3U0YA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with compound 382 and udp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
288
structure length
288
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histo-blood group ABO system transferase
publication title A novel compound from a molecular fragment library screen inhibits glycosyltransferases by displacing the metal ion and interfering with substrate binding
rcsb
source organism Homo sapiens
total genus 98
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u0yA00
1GX4A 5C8RA 5FYEA 4MYBA 2PX7A 2W0WA 4D48A 1XHBA 4HO2A 3K8EA 3POLA 1HM9A 3Q80A 4BMAA 3BRKX 3I0FA 1HV9A 3I0KA 4FREA 5C4FA 1FRWA 2RJ6A 3V0NA 4KPZA 3I0HA 2O1FA 4Y7GA 1WSZA 2V0IA 5JQQA 3F1YA 1G8OA 3CKJA 1ON6A 1VGZA 1VZXA 1S4PA 2CU2A 2OI7A 2Z87A 1QGQA 2RJ8A 3TQDA 4G87A 1GQCA 1VICA 1FGXA 1JYKA 4EEAA 4FCEA 5CMFX 1EZIA 3I0CA 2BO8A 2QH5A 1FOAA 1R81A 4YS8A 2ZU8A 3OH2A 5C38A 4GBPA 4B2XA 5FU8A 1TW5A 3SX7A 3ZLLA 2AECA 5C4DA 4EE5A 4BQHA 1S4OA 1G9RA 2RIYA 4NANA 5EIYA 1GA8A 1H5SB 4Y7VA 1H4CA 2FFVA 1R80A 1XZ6A 4J18A 3USQA 2YCMA 1G0RA 1INJA 3CGXA 4FRLA 3I0GA 1VGUA 4EEOA 4HO4A 2D7RA 2ZU9A 4B4BA 3D98A 4HOCA 2D0JA 1G3LA 2YC5A 1LZ7A 1WT2A 1H7QA 4AC3A 3BCVA 1H7HA 2W0VA 3RMVA 4KC1A 5CMJA 2YC3A 3K8DA 4UEGA 3SPTA 4FRPA 2RJ9A 5CMIA 1K4VA 5CMGX 1JYLA 2Y4LA 1WT3A 4Y7FA 4CVHA 2JCJA 3EE5A 5L6VA 4AYJA 5IFYA 2XMHA 4KRVA 1G2VA 3FOQA 3U2UA 2YESA 5AJPA 4ASJA 1ZI1A 4HO9A 2FYCB 4DE7A 1VM8A 1H7LA 1FGGA 4HCQA 3T7OA 4B5BA 4E1KA 4K6RA 1ZJPA 4NALA 4Y64A 1NHEB 1S4NA 2P6WA 1OMXA 4P02A 1H5RB 3Q7UA 1H7FA 5C3BA 2AM3A 5C4EA 3DJ4A 3ZF8A 3TZTA 4HO8A 3OH4A 1TVYA 4FRBA 4CJCA 3V0MA 3I0LA 4M4KA 3ZGFA 5FU0A 4B3UA 2AH9A 