3U0YA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with compound 382 and udp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
288
structure length
288
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title A novel compound from a molecular fragment library screen inhibits glycosyltransferases by displacing the metal ion and interfering with substrate binding
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u0yA00
2D0JA 2D7IA 4J18A 4Y9XA 1NHEB 1ZI3A 3D5NA 3KIAA 3PKQA 5C8RA 2QH5A 2X65A 5FV9A 1ZHJA 1HJLA 2YQCA 2P6WA 1H5SD 3Q4SA 3T7NA 4B42A 2MZBA 1OMZA 1JVDA 1H5TA 5EJZA 3ZLLA 5C4DA 2WVLA 1FO8A 3I0FA 3IOHA 4EEGA 1VPAA 3CKNA 2RIXA 4R7PA 5CMGX 3CKOA 1JVGA 1FZWA 2WAWA 3GUEA 5FTSA 4KNRA 4MYBA 5C4FA 3BRKX 3ZLKA 1V83A 3ZGFA 2JCOA 3E26A 4E1KA 2WE9A 1E5KA 1VH3A 2V0HA 1S4OA 4P02A 1FGXA 3ST8A 3DK5A 4D11C 1GA8A 1HV9A 1OMXA 4DE7A 3V8YA 2RJ6A 5CQLX 2VS4A 1VH1A 2P73A 5HS2A 5L6VA 2I7BA 2PGYA 3SXBA 1V82A 4HO6A 1R7YA 2YESA 4D0TA 2AH9A 2YC3A 2VXMA 2BO6A 1JV3A 2I5EA 1EYRA 1H3MA 1YP2A 5C49A 1GX0A 3SX5A 2WEEA 1O7QA 4Y7TA 2Z86A 4EEMA 2XWLA 1ZCVA 4FRMA 4HO4A 4DECA 2VSHA 1WT2A 2FYBA 4Y6NA 1W57A 3R3IA 4M28A 1G8OA 4G3SA 2VS3A 3USQA 1NMMB 4LW3A 2VS5A 2XMHA 1G23A 1MC3A 2NXVA 3OAMA 1PZYB 4D48A 2AE7A 1VZXA 4HO8A 4EEOA 2BO4A 3U2VA 2CU2A 5FYEA 1R7TA 5C3AA 5CQOA 5C1GA 2WVMA 1WSZA 4G3QA 3NGWA 3OH2A 3TZTA 1O23B 1ZI4A 3CU0A 5CQPA 3V91A 4ARWA 4B3UA 2Y4KA 1W77A 4Y7GA 3K8DA 1XZ6A 1FR9A 4XWIA 5FUHA 1IINA 3CGXA 4AAWA 3FOQA 1G1LA 4JD0A 2XWMA 2RJ7A 1ZIZA 4HO0A 2JCKA 2FFVA 2ZU7A 4HO2A 1VGZA 1GX4A 4HCQA 4M2BA 1G9RA 1FO9A 3EE5A 2RJ4A 2V0IA 2O1HA 2FFUA 1R7XA 5CMFX 2YCMA 4YS8A 2A8UA 2PA4A 5I1FA 5JQQA 1Z90A 4FRLA 1S4PA 1LVWA 1MP3A 4ASJA 1G93A 1G2VA 1TW5A 1H7HA 4Y63A 3I0JA 3Q7UA 5FU8A 1MP4A 2V0JA 3U0YA 4NAKA 2VSIA 1QG8A 2PX7A 4P00A 1ZJ2A 2X60A 1LL3A 2WGZA 4FRBA 3U2XA 2OEGA 4KQLA 1MP5A 4L41C 4NALA 1ZJ1A 4FRAA 1H5RA 2RJ9A 5AJPA 3TQDA 1ZCTA 1R7UA 5C38A 2AM3A 4Y7UA 2FYCB 2FYDB 3IOIA 5IFYA 3SXEA 1GWWA 1H5SB 5BXCA 1NF5B 1TW1A 2JCJA 2X5ZA 1W55A 2RITA 1LZJA 3I0HA 2RJ5A 4B5BA 5C4BA 3DJ4A 4M4KA 3ZF8A 5C4EA 2ZU9A 2AM5A 4FREA 3O3PA 1PZTA 3OH4A 4CJCA 3OGZA 1JYLA 3QVBA 1QGQA 3I0IX 1IIMA 1H5SC 1H5TB 1LZ7A 3T7OA 1VGWA 1GWVA 1YP3A 1I52A 3SXCA 4EE5A 1LL2A 2YC5A 3N9WA 3OC9A 2AESA 4FRQA 2YQJA 3R2WA 2Y6PA 1ZI1A 3JUKA 4ZDQA 4Y64A 3Q80A 4AYJA 4NAIA 1JYKA 2RJ0A 4KC2A 4Y6UA 4B4MA 2YQSA 1G95A 5IDTA 1WT3A 4FCEA 3D8VA 4DDZA 1R7VA 1ZJ3A 5C1LA 2RIYA 4EE4A 1HM8A 2VD4A 2QGIA 2Y7AA 1QWJA 3V0PA 3FWWA 3V8ZA 5DDTA 4MNDA 1H7TA 5CMIA 5FU0A 3V0QA 3BCVA 4KXOA 4KC1A 3SXDA 4FCUA 2E3DA 2V0KA 2QKXA 1KWSA 4K6RA 1ON8A 5EJ1A 4FROA 4Y62A 4D11A 1WT1A 5DDVA 1H7QA 3HL3A 1O0RA 3DUVA 3LW6A 4EE3A 5C48A 3RMVA 4KC4A 1WT0A 1NKHB 4HOCA 1FOAA 1G3LA 1JV1A 3I0DA 5C47A 3K8EA 1ZI5A 5CQNX 1NWGB 1INJA 3POLA 1FXOA 1H7LA 4ECMA 2OI5A 1G97A 2A8WA 4HO3A 4EVWA 4D0ZA 5L6SA 2DPWA 1FGGA 1H7FA 2VXLA 3I0LA 3SXGA 1ZJOA 3U2WA 4B2XA 3OH1A 4KPXA 2D7RA 2P72A 2PGVA 4HO5A 4B4GA 2Y4LA 3OH3A 3V90A 5CMJA 3SX8A 3F1CA 1S4NA 1QGSA 4AYLA 1R80A 4GBPA 1K4VA 4CJ8A 1ZJPA 2FYAA 3V0LA 1EZIA 3CKVA 4KT7A 3JUJA 2W0VA 2OEFA 4AC3A 1R82A 2OI7A 2V0LA 3PKPA 1H7GA 3V0OA 3PNNA 4BQHA 1NQIB 1H4DA 4FRPA 1FG5N 4FQWA 3OKRA 2O1FA 4FRHA 4FRDA 3JTJA 4KPZA 1VICA 1FWYA 2VFZA 4LW6A 1H7EA 1H4EA 2JCLA 3IOJA 3U0XA 1ZCUA 3I0GA 3V0MA 2RIZA 1ZJ0A 4JISA 3SX7A 2Q4JA 1FRWA 2AM4A 4M2AA 3I0KA 1V84A 1O7OA 1G0RA 2RJ1A 2RJ8A 5FTVA 3RSBA 3V0NA 4HO9A 4B2WA 2X5SA 1TVYA 3I0EA 3U2UA 2ICXA 3E25A 5C3DA 2Y4MA 3SPTA 1GQCA 1VZUA 1INIA 4NANA 3U2TA 5CQMX 4KNXA 1H5RB 2APCA 3SXAA 