1QG8A 3SXGA 1O23B 1H7TA 3IOIA 1ZI3A 1R82A 4KNXA 1TZFA 2BO4A 1FG5N 4EEMA 3CKOA 2FYBA 4Y7TA 1W57A 1H3MA 1H7EA 4FCUA 2X60A 5C49A 2OI5A 4ASYA 2RITA 3I0EA 4KNRA 5C48A 1ZDGA 4NAKA 1IIMA 2RIZA 1VGWA 3OGZA 1Z90A 5CQNX 5FTVA 1V84A 1ZJ3A 1JV1A 4JISA 5L6SA 2O1GA 3V90A 2P72A 2QKXA 1OQMB 3E26A 2A8UA 1FXOA 1V82A 3U0YA 3Q4SA 1GQ9A 3U2WA 2WE9A 1ZJOA 2XWMA 4KQLA 4MNDA 4L41C 1LVWA 4FRQA 4XWIA 2YQJA 4D11A 2FFUA 1O7OA 1WT1A 1H5TB 4CJBA 1ZDFA 2I5EA 3OC9A 1W55A 2RJ5A 1R7XA 2PGYA 3V0PA 1LL3A 2APCA 2OEFA 5C1LA 1ZIZA 2PA4A 4Y62A 1LZ0A 2V0HA 1VGTA 2VFZA 1G97A 2Y7AA 2AESA 2X65A 2V0LA 2UX8A 4NAIA 1G93A 1NWGB 1NF5B 2Q4JA 4HO5A 2AM4A 1H5SA 5AJNA 2FYAA 3R3IA 4KPXA 4Y6NA 4IRQA 3R2WA 2JCOA 1I52A 5C47A 2P73A 2XMEA 2VS4A 1HM0A 1H5SD 3U2XA 1WT0A 4G3PA 1VZTA 4DECA 3U2TA 2AM5A 2PGVA 3OAMA 1JVGA 1ZJ2A 2E8BA 4ZDQA 3JUJA 1INIA 2DPWA 4M28A 4KC4A 2XWLA 4EE4A 3I0IX 1O7QA 3NGWA 2VXMA 1GX0A 3KIAA 2YQHA 3V0LA 2WVLA 3V91A 4KXOA 2WGZA 1H4EA 3DUVA 1MP4A 4G3QA 3E25A 4ECMA 5EJZA 2OI6A 2NXVA 1H7GA 2FYDB 3U2VA 4B2WA 1JV3A 4G3SA 3USRA 2XWNA 2JCLA 1ZJ0A 3RMWA 3T7MA 1H5RA 1EYRA 4ARWA 1G1LA 3PKPA 1YP3A 2A8WA 3D5NA 5FUHA 3GUEA 4LW6A 4FRDA 4EVWA 5HS2A 2ZU7A 4AYLA 2E3DA 1YP2A 1WVCA 5CMHA 2VS5A 4AAWA 3LW6A 1NKHB 1H4DA 3JTJA 3RSBA 5DDVA 1G95A 2Y4JA 2V0KA 2OEGA 4R7PA 2X5ZA 1ON8A 5AJOA 1HJLA 2BO7A 5C1HA 4IRPA 3SXCA 2Y4MA 5C4CA 1R7TA 4Y7UA 3CKQA 2WVMA 1FWYA 3SX3A 4B42A 1MP3A 1OMZA 4Y6UA 3V0QA 4FRMA 4HO6A 4D0TA 1ZJ1A 1G23A 3QVBA 3DK5A 2RJ4A 1NQIB 4C2SA 4P00A 3I0JA 1NMMB 4KC2A 4M2BA 1VPAA 4EEGA 1MP5A 5I1FA 1FO8A 5C36A 2GGQA 1KWSA 4M2AA 1VH1A 3ST8A 2ICXA 3PKQA 5IDTA 1HJJA 1LZJA 1H5TA 5IDSA 1VH3A 2VSHA 3CU0A 1LL2A 1PZTA 2VXLA 1FO9A 1TW1A 1R7YA 5CQOA 1FXJA 2JCKA 