4CVHA 1YROB 3D98A 1H4CA 1XHBA 2UX8A 4Y7FA 1LL0A 1OQMB 2I5KA 2YQHA 3ZGGA 1HM0A 1VM8A 2AECA 1VZTA 1ZCYA 1VGTA 1ON6A 2XMEA 3RMWA 5C1HA 2W0WA 4UEGA 3T7MA 1VGUA 1GQ9A 1HJJA 2GGOA 4G87A 5AJOA 2BO8A 3CKJA 5C4CA 2ICYA 4C2SA 4IRQA 2WVKA 4B4BA 5J49A 5C36A 1FR8A 2GGQA 4ASYA 2AGDA 3SX3A 1SS9A 2BO7A 1ZDGA 3USRA 1TZFA 1HM9A 4KRVA 4EEAA 5C3BA 4BMAA 4CJBA 2E8BA 1LZIA 1WVCA 1YP4A 1ZDFA 4G3PA 1LZ0A 3CKQA 5AJNA 5IDSA 3F1YA 2Y4JA 1R81A 1FXJA 2OI6A 2ZU8A 4Y7VA 1H5SA 3OH0A 4IRPA 4HG6A 2O1GA 5CMHA 2XWNA 2FY7A 5EIYA 3I0CA 2Z87A
chains in the Genus database with same CATH superfamily
2D0JA 2D7IA 4J18A 4Y9XA 4FIXA 1NHEB 1ZI3A 3D5NA 3KIAA 3PKQA 5C8RA 2QH5A 2X65A 4MIXA 5FV9A 1ZHJA 1HJLA 2YQCA 2P6WA 1H5SD 3Q4SA 3T7NA 4B42A 2MZBA 1OMZA 1JVDA 1H5TA 5EJZA 3ZLLA 5C4DA 2WVLA 1FO8A 3I0FA 3IOHA 4EEGA 1VPAA 3CKNA 2RIXA 4R7PA 5CMGX 3CKOA 1JVGA 1FZWA 2WAWA 3GUEA 5FTSA 4KNRA 4MYBA 5C4FA 3BRKX 3ZLKA 1V83A 3ZGFA 2JCOA 3E26A 4E1KA 2WE9A 1E5KA 1VH3A 2V0HA 1S4OA 4P02A 1FGXA 3ST8A 3DK5A 4D11C 1GA8A 1HV9A 1OMXA 4DE7A 3V8YA 2RJ6A 5CQLX 2VS4A 1VH1A 2P73A 5HS2A 5L6VA 2I7BA 2PGYA 3SXBA 1V82A 4HO6A 1R7YA 2YESA 4D0TA 2AH9A 2YC3A 2VXMA 2BO6A 1JV3A 2I5EA 1EYRA 1H3MA 1YP2A 2J0AA 5C49A 1GX0A 3SX5A 2WEEA 1O7QA 4Y7TA 2Z86A 4EEMA 2XWLA 1ZCVA 4FRMA 4HO4A 4DECA 2VSHA 1WT2A 2FYBA 4Y6NA 1W57A 3R3IA 4M28A 1G8OA 4G3SA 2VS3A 3USQA 1NMMB 4LW3A 2VS5A 2XMHA 1G23A 1MC3A 2NXVA 3OAMA 1PZYB 4D48A 2AE7A 1VZXA 4HO8A 4EEOA 2BO4A 4O6MA 3U2VA 2CU2A 5FYEA 1R7TA 5C3AA 5CQOA 5C1GA 2WVMA 1WSZA 4G3QA 3NGWA 3OH2A 3TZTA 1O23B 1ZI4A 3CU0A 5CQPA 3V91A 4ARWA 4B3UA 2Y4KA 1W77A 4Y7GA 3K8DA 1XZ6A 1FR9A 4XWIA 5FUHA 1IINA 3CGXA 4AAWA 3FOQA 1G1LA 4JD0A 2XWMA 2RJ7A 1ZIZA 4HO0A 2JCKA 2FFVA 2ZU7A 4HO2A 1VGZA 1GX4A 4HCQA 4M2BA 1G9RA 1FO9A 3EE5A 2RJ4A 2V0IA 2O1HA 2FFUA 1R7XA 5CMFX 2YCMA 4YS8A 2A8UA 2PA4A 5I1FA 5JQQA 1Z90A 4FRLA 1S4PA 1LVWA 1MP3A 4ASJA 1G93A 1G2VA 1TW5A 1H7HA 4Y63A 4O6NA 3I0JA 3Q7UA 5FU8A 1MP4A 2V0JA 3U0YA 4NAKA 2VSIA 1QG8A 2PX7A 4P00A 1ZJ2A 2X60A 1LL3A 2WGZA 4FRBA 3U2XA 2OEGA 4KQLA 1MP5A 4L41C 4NALA 1ZJ1A 4FRAA 1H5RA 2RJ9A 5AJPA 3TQDA 1ZCTA 1R7UA 5C38A 2AM3A 4Y7UA 2FYCB 2FYDB 3IOIA 5IFYA 3SXEA 1GWWA 1H5SB 5D91A 5BXCA 1NF5B 1TW1A 2JCJA 2X5ZA 1W55A 2RITA 1LZJA 3I0HA 2RJ5A 4B5BA 5C4BA 3DJ4A 4M4KA 3ZF8A 5C4EA 2ZU9A 2AM5A 4FREA 3O3PA 1PZTA 3OH4A 4CJCA 3OGZA 1JYLA 3QVBA 4Q7CA 1QGQA 3I0IX 1IIMA 1H5SC 1H5TB 2J0BA 1LZ7A 3T7OA 1VGWA 1GWVA 1YP3A 1I52A 3SXCA 4EE5A 1LL2A 2YC5A 3N9WA 3OC9A 2AESA 4FRQA 2YQJA 3R2WA 2Y6PA 1ZI1A 3JUKA 4ZDQA 4Y64A 3Q80A 4AYJA 4FIYA 4NAIA 1JYKA 2RJ0A 4KC2A 4Y6UA 4B4MA 2YQSA 1G95A 5IDTA 1WT3A 4FCEA 3D8VA 4DDZA 1R7VA 1ZJ3A 5C1LA 2RIYA 4EE4A 1HM8A 2VD4A 2QGIA 2Y7AA 1QWJA 3V0PA 3FWWA 3V8ZA 5DDTA 4MNDA 1H7TA 5CMIA 5FU0A 3V0QA 3BCVA 4KXOA 4KC1A 3SXDA 4FCUA 2E3DA 2V0KA 2QKXA 1KWSA 4K6RA 1ON8A 5EJ1A 4FROA 4Y62A 4D11A 1WT1A 5DDVA 1H7QA 3HL3A 1O0RA 3DUVA 3LW6A 4EE3A 5C48A 3RMVA 4KC4A 1WT0A 1NKHB 4HOCA 1FOAA 1G3LA 1JV1A 3I0DA 5C47A 3K8EA 2C0NA 1ZI5A 5CQNX 1NWGB 1INJA 3POLA 1FXOA 1H7LA 4ECMA 2OI5A 1G97A 2A8WA 4HO3A 4EVWA 4D0ZA 5L6SA 2DPWA 1FGGA 1H7FA 2VXLA 3I0LA 3SXGA 1ZJOA 3U2WA 4B2XA 3OH1A 4KPXA 2D7RA 2P72A 2PGVA 4HO5A 4B4GA 2Y4LA 3OH3A 3V90A 5CMJA 3SX8A 3F1CA 1S4NA 1QGSA 4AYLA 1R80A 4GBPA 1K4VA 4CJ8A 1ZJPA 2FYAA 3V0LA 1EZIA 3CKVA 4KT7A 3JUJA 2W0VA 2OEFA 4AC3A 1R82A 2OI7A 2V0LA 3PKPA 1H7GA 3V0OA 3PNNA 4BQHA 1NQIB 1H4DA 4FRPA 1FG5N 4FQWA 3OKRA 2O1FA 4FRHA 4FRDA 3JTJA 4KPZA 1VICA 1FWYA 2VFZA 4LW6A 1H7EA 1H4EA 2JCLA 3IOJA 3U0XA 1ZCUA 3I0GA 3V0MA 2RIZA 1ZJ0A 4JISA 3SX7A 2Q4JA 1FRWA 