1R7UA 5DDTA 3FWWA 3OH0A 3V8ZA 4B4GA 1VZUA 2AGDA 2RJ1A 1QGSA 1YROB 4FRHA 5CQLX 3IOJA 1LZIA 3N9WA 2WEEA 3CKNA 5C1GA 3SXAA 3SX5A 2Y6PA 3OH1A 1V83A 3SX8A 3D8VA 2I7BA 4D11C 1GWWA 4CJ8A 5BXCA 3O3PA 4Y63A 1GWVA 5FV9A 2MZBA 3PNNA 1ZHJA 2O1HA 3JUKA 4HO0A 2RJ0A 4HG6A 5C4BA 1FR8A 2ICYA 2D7IA 1R7VA 2VSIA 2GGOA 3V8YA 2WVKA 1SS9A 5C3DA 1PZYB 1ZCUA 1E5KA 4D0ZA 3SXEA 4HO3A 2AE7A 3U0XA 5FTSA 2WAWA 2V0JA 2Y4KA 4FQWA 2Z86A 4JD0A 1FR9A 4B4MA 5J49A 3I0DA 1JVDA 1H5SC 1IINA 4EE3A 3ZGGA 1W77A 2VD4A 1YP4A 1FZWA 3HL3A 3OKRA 3ZLKA 2QGIA 2RJ7A 2X5SA 1ZCTA 3OH3A 4FRAA 5EJ1A 5CQMX 3V0OA 4FROA 1MC3A 2I5KA 2BO6A 3F1CA 2RIXA 4DDZA 2YQCA 5CQPA 2YQSA 1ZI5A 3CKVA 2FY7A 3SXDA 1O0RA 4Y9XA 1LL0A 1ZCVA 4LW3A 3IOHA 1QWJA 1ZCYA 3SXBA 3T7NA 5C3AA 1ZI4A 2VS3A 4KT7A 1HM8A
chains in the Genus database with same CATH superfamily
1GX4A 5C8RA 5FYEA 4MYBA 2PX7A 2W0WA 4D48A 1XHBA 4HO2A 3K8EA 3POLA 1HM9A 3Q80A 4BMAA 3BRKX 3I0FA 1HV9A 3I0KA 4FREA 5C4FA 1FRWA 2RJ6A 3V0NA 4KPZA 3I0HA 2O1FA 4Y7GA 1WSZA 2V0IA 5JQQA 3F1YA 1G8OA 3CKJA 1ON6A 1VGZA 1VZXA 1S4PA 2CU2A 2OI7A 2Z87A 1QGQA 2RJ8A 3TQDA 4G87A 1GQCA 1VICA 1FGXA 1JYKA 4EEAA 4FCEA 5CMFX 1EZIA 3I0CA 2BO8A 2QH5A 4Q7CA 1FOAA 1R81A 4YS8A 2ZU8A 3OH2A 5C38A 2VK9A 4GBPA 4B2XA 5FU8A 1TW5A 3SX7A 3ZLLA 2AECA 5C4DA 4EE5A 4BQHA 1S4OA 1G9RA 2RIYA 4NANA 5EIYA 1GA8A 1H5SB 4Y7VA 5D91A 1H4CA 2FFVA 1R80A 1XZ6A 4J18A 3USQA 2YCMA 1G0RA 1INJA 3CGXA 4FRLA 3I0GA 1VGUA 4EEOA 4HO4A 2D7RA 2ZU9A 4B4BA 3D98A 4HOCA 2D0JA 1G3LA 2YC5A 1LZ7A 1WT2A 1H7QA 4AC3A 3BCVA 4O6NA 1H7HA 2W0VA 3RMVA 4KC1A 5CMJA 2YC3A 3K8DA 4UEGA 3SPTA 4FRPA 2RJ9A 5CMIA 1K4VA 5CMGX 1JYLA 2Y4LA 1WT3A 4Y7FA 4CVHA 2JCJA 3EE5A 5L6VA 4AYJA 5IFYA 2XMHA 4KRVA 1G2VA 