2AM4A 4M2AA 3I0KA 1V84A 1O7OA 1G0RA 2RJ1A 2RJ8A 5FTVA 3RSBA 3V0NA 4HO9A 4B2WA 2X5SA 1TVYA 3I0EA 3U2UA 2ICXA 3E25A 5C3DA 2Y4MA 3SPTA 1GQCA 1VZUA 1INIA 4NANA 3U2TA 5CQMX 4KNXA 1H5RB 2APCA 3SXAA 4CVHA 1YROB 3D98A 1H4CA 1XHBA 2UX8A 4Y7FA 1LL0A 1OQMB 2I5KA 2YQHA 3ZGGA 1HM0A 1VM8A 2AECA 1VZTA 1ZCYA 1VGTA 1ON6A 2XMEA 3RMWA 5C1HA 2W0WA 4UEGA 3T7MA 1VGUA 1GQ9A 1HJJA 2GGOA 4G87A 5AJOA 2BO8A 3CKJA 5C4CA 2ICYA 4C2SA 4IRQA 2WVKA 4B4BA 5J49A 5C36A 1FR8A 2VK9A 2GGQA 4ASYA 2AGDA 3SX3A 1SS9A 2BO7A 1ZDGA 3USRA 1TZFA 1HM9A 4KRVA 4EEAA 5C3BA 4BMAA 5D92A 4CJBA 2E8BA 1LZIA 1WVCA 1YP4A 1ZDFA 4G3PA 1LZ0A 3CKQA 5AJNA 5IDSA 3F1YA 2Y4JA 1R81A 1FXJA 2OI6A 2ZU8A 4Y7VA 1H5SA 3OH0A 4IRPA 4HG6A 2O1GA 5CMHA 2XWNA 2FY7A 5EIYA 3I0CA 2Z87A
chains in the Genus database with same CATH topology
2D0JA 2D7IA 4J18A 4Y9XA 4FIXA 1NHEB 1ZI3A 3D5NA 3KIAA 3PKQA 5C8RA 2QH5A 2X65A 4MIXA 5FV9A 1ZHJA 1HJLA 2YQCA 2P6WA 1H5SD 3Q4SA 3T7NA 4B42A 2MZBA 1OMZA 1JVDA 1H5TA 5EJZA 3ZLLA 5C4DA 2WVLA 1FO8A 3I0FA 3IOHA 4EEGA 1VPAA 3CKNA 2RIXA 4R7PA 5CMGX 3CKOA 1JVGA 1FZWA 2WAWA 3GUEA 5FTSA 4KNRA 4MYBA 5C4FA 3BRKX 3ZLKA 1V83A 3ZGFA 2JCOA 3E26A 4E1KA 2WE9A 1E5KA 1VH3A 2V0HA 1S4OA 4P02A 1FGXA 3ST8A 3DK5A 4D11C 1GA8A 1HV9A 1OMXA 4DE7A 3V8YA 2RJ6A 5CQLX 2VS4A 1VH1A 2P73A 5HS2A 5L6VA 2I7BA 2PGYA 3SXBA 1V82A 4HO6A 1R7YA 2YESA 4D0TA 2AH9A 2YC3A 2VXMA 2BO6A 1JV3A 2I5EA 1EYRA 1H3MA 1YP2A 2J0AA 5C49A 1GX0A 3SX5A 2WEEA 1O7QA 4Y7TA 2Z86A 4EEMA 2XWLA 1ZCVA 4FRMA 4HO4A 4DECA 2VSHA 1WT2A 2FYBA 4Y6NA 1W57A 3R3IA 4M28A 1G8OA 4G3SA 2VS3A 3USQA 1NMMB 4LW3A 2VS5A 2XMHA 1G23A 1MC3A 2NXVA 3OAMA 1PZYB 4D48A 2AE7A 1VZXA 4HO8A 4EEOA 2BO4A 4O6MA 3U2VA 2CU2A 5FYEA 1R7TA 5C3AA 5CQOA 5C1GA 2WVMA 1WSZA 4G3QA 3NGWA 3OH2A 3TZTA 1O23B 1ZI4A 3CU0A 5CQPA 3V91A 4ARWA 4B3UA 2Y4KA 1W77A 4Y7GA 3K8DA 1XZ6A 1FR9A 4XWIA 5FUHA 1IINA 3CGXA 4AAWA 3FOQA 1G1LA 4JD0A 2XWMA 2RJ7A 1ZIZA 4HO0A 2JCKA 2FFVA 2ZU7A 4HO2A 1VGZA 1GX4A 4HCQA 4M2BA 1G9RA 1FO9A 3EE5A 2RJ4A 2V0IA 2O1HA 2FFUA 1R7XA 5CMFX 2YCMA 4YS8A 2A8UA 2PA4A 5I1FA 5JQQA 1Z90A 4FRLA 1S4PA 1LVWA 1MP3A 4ASJA 1G93A 1G2VA 1TW5A 1H7HA 4Y63A 4O6NA 3I0JA 3Q7UA 5FU8A 1MP4A 2V0JA 3U0YA 4NAKA 2VSIA 1QG8A 2PX7A 4P00A 1ZJ2A 2X60A 1LL3A 2WGZA 4FRBA 3U2XA 2OEGA 4KQLA 1MP5A 4L41C 4NALA 1ZJ1A 4FRAA 1H5RA 2RJ9A 5AJPA 3TQDA 1ZCTA 1R7UA 5C38A 2AM3A 4Y7UA 2FYCB 2FYDB 3IOIA 5IFYA 3SXEA 1GWWA 1H5SB 5D91A 5BXCA 1NF5B 1TW1A 2JCJA 2X5ZA 1W55A 2RITA 1LZJA 3I0HA 2RJ5A 4B5BA 5C4BA 3DJ4A 4M4KA 3ZF8A 5C4EA 2ZU9A 2AM5A 4FREA 3O3PA 1PZTA 3OH4A 4CJCA 3OGZA 1JYLA 3QVBA 4Q7CA 1QGQA 3I0IX 1IIMA 1H5SC 1H5TB 2J0BA 1LZ7A 3T7OA 1VGWA 1GWVA 1YP3A 1I52A 3SXCA 4EE5A 1LL2A 2YC5A 3N9WA 3OC9A 2AESA 4FRQA 2YQJA 3R2WA 2Y6PA 1ZI1A 3JUKA 4ZDQA 4Y64A 3Q80A 4AYJA 4FIYA 4NAIA 1JYKA 2RJ0A 4KC2A 4Y6UA 4B4MA 2YQSA 1G95A 5IDTA 1WT3A 4FCEA 3D8VA 4DDZA 1R7VA 1ZJ3A 5C1LA 2RIYA 4EE4A 1HM8A 2VD4A 2QGIA 2Y7AA 1QWJA 3V0PA 3FWWA 3V8ZA 5DDTA 4MNDA 1H7TA 5CMIA 5FU0A 3V0QA 3BCVA 4KXOA 4KC1A 3SXDA 4FCUA 2E3DA 2V0KA 2QKXA 1KWSA 4K6RA 1ON8A 5EJ1A 4FROA 4Y62A 4D11A 1WT1A 5DDVA 1H7QA 3HL3A 1O0RA 3DUVA 3LW6A 4EE3A 5C48A 3RMVA 4KC4A 1WT0A 1NKHB 4HOCA 1FOAA 1G3LA 1JV1A 3I0DA 5C47A 3K8EA 2C0NA 1ZI5A 5CQNX 1NWGB 1INJA 3POLA 1FXOA 1H7LA 4ECMA 2OI5A 1G97A 2A8WA 4HO3A 4EVWA 4D0ZA 5L6SA 2DPWA 1FGGA 1H7FA 2VXLA 3I0LA 3SXGA 1ZJOA 3U2WA 4B2XA 3OH1A 4KPXA 2D7RA 2P72A 2PGVA 4HO5A 4B4GA 2Y4LA 3OH3A 3V90A 5CMJA 3SX8A 3F1CA 1S4NA 1QGSA 4AYLA 1R80A 4GBPA 1K4VA 4CJ8A 1ZJPA 2FYAA 3V0LA 1EZIA 3CKVA 4KT7A 3JUJA 2W0VA 2OEFA 4AC3A 1R82A 2OI7A 2V0LA 