3FOQA 3U2UA 2YESA 5AJPA 4ASJA 1ZI1A 4HO9A 2FYCB 4DE7A 1VM8A 1H7LA 1FGGA 4HCQA 4MIXA 3T7OA 4B5BA 4E1KA 4K6RA 1ZJPA 4NALA 4Y64A 1NHEB 1S4NA 2P6WA 1OMXA 4P02A 1H5RB 3Q7UA 1H7FA 5C3BA 2AM3A 5C4EA 3DJ4A 3ZF8A 3TZTA 4HO8A 3OH4A 5D92A 1TVYA 4FRBA 4CJCA 3V0MA 3I0LA 4M4KA 4O6MA 3ZGFA 5FU0A 4B3UA 2AH9A 1QG8A 3SXGA 1O23B 1H7TA 3IOIA 1ZI3A 1R82A 4KNXA 1TZFA 2BO4A 1FG5N 4EEMA 3CKOA 2FYBA 4Y7TA 1W57A 1H3MA 1H7EA 4FCUA 2X60A 5C49A 2OI5A 4ASYA 2RITA 3I0EA 4KNRA 5C48A 1ZDGA 4NAKA 1IIMA 2RIZA 1VGWA 3OGZA 1Z90A 5CQNX 5FTVA 1V84A 1ZJ3A 1JV1A 4JISA 5L6SA 2O1GA 3V90A 2P72A 2QKXA 1OQMB 3E26A 2A8UA 1FXOA 1V82A 3U0YA 3Q4SA 1GQ9A 3U2WA 2WE9A 1ZJOA 2XWMA 4KQLA 4MNDA 4L41C 1LVWA 4FRQA 4XWIA 2YQJA 4D11A 2FFUA 1O7OA 1WT1A 1H5TB 4CJBA 4FIXA 1ZDFA 2I5EA 3OC9A 1W55A 2RJ5A 1R7XA 2PGYA 3V0PA 1LL3A 2APCA 2OEFA 5C1LA 1ZIZA 2PA4A 4Y62A 1LZ0A 2V0HA 1VGTA 2VFZA 1G97A 2Y7AA 2AESA 2X65A 2V0LA 2UX8A 4NAIA 1G93A 1NWGB 1NF5B 2Q4JA 4HO5A 2AM4A 1H5SA 5AJNA 2J0AA 2FYAA 3R3IA 4KPXA 4Y6NA 4IRQA 3R2WA 2C0NA 2JCOA 1I52A 5C47A 2P73A 2XMEA 2VS4A 1HM0A 1H5SD 3U2XA 1WT0A 4G3PA 1VZTA 4DECA 3U2TA 2AM5A 2PGVA 3OAMA 1JVGA 1ZJ2A 2E8BA 4ZDQA 3JUJA 1INIA 2DPWA 4M28A 4KC4A 2XWLA 4EE4A 3I0IX 1O7QA 3NGWA 2VXMA 1GX0A 3KIAA 2YQHA 3V0LA 2WVLA 3V91A 4KXOA 2WGZA 1H4EA 3DUVA 1MP4A 4G3QA 3E25A 4ECMA 5EJZA 2OI6A 2NXVA 1H7GA 2FYDB 3U2VA 4B2WA 1JV3A 4G3SA 3USRA 2XWNA 2JCLA 1ZJ0A 3RMWA 3T7MA 1H5RA 1EYRA 4ARWA 1G1LA 3PKPA 1YP3A 2A8WA 3D5NA 5FUHA 3GUEA 4LW6A 4FRDA 4EVWA 5HS2A 2ZU7A 4AYLA 2E3DA 1YP2A 1WVCA 5CMHA 2VS5A 4AAWA 3LW6A 1NKHB 1H4DA 3JTJA 3RSBA 5DDVA 1G95A 2Y4JA 2V0KA 2OEGA 4R7PA 2X5ZA 1ON8A 5AJOA 1HJLA 2BO7A 5C1HA 4IRPA 3SXCA 2Y4MA 5C4CA 1R7TA 4Y7UA 3CKQA 2WVMA 