3PKPA 1H7GA 3V0OA 3PNNA 4BQHA 1NQIB 1H4DA 4FRPA 1FG5N 4FQWA 3OKRA 2O1FA 4FRHA 4FRDA 3JTJA 4KPZA 1VICA 1FWYA 2VFZA 4LW6A 1H7EA 1H4EA 2JCLA 3IOJA 3U0XA 1ZCUA 3I0GA 3V0MA 2RIZA 1ZJ0A 4JISA 3SX7A 2Q4JA 1FRWA 2AM4A 4M2AA 3I0KA 1V84A 1O7OA 1G0RA 2RJ1A 2RJ8A 5FTVA 3RSBA 3V0NA 4HO9A 4B2WA 2X5SA 1TVYA 3I0EA 3U2UA 2ICXA 3E25A 5C3DA 2Y4MA 3SPTA 1GQCA 1VZUA 1INIA 4NANA 3U2TA 5CQMX 4KNXA 1H5RB 2APCA 3SXAA 4CVHA 1YROB 3D98A 1H4CA 1XHBA 2UX8A 4Y7FA 1LL0A 1OQMB 2I5KA 2YQHA 3ZGGA 1HM0A 1VM8A 2AECA 1VZTA 1ZCYA 1VGTA 1ON6A 2XMEA 3RMWA 5C1HA 2W0WA 4UEGA 3T7MA 1VGUA 1GQ9A 1HJJA 2GGOA 4G87A 5AJOA 2BO8A 3CKJA 5C4CA 2ICYA 4C2SA 4IRQA 2WVKA 4B4BA 5J49A 5C36A 1FR8A 2VK9A 2GGQA 4ASYA 2AGDA 3SX3A 1SS9A 2BO7A 1ZDGA 3USRA 1TZFA 1HM9A 4KRVA 4EEAA 5C3BA 4BMAA 5D92A 4CJBA 2E8BA 1LZIA 1WVCA 1YP4A 1ZDFA 4G3PA 1LZ0A 3CKQA 5AJNA 5IDSA 3F1YA 2Y4JA 1R81A 1FXJA 2OI6A 2ZU8A 4Y7VA 1H5SA 3OH0A 4IRPA 4HG6A 2O1GA 5CMHA 2XWNA 2FY7A 5EIYA 3I0CA 2Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0J A;  2D7I A;  4J18 A;  4Y9X A;  1NHE B;  1ZI3 A;  3D5N A;  3KIA A;  3PKQ A;  5C8R A;  2QH5 A;  2X65 A;  5FV9 A;  1ZHJ A;  1HJL A;  2YQC A;  2P6W A;  1H5S D;  3Q4S A;  3T7N A;  4B42 A;  2MZB A;  1OMZ A;  1JVD A;  1H5T A;  5EJZ A;  3ZLL A;  5C4D A;  2WVL A;  1FO8 A;  3I0F A;  3IOH A;  4EEG A;  1VPA A;  3CKN A;  2RIX A;  4R7P A;  5CMG X;  3CKO A;  1JVG A;  1FZW A;  2WAW A;  3GUE A;  5FTS A;  4KNR A;  4MYB A;  5C4F A;  3BRK X;  3ZLK A;  1V83 A;  3ZGF A;  2JCO A;  3E26 A;  4E1K A;  2WE9 A;  1E5K A;  1VH3 A;  2V0H A;  1S4O A;  4P02 A;  1FGX A;  3ST8 A;  3DK5 A;  4D11 C;  1GA8 A;  1HV9 A;  1OMX A;  4DE7 A;  3V8Y A;  2RJ6 A;  5CQL X;  2VS4 A;  1VH1 A;  2P73 A;  5HS2 A;  5L6V A;  2I7B A;  2PGY A;  3SXB A;  1V82 A;  4HO6 A;  1R7Y A;  2YES A;  4D0T A;  2AH9 A;  2YC3 A;  2VXM A;  2BO6 A;  1JV3 A;  2I5E A;  1EYR A;  1H3M A;  1YP2 A;  5C49 A;  1GX0 A;  3SX5 A;  2WEE A;  1O7Q A;  4Y7T A;  2Z86 A;  4EEM A;  2XWL A;  1ZCV A;  4FRM A;  4HO4 A;  4DEC A;  2VSH A;  1WT2 A;  2FYB A;  4Y6N A;  1W57 A;  3R3I A;  4M28 A;  1G8O A;  4G3S A;  2VS3 A;  3USQ A;  1NMM B;  4LW3 A;  2VS5 A;  2XMH A;  1G23 A;  1MC3 A;  2NXV A;  3OAM A;  1PZY B;  4D48 A;  2AE7 A;  1VZX A;  4HO8 A;  4EEO A;  2BO4 A;  3U2V A;  2CU2 A;  5FYE A;  1R7T A;  5C3A A;  5CQO A;  5C1G A;  2WVM A;  1WSZ A;  4G3Q A;  3NGW A;  3OH2 A;  3TZT A;  1O23 B;  1ZI4 A;  3CU0 A;  5CQP A;  3V91 A;  4ARW A;  4B3U A;  2Y4K A;  1W77 A;  4Y7G A;  3K8D A;  1XZ6 A;  1FR9 A;  4XWI A;  5FUH A;  1IIN A;  3CGX A;  4AAW A;  3FOQ A;  1G1L A;  4JD0 A;  2XWM A;  2RJ7 A;  1ZIZ A;  4HO0 A;  2JCK A;  2FFV A;  2ZU7 A;  4HO2 A;  1VGZ A;  1GX4 A;  4HCQ A;  4M2B A;  1G9R A;  1FO9 A;  3EE5 A;  2RJ4 A;  2V0I A;  2O1H A;  2FFU A;  1R7X A;  5CMF X;  2YCM A;  4YS8 A;  2A8U A;  2PA4 A;  5I1F A;  5JQQ A;  1Z90 A;  4FRL A;  1S4P A;  1LVW A;  1MP3 A;  4ASJ A;  1G93 A;  1G2V A;  1TW5 A;  1H7H A;  4Y63 A;  3I0J A;  3Q7U A;  5FU8 A;  1MP4 A;  2V0J A;  3U0Y A;  4NAK A;  2VSI A;  1QG8 A;  2PX7 A;  4P00 A;  1ZJ2 A;  2X60 A;  1LL3 A;  2WGZ A;  4FRB A;  3U2X A;  2OEG A;  4KQL A;  1MP5 A;  4L41 C;  4NAL A;  1ZJ1 A;  4FRA A;  1H5R A;  2RJ9 A;  5AJP A;  3TQD A;  1ZCT A;  1R7U A;  5C38 A;  2AM3 A;  4Y7U A;  2FYC B;  2FYD B;  3IOI A;  5IFY A;  3SXE A;  1GWW A;  1H5S B;  5BXC A;  1NF5 B;  1TW1 A;  2JCJ A;  2X5Z A;  1W55 A;  2RIT A;  1LZJ A;  3I0H A;  2RJ5 A;  4B5B A;  5C4B A;  3DJ4 A;  4M4K A;  3ZF8 A;  5C4E A;  2ZU9 A;  2AM5 A;  4FRE A;  3O3P A;  1PZT A;  3OH4 A;  4CJC A;  3OGZ A;  1JYL A;  3QVB A;  1QGQ A;  3I0I X;  1IIM A;  1H5S C;  1H5T B;  1LZ7 A;  3T7O A;  1VGW A;  1GWV A;  1YP3 A;  1I52 A;  3SXC A;  4EE5 A;  1LL2 A;  2YC5 A;  3N9W A;  3OC9 A;  2AES A;  4FRQ A;  2YQJ A;  3R2W A;  2Y6P A;  1ZI1 A;  3JUK A;  4ZDQ A;  4Y64 A;  3Q80 A;  4AYJ A;  4NAI A;  1JYK A;  2RJ0 A;  4KC2 A;  4Y6U A;  4B4M A;  2YQS A;  1G95 A;  5IDT A;  1WT3 A;  4FCE A;  3D8V A;  4DDZ A;  1R7V A;  1ZJ3 A;  5C1L A;  2RIY A;  4EE4 A;  1HM8 A;  2VD4 A;  2QGI A;  2Y7A A;  1QWJ A;  3V0P A;  3FWW A;  3V8Z A;  5DDT A;  4MND A;  1H7T A;  5CMI A;  5FU0 A;  3V0Q A;  3BCV A;  4KXO A;  4KC1 A;  3SXD A;  4FCU A;  2E3D A;  2V0K A;  2QKX A;  1KWS A;  4K6R A;  1ON8 A;  5EJ1 A;  4FRO A;  4Y62 A;  4D11 A;  1WT1 A;  5DDV A;  1H7Q A;  3HL3 A;  1O0R A;  3DUV A;  3LW6 A;  4EE3 A;  5C48 A;  3RMV A;  4KC4 A;  1WT0 A;  1NKH B;  4HOC A;  1FOA A;  1G3L A;  1JV1 A;  3I0D A;  5C47 A;  3K8E A;  1ZI5 A;  5CQN X;  1NWG B;  1INJ A;  3POL A;  1FXO A;  1H7L A;  4ECM A;  2OI5 A;  1G97 A;  2A8W A;  4HO3 A;  4EVW A;  4D0Z A;  5L6S A;  2DPW A;  1FGG A;  1H7F A;  2VXL A;  3I0L A;  3SXG A;  1ZJO A;  3U2W A;  4B2X A;  3OH1 A;  4KPX A;  2D7R A;  2P72 A;  2PGV A;  4HO5 A;  4B4G A;  2Y4L A;  3OH3 A;  3V90 A;  5CMJ A;  3SX8 A;  3F1C A;  1S4N A;  1QGS A;  4AYL A;  1R80 A;  4GBP A;  1K4V A;  4CJ8 A;  1ZJP A;  2FYA A;  3V0L A;  1EZI A;  3CKV A;  4KT7 A;  3JUJ A;  2W0V A;  2OEF A;  4AC3 A;  1R82 A;  2OI7 A;  2V0L A;  3PKP A;  1H7G A;  3V0O A;  3PNN A;  4BQH A;  1NQI B;  1H4D A;  4FRP A;  1FG5 N;  4FQW A;  3OKR A;  2O1F A;  4FRH A;  4FRD A;  3JTJ A;  4KPZ A;  1VIC A;  1FWY A;  2VFZ A;  4LW6 A;  1H7E A;  1H4E A;  2JCL A;  3IOJ A;  3U0X A;  1ZCU A;  3I0G A;  3V0M A;  2RIZ A;  1ZJ0 A;  4JIS A;  3SX7 A;  2Q4J A;  1FRW A;  2AM4 A;  4M2A A;  3I0K A;  1V84 A;  1O7O A;  1G0R A;  2RJ1 A;  2RJ8 A;  5FTV A;  3RSB A;  3V0N A;  4HO9 A;  4B2W A;  2X5S A;  1TVY A;  3I0E A;  3U2U A;  2ICX A;  3E25 A;  5C3D A;  2Y4M A;  3SPT A;  1GQC A;  1VZU A;  1INI A;  4NAN A;  3U2T A;  5CQM X;  4KNX A;  1H5R B;  2APC A;  3SXA A;  4CVH A;  1YRO B;  3D98 A;  1H4C A;  1XHB A;  2UX8 A;  4Y7F A;  1LL0 A;  1OQM B;  2I5K A;  2YQH A;  3ZGG A;  1HM0 A;  1VM8 A;  2AEC A;  1VZT A;  1ZCY A;  1VGT A;  1ON6 A;  2XME A;  3RMW A;  5C1H A;  2W0W A;  4UEG A;  3T7M A;  1VGU A;  1GQ9 A;  1HJJ A;  2GGO A;  4G87 A;  5AJO A;  2BO8 A;  3CKJ A;  5C4C A;  2ICY A;  4C2S A;  4IRQ A;  2WVK A;  4B4B A;  5J49 A;  5C36 A;  1FR8 A;  2GGQ A;  4ASY A;  2AGD A;  3SX3 A;  1SS9 A;  2BO7 A;  1ZDG A;  3USR A;  1TZF A;  1HM9 A;  4KRV A;  4EEA A;  5C3B A;  4BMA A;  4CJB A;  2E8B A;  1LZI A;  1WVC A;  1YP4 A;  1ZDF A;  4G3P A;  1LZ0 A;  3CKQ A;  5AJN A;  5IDS A;  3F1Y A;  2Y4J A;  1R81 A;  1FXJ A;  2OI6 A;  2ZU8 A;  4Y7V A;  1H5S A;  3OH0 A;  4IRP A;  4HG6 A;  2O1G A;  5CMH A;  2XWN A;  2FY7 A;  5EIY A;  3I0C A;  2Z87 A; 
#chains in the Genus database with same CATH topology
 2D0J A;  2D7I A;  4J18 A;  4Y9X A;  4FIX A;  1NHE B;  1ZI3 A;  3D5N A;  3KIA A;  3PKQ A;  5C8R A;  2QH5 A;  2X65 A;  4MIX A;  5FV9 A;  1ZHJ A;  1HJL A;  2YQC A;  2P6W A;  1H5S D;  3Q4S A;  3T7N A;  4B42 A;  2MZB A;  1OMZ A;  1JVD A;  1H5T A;  5EJZ A;  3ZLL A;  5C4D A;  2WVL A;  1FO8 A;  3I0F A;  3IOH A;  4EEG A;  1VPA A;  3CKN A;  2RIX A;  4R7P A;  5CMG X;  3CKO A;  1JVG A;  1FZW A;  2WAW A;  3GUE A;  5FTS A;  4KNR A;  4MYB A;  5C4F A;  3BRK X;  3ZLK A;  1V83 A;  3ZGF A;  2JCO A;  3E26 A;  4E1K A;  2WE9 A;  1E5K A;  1VH3 A;  2V0H A;  1S4O A;  