1FWYA 3SX3A 4B42A 1MP3A 1OMZA 4Y6UA 3V0QA 4FRMA 4HO6A 4D0TA 1ZJ1A 1G23A 3QVBA 3DK5A 2RJ4A 1NQIB 4C2SA 4P00A 3I0JA 1NMMB 4KC2A 4M2BA 1VPAA 4EEGA 1MP5A 5I1FA 1FO8A 5C36A 2GGQA 1KWSA 4M2AA 1VH1A 3ST8A 2ICXA 3PKQA 5IDTA 1HJJA 1LZJA 1H5TA 5IDSA 1VH3A 2VSHA 3CU0A 1LL2A 1PZTA 2VXLA 1FO9A 1TW1A 1R7YA 5CQOA 1FXJA 2JCKA 1R7UA 5DDTA 3FWWA 3OH0A 3V8ZA 4B4GA 1VZUA 2AGDA 2RJ1A 1QGSA 1YROB 4FRHA 5CQLX 3IOJA 1LZIA 3N9WA 2WEEA 3CKNA 5C1GA 3SXAA 3SX5A 2Y6PA 3OH1A 1V83A 3SX8A 3D8VA 2I7BA 4D11C 1GWWA 4CJ8A 5BXCA 3O3PA 4Y63A 1GWVA 5FV9A 2MZBA 3PNNA 1ZHJA 2O1HA 3JUKA 4HO0A 2RJ0A 4HG6A 5C4BA 1FR8A 2ICYA 2D7IA 1R7VA 2VSIA 2GGOA 3V8YA 2WVKA 1SS9A 5C3DA 1PZYB 1ZCUA 1E5KA 4D0ZA 3SXEA 4HO3A 2AE7A 3U0XA 5FTSA 2WAWA 2V0JA 2Y4KA 2J0BA 4FQWA 2Z86A 4JD0A 1FR9A 4B4MA 5J49A 3I0DA 1JVDA 1H5SC 1IINA 4EE3A 3ZGGA 1W77A 2VD4A 1YP4A 1FZWA 3HL3A 3OKRA 3ZLKA 2QGIA 2RJ7A 2X5SA 1ZCTA 3OH3A 4FRAA 4FIYA 5EJ1A 5CQMX 3V0OA 4FROA 1MC3A 2I5KA 2BO6A 3F1CA 2RIXA 4DDZA 2YQCA 5CQPA 2YQSA 1ZI5A 3CKVA 2FY7A 3SXDA 1O0RA 4Y9XA 1LL0A 1ZCVA 4LW3A 3IOHA 1QWJA 1ZCYA 3SXBA 3T7NA 5C3AA 1ZI4A 2VS3A 4KT7A 1HM8A
chains in the Genus database with same CATH topology
1GX4A 5C8RA 5FYEA 4MYBA 2PX7A 2W0WA 4D48A 1XHBA 4HO2A 3K8EA 3POLA 1HM9A 3Q80A 4BMAA 3BRKX 3I0FA 1HV9A 3I0KA 4FREA 5C4FA 1FRWA 2RJ6A 3V0NA 4KPZA 3I0HA 2O1FA 4Y7GA 1WSZA 2V0IA 5JQQA 3F1YA 1G8OA 3CKJA 1ON6A 1VGZA 1VZXA 1S4PA 2CU2A 2OI7A 2Z87A 1QGQA 2RJ8A 3TQDA 4G87A 1GQCA 1VICA 1FGXA 1JYKA 4EEAA 4FCEA 5CMFX 1EZIA 3I0CA 2BO8A 2QH5A 4Q7CA 1FOAA 1R81A 4YS8A 2ZU8A 3OH2A 5C38A 2VK9A 4GBPA 4B2XA 5FU8A 1TW5A 3SX7A 3ZLLA 2AECA 5C4DA 4EE5A 4BQHA 1S4OA 1G9RA 2RIYA 4NANA 5EIYA 1GA8A 1H5SB 4Y7VA 5D91A 1H4CA 2FFVA 