4P02 A;  1FGX A;  3ST8 A;  3DK5 A;  4D11 C;  1GA8 A;  1HV9 A;  1OMX A;  4DE7 A;  3V8Y A;  2RJ6 A;  5CQL X;  2VS4 A;  1VH1 A;  2P73 A;  5HS2 A;  5L6V A;  2I7B A;  2PGY A;  3SXB A;  1V82 A;  4HO6 A;  1R7Y A;  2YES A;  4D0T A;  2AH9 A;  2YC3 A;  2VXM A;  2BO6 A;  1JV3 A;  2I5E A;  1EYR A;  1H3M A;  1YP2 A;  2J0A A;  5C49 A;  1GX0 A;  3SX5 A;  2WEE A;  1O7Q A;  4Y7T A;  2Z86 A;  4EEM A;  2XWL A;  1ZCV A;  4FRM A;  4HO4 A;  4DEC A;  2VSH A;  1WT2 A;  2FYB A;  4Y6N A;  1W57 A;  3R3I A;  4M28 A;  1G8O A;  4G3S A;  2VS3 A;  3USQ A;  1NMM B;  4LW3 A;  2VS5 A;  2XMH A;  1G23 A;  1MC3 A;  2NXV A;  3OAM A;  1PZY B;  4D48 A;  2AE7 A;  1VZX A;  4HO8 A;  4EEO A;  2BO4 A;  4O6M A;  3U2V A;  2CU2 A;  5FYE A;  1R7T A;  5C3A A;  5CQO A;  5C1G A;  2WVM A;  1WSZ A;  4G3Q A;  3NGW A;  3OH2 A;  3TZT A;  1O23 B;  1ZI4 A;  3CU0 A;  5CQP A;  3V91 A;  4ARW A;  4B3U A;  2Y4K A;  1W77 A;  4Y7G A;  3K8D A;  1XZ6 A;  1FR9 A;  4XWI A;  5FUH A;  1IIN A;  3CGX A;  4AAW A;  3FOQ A;  1G1L A;  4JD0 A;  2XWM A;  2RJ7 A;  1ZIZ A;  4HO0 A;  2JCK A;  2FFV A;  2ZU7 A;  4HO2 A;  1VGZ A;  1GX4 A;  4HCQ A;  4M2B A;  1G9R A;  1FO9 A;  3EE5 A;  2RJ4 A;  2V0I A;  2O1H A;  2FFU A;  1R7X A;  5CMF X;  2YCM A;  4YS8 A;  2A8U A;  2PA4 A;  5I1F A;  5JQQ A;  1Z90 A;  4FRL A;  1S4P A;  1LVW A;  1MP3 A;  4ASJ A;  1G93 A;  1G2V A;  1TW5 A;  1H7H A;  4Y63 A;  4O6N A;  3I0J A;  3Q7U A;  5FU8 A;  1MP4 A;  2V0J A;  3U0Y A;  4NAK A;  2VSI A;  1QG8 A;  2PX7 A;  4P00 A;  1ZJ2 A;  2X60 A;  1LL3 A;  2WGZ A;  4FRB A;  3U2X A;  2OEG A;  4KQL A;  1MP5 A;  4L41 C;  4NAL A;  1ZJ1 A;  4FRA A;  1H5R A;  2RJ9 A;  5AJP A;  3TQD A;  1ZCT A;  1R7U A;  5C38 A;  2AM3 A;  4Y7U A;  2FYC B;  2FYD B;  3IOI A;  5IFY A;  3SXE A;  1GWW A;  1H5S B;  5D91 A;  5BXC A;  1NF5 B;  1TW1 A;  2JCJ A;  2X5Z A;  1W55 A;  2RIT A;  1LZJ A;  3I0H A;  2RJ5 A;  4B5B A;  5C4B A;  3DJ4 A;  4M4K A;  3ZF8 A;  5C4E A;  2ZU9 A;  2AM5 A;  4FRE A;  3O3P A;  1PZT A;  3OH4 A;  4CJC A;  3OGZ A;  1JYL A;  3QVB A;  4Q7C A;  1QGQ A;  3I0I X;  1IIM A;  1H5S C;  1H5T B;  2J0B A;  1LZ7 A;  3T7O A;  1VGW A;  1GWV A;  1YP3 A;  1I52 A;  3SXC A;  4EE5 A;  1LL2 A;  2YC5 A;  3N9W A;  3OC9 A;  2AES A;  4FRQ A;  2YQJ A;  3R2W A;  2Y6P A;  1ZI1 A;  3JUK A;  4ZDQ A;  4Y64 A;  3Q80 A;  4AYJ A;  4FIY A;  4NAI A;  1JYK A;  2RJ0 A;  4KC2 A;  4Y6U A;  4B4M A;  2YQS A;  1G95 A;  5IDT A;  1WT3 A;  4FCE A;  3D8V A;  4DDZ A;  1R7V A;  1ZJ3 A;  5C1L A;  2RIY A;  4EE4 A;  1HM8 A;  2VD4 A;  2QGI A;  2Y7A A;  1QWJ A;  3V0P A;  3FWW A;  3V8Z A;  5DDT A;  4MND A;  1H7T A;  5CMI A;  5FU0 A;  3V0Q A;  3BCV A;  4KXO A;  4KC1 A;  3SXD A;  4FCU A;  2E3D A;  2V0K A;  2QKX A;  1KWS A;  4K6R A;  1ON8 A;  5EJ1 A;  4FRO A;  4Y62 A;  4D11 A;  1WT1 A;  5DDV A;  1H7Q A;  3HL3 A;  1O0R A;  3DUV A;  3LW6 A;  4EE3 A;  5C48 A;  3RMV A;  4KC4 A;  1WT0 A;  1NKH B;  4HOC A;  1FOA A;  1G3L A;  1JV1 A;  3I0D A;  5C47 A;  3K8E A;  2C0N A;  1ZI5 A;  5CQN X;  1NWG B;  1INJ A;  3POL A;  1FXO A;  1H7L A;  4ECM A;  2OI5 A;  1G97 A;  2A8W A;  4HO3 A;  4EVW A;  4D0Z A;  5L6S A;  2DPW A;  1FGG A;  1H7F A;  2VXL A;  3I0L A;  3SXG A;  1ZJO A;  3U2W A;  4B2X A;  3OH1 A;  4KPX A;  2D7R A;  2P72 A;  2PGV A;  4HO5 A;  4B4G A;  2Y4L A;  3OH3 A;  3V90 A;  5CMJ A;  3SX8 A;  3F1C A;  1S4N A;  1QGS A;  4AYL A;  1R80 A;  4GBP A;  1K4V A;  4CJ8 A;  1ZJP A;  2FYA A;  3V0L A;  1EZI A;  3CKV A;  4KT7 A;  3JUJ A;  2W0V A;  2OEF A;  4AC3 A;  1R82 A;  2OI7 A;  2V0L A;  3PKP A;  1H7G A;  3V0O A;  3PNN A;  4BQH A;  1NQI B;  1H4D A;  4FRP A;  1FG5 N;  4FQW A;  3OKR A;  2O1F A;  4FRH A;  4FRD A;  3JTJ A;  4KPZ A;  1VIC A;  1FWY A;  2VFZ A;  4LW6 A;  1H7E A;  1H4E A;  2JCL A;  3IOJ A;  3U0X A;  1ZCU A;  3I0G A;  3V0M A;  2RIZ A;  1ZJ0 A;  4JIS A;  3SX7 A;  2Q4J A;  1FRW A;  2AM4 A;  4M2A A;  3I0K A;  1V84 A;  1O7O A;  1G0R A;  2RJ1 A;  2RJ8 A;  5FTV A;  3RSB A;  3V0N A;  4HO9 A;  4B2W A;  2X5S A;  1TVY A;  3I0E A;  3U2U A;  2ICX A;  3E25 A;  5C3D A;  2Y4M A;  3SPT A;  1GQC A;  1VZU A;  1INI A;  4NAN A;  3U2T A;  5CQM X;  4KNX A;  1H5R B;  2APC A;  3SXA A;  4CVH A;  1YRO B;  3D98 A;  1H4C A;  1XHB A;  2UX8 A;  4Y7F A;  1LL0 A;  1OQM B;  2I5K A;  2YQH A;  3ZGG A;  1HM0 A;  1VM8 A;  2AEC A;  1VZT A;  1ZCY A;  1VGT A;  1ON6 A;  2XME A;  3RMW A;  5C1H A;  2W0W A;  4UEG A;  3T7M A;  1VGU A;  1GQ9 A;  1HJJ A;  2GGO A;  4G87 A;  5AJO A;  2BO8 A;  3CKJ A;  5C4C A;  2ICY A;  4C2S A;  4IRQ A;  2WVK A;  4B4B A;  5J49 A;  5C36 A;  1FR8 A;  2VK9 A;  2GGQ A;  4ASY A;  2AGD A;  3SX3 A;  1SS9 A;  2BO7 A;  1ZDG A;  3USR A;  1TZF A;  1HM9 A;  4KRV A;  4EEA A;  5C3B A;  4BMA A;  5D92 A;  4CJB A;  2E8B A;  1LZI A;  1WVC A;  1YP4 A;  1ZDF A;  4G3P A;  1LZ0 A;  3CKQ A;  5AJN A;  5IDS A;  3F1Y A;  2Y4J A;  1R81 A;  1FXJ A;  2OI6 A;  2ZU8 A;  4Y7V A;  1H5S A;  3OH0 A;  4IRP A;  4HG6 A;  2O1G A;  5CMH A;  2XWN A;  2FY7 A;  5EIY A;  3I0C A;  2Z87 A; 
#chains in the Genus database with same CATH homology
 2D0J A;  2D7I A;  4J18 A;  4Y9X A;  4FIX A;  1NHE B;  1ZI3 A;  3D5N A;  3KIA A;  3PKQ A;  5C8R A;  2QH5 A;  2X65 A;  4MIX A;  5FV9 A;  1ZHJ A;  1HJL A;  2YQC A;  2P6W A;  1H5S D;  3Q4S A;  3T7N A;  4B42 A;  2MZB A;  1OMZ A;  1JVD A;  1H5T A;  5EJZ A;  3ZLL A;  5C4D A;  2WVL A;  1FO8 A;  3I0F A;  3IOH A;  4EEG A;  1VPA A;  3CKN A;  2RIX A;  4R7P A;  5CMG X;  3CKO A;  1JVG A;  1FZW A;  2WAW A;  3GUE A;  5FTS A;  4KNR A;  4MYB A;  5C4F A;  3BRK X;  3ZLK A;  1V83 A;  3ZGF A;  2JCO A;  3E26 A;  4E1K A;  2WE9 A;  1E5K A;  1VH3 A;  2V0H A;  1S4O A;  4P02 A;  1FGX A;  3ST8 A;  3DK5 A;  4D11 C;  1GA8 A;  1HV9 A;  1OMX A;  4DE7 A;  3V8Y A;  2RJ6 A;  5CQL X;  2VS4 A;  1VH1 A;  2P73 A;  5HS2 A;  5L6V A;  2I7B A;  2PGY A;  3SXB A;  1V82 A;  4HO6 A;  1R7Y A;  2YES A;  4D0T A;  2AH9 A;  2YC3 A;  2VXM A;  2BO6 A;  1JV3 A;  2I5E A;  1EYR A;  1H3M A;  1YP2 A;  2J0A A;  5C49 A;  1GX0 A;  3SX5 A;  2WEE A;  1O7Q A;  4Y7T A;  2Z86 A;  4EEM A;  2XWL A;  1ZCV A;  4FRM A;  4HO4 A;  4DEC A;  2VSH A;  1WT2 A;  2FYB A;  4Y6N A;  1W57 A;  3R3I A;  4M28 A;  1G8O A;  4G3S A;  2VS3 A;  3USQ A;  1NMM B;  4LW3 A;  2VS5 A;  2XMH A;  1G23 A;  1MC3 A;  2NXV A;  3OAM A;  1PZY B;  4D48 A;  2AE7 A;  1VZX A;  4HO8 A;  4EEO A;  2BO4 A;  4O6M A;  3U2V A;  2CU2 A;  5FYE A;  1R7T A;  5C3A A;  5CQO A;  5C1G A;  2WVM A;  1WSZ A;  4G3Q A;  3NGW A;  3OH2 A;  3TZT A;  1O23 B;  1ZI4 A;  3CU0 A;  5CQP A;  3V91 A;  4ARW A;  4B3U A;  2Y4K A;  1W77 A;  4Y7G A;  3K8D A;  1XZ6 A;  1FR9 A;  4XWI A;  5FUH A;  1IIN A;  3CGX A;  4AAW A;  3FOQ A;  1G1L A;  4JD0 A;  2XWM A;  2RJ7 A;  1ZIZ A;  4HO0 A;  2JCK A;  2FFV A;  2ZU7 A;  4HO2 A;  1VGZ A;  1GX4 A;  4HCQ A;  4M2B A;  1G9R A;  1FO9 A;  3EE5 A;  2RJ4 A;  2V0I A;  2O1H A;  2FFU A;  1R7X A;  5CMF X;  2YCM A;  4YS8 A;  2A8U A;  2PA4 A;  5I1F A;  5JQQ A;  1Z90 A;  4FRL A;  1S4P A;  1LVW A;  1MP3 A;  4ASJ A;  1G93 A;  1G2V A;  1TW5 A;  1H7H A;  4Y63 A;  4O6N A;  3I0J A;  3Q7U A;  5FU8 A;  1MP4 A;  2V0J A;  3U0Y A;  4NAK A;  2VSI A;  1QG8 A;  2PX7 A;  4P00 A;  1ZJ2 A;  2X60 A;  1LL3 A;  2WGZ A;  4FRB A;  3U2X A;  2OEG A;  4KQL A;  1MP5 A;  4L41 C;  4NAL A;  1ZJ1 A;  4FRA A;  1H5R A;  2RJ9 A;  5AJP A;  3TQD A;  1ZCT A;  1R7U A;  5C38 A;  2AM3 A;  4Y7U A;  2FYC B;  2FYD B;  3IOI A;  5IFY A;  3SXE A;  1GWW A;  1H5S B;  5D91 A;  5BXC A;  1NF5 B;  1TW1 A;  2JCJ A;  2X5Z A;  1W55 A;  2RIT A;  1LZJ A;  3I0H A;  2RJ5 A;  4B5B A;  5C4B A;  3DJ4 A;  4M4K A;  3ZF8 A;  5C4E A;  2ZU9 A;  2AM5 A;  4FRE A;  3O3P A;  1PZT A;  3OH4 A;  4CJC A;  3OGZ A;  1JYL A;  3QVB A;  4Q7C A;  1QGQ A;  3I0I X;  1IIM A;  1H5S C;  1H5T B;  2J0B A;  1LZ7 A;  3T7O A;  1VGW A;  1GWV A;  1YP3 A;  1I52 A;  3SXC A;  4EE5 A;  1LL2 A;  2YC5 A;  3N9W A;  3OC9 A;  2AES A;  4FRQ A;  2YQJ A;  3R2W A;  2Y6P A;  1ZI1 A;  3JUK A;  4ZDQ A;  4Y64 A;  3Q80 A;  4AYJ A;  4FIY A;  4NAI A;  1JYK A;  2RJ0 A;  4KC2 A;  4Y6U A;  4B4M A;  2YQS A;  1G95 A;  5IDT A;  1WT3 A;  4FCE A;  3D8V A;  4DDZ A;  1R7V A;  1ZJ3 A;  5C1L A;  2RIY A;  4EE4 A;  1HM8 A;  2VD4 A;  2QGI A;  2Y7A A;  1QWJ A;  3V0P A;  3FWW A;  3V8Z A;  5DDT A;  4MND A;  1H7T A;  5CMI A;  5FU0 A;  3V0Q A;  3BCV A;  4KXO A;  4KC1 A;  3SXD A;  4FCU A;  2E3D A;  2V0K A;  2QKX A;  1KWS A;  4K6R A;  1ON8 A;  5EJ1 A;  4FRO A;  4Y62 A;  4D11 A;  1WT1 A;  5DDV A;  1H7Q A;  3HL3 A;  1O0R A;  3DUV A;  3LW6 A;  4EE3 A;  5C48 A;  3RMV A;  4KC4 A;  1WT0 A;  1NKH B;  4HOC A;  1FOA A;  1G3L A;  1JV1 A;  3I0D A;  5C47 A;  3K8E A;  2C0N A;  1ZI5 A;  5CQN X;  1NWG B;  1INJ A;  3POL A;  1FXO A;  1H7L A;  4ECM A;  2OI5 A;  1G97 A;  2A8W A;  4HO3 A;  4EVW A;  4D0Z A;  5L6S A;  2DPW A;  1FGG A;  1H7F A;  2VXL A;  3I0L A;  3SXG A;  1ZJO A;  3U2W A;  4B2X A;  3OH1 A;  4KPX A;  2D7R A;  2P72 A;  2PGV A;  4HO5 A;  4B4G A;  2Y4L A;  3OH3 A;  3V90 A;  5CMJ A;  3SX8 A;  3F1C A;  1S4N A;  1QGS A;  4AYL A;  1R80 A;  4GBP A;  1K4V A;  4CJ8 A;  1ZJP A;  2FYA A;  3V0L A;  1EZI A;  3CKV A;  4KT7 A;  3JUJ A;  2W0V A;  2OEF A;  4AC3 A;  1R82 A;  2OI7 A;  2V0L A;  3PKP A;  1H7G A;  3V0O A;  3PNN A;  4BQH A;  1NQI B;  1H4D A;  4FRP A;  1FG5 N;  4FQW A;  3OKR A;  2O1F A;  4FRH A;  4FRD A;  3JTJ A;  4KPZ A;  1VIC A;  1FWY A;  2VFZ A;  4LW6 A;  1H7E A;  1H4E A;  2JCL A;  3IOJ A;  3U0X A;  1ZCU A;  3I0G A;  3V0M A;  2RIZ A;  1ZJ0 A;  4JIS A;  3SX7 A;  2Q4J A;  1FRW A;  2AM4 A;  4M2A A;  3I0K A;  1V84 A;  1O7O A;  1G0R A;  2RJ1 A;  2RJ8 A;  5FTV A;  3RSB A;  3V0N A;  4HO9 A;  4B2W A;  2X5S A;  1TVY A;  3I0E A;  3U2U A;  2ICX A;  3E25 A;  5C3D A;  2Y4M A;  3SPT A;  1GQC A;  1VZU A;  1INI A;  4NAN A;  3U2T A;  5CQM X;  4KNX A;  1H5R B;  2APC A;  3SXA A;  4CVH A;  1YRO B;  3D98 A;  1H4C A;  1XHB A;  2UX8 A;  4Y7F A;  1LL0 A;  1OQM B;  2I5K A;  2YQH A;  3ZGG A;  1HM0 A;  1VM8 A;  2AEC A;  1VZT A;  1ZCY A;  1VGT A;  1ON6 A;  2XME A;  3RMW A;  5C1H A;  2W0W A;  4UEG A;  3T7M A;  1VGU A;  1GQ9 A;  1HJJ A;  2GGO A;  4G87 A;  5AJO A;  2BO8 A;  3CKJ A;  5C4C A;  2ICY A;  4C2S A;  4IRQ A;  2WVK A;  4B4B A;  5J49 A;  5C36 A;  1FR8 A;  2VK9 A;  2GGQ A;  4ASY A;  2AGD A;  3SX3 A;  1SS9 A;  2BO7 A;  1ZDG A;  3USR A;  1TZF A;  1HM9 A;  4KRV A;  4EEA A;  5C3B A;  4BMA A;  5D92 A;  4CJB A;  2E8B A;  1LZI A;  1WVC A;  1YP4 A;  1ZDF A;  4G3P A;  1LZ0 A;  3CKQ A;  5AJN A;  5IDS A;  3F1Y A;  2Y4J A;  1R81 A;  1FXJ A;  2OI6 A;  2ZU8 A;  4Y7V A;  1H5S A;  3OH0 A;  4IRP A;  4HG6 A;  2O1G A;  5CMH A;  2XWN A;  2FY7 A;  5EIY A;  3I0C A;  2Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...