1R80A 1XZ6A 4J18A 3USQA 2YCMA 1G0RA 1INJA 3CGXA 4FRLA 3I0GA 1VGUA 4EEOA 4HO4A 2D7RA 2ZU9A 4B4BA 3D98A 4HOCA 2D0JA 1G3LA 2YC5A 1LZ7A 1WT2A 1H7QA 4AC3A 3BCVA 4O6NA 1H7HA 2W0VA 3RMVA 4KC1A 5CMJA 2YC3A 3K8DA 4UEGA 3SPTA 4FRPA 2RJ9A 5CMIA 1K4VA 5CMGX 1JYLA 2Y4LA 1WT3A 4Y7FA 4CVHA 2JCJA 3EE5A 5L6VA 4AYJA 5IFYA 2XMHA 4KRVA 1G2VA 3FOQA 3U2UA 2YESA 5AJPA 4ASJA 1ZI1A 4HO9A 2FYCB 4DE7A 1VM8A 1H7LA 1FGGA 4HCQA 4MIXA 3T7OA 4B5BA 4E1KA 4K6RA 1ZJPA 4NALA 4Y64A 1NHEB 1S4NA 2P6WA 1OMXA 4P02A 1H5RB 3Q7UA 1H7FA 5C3BA 2AM3A 5C4EA 3DJ4A 3ZF8A 3TZTA 4HO8A 3OH4A 5D92A 1TVYA 4FRBA 4CJCA 3V0MA 3I0LA 4M4KA 4O6MA 3ZGFA 5FU0A 4B3UA 2AH9A 1QG8A 3SXGA 1O23B 1H7TA 3IOIA 1ZI3A 1R82A 4KNXA 1TZFA 2BO4A 1FG5N 4EEMA 3CKOA 2FYBA 4Y7TA 1W57A 1H3MA 1H7EA 4FCUA 2X60A 5C49A 2OI5A 4ASYA 2RITA 3I0EA 4KNRA 5C48A 1ZDGA 4NAKA 1IIMA 2RIZA 1VGWA 3OGZA 1Z90A 5CQNX 5FTVA 1V84A 1ZJ3A 1JV1A 4JISA 5L6SA 2O1GA 3V90A 2P72A 2QKXA 1OQMB 3E26A 2A8UA 1FXOA 1V82A 3U0YA 3Q4SA 1GQ9A 3U2WA 2WE9A 1ZJOA 2XWMA 4KQLA 4MNDA 4L41C 1LVWA 4FRQA 4XWIA 2YQJA 4D11A 2FFUA 1O7OA 1WT1A 1H5TB 4CJBA 4FIXA 1ZDFA 2I5EA 3OC9A 1W55A 2RJ5A 1R7XA 2PGYA 3V0PA 1LL3A 2APCA 2OEFA 5C1LA 1ZIZA 2PA4A 4Y62A 1LZ0A 2V0HA 1VGTA 2VFZA 1G97A 2Y7AA 2AESA 2X65A 2V0LA 2UX8A 4NAIA 1G93A 1NWGB 1NF5B 2Q4JA 4HO5A 2AM4A 1H5SA 5AJNA 2J0AA 2FYAA 3R3IA 4KPXA 4Y6NA 4IRQA 3R2WA 2C0NA 2JCOA 1I52A 5C47A 2P73A 2XMEA 2VS4A 1HM0A 1H5SD 3U2XA 1WT0A 4G3PA 1VZTA 4DECA 3U2TA 2AM5A 2PGVA 3OAMA 1JVGA 1ZJ2A 2E8BA 4ZDQA 3JUJA 1INIA 2DPWA 4M28A 4KC4A 2XWLA 4EE4A 3I0IX 1O7QA 3NGWA 2VXMA 1GX0A 3KIAA 2YQHA 3V0LA 2WVLA 3V91A 4KXOA 2WGZA 1H4EA 3DUVA 1MP4A 4G3QA 3E25A 4ECMA 5EJZA 2OI6A 2NXVA 1H7GA 2FYDB 3U2VA 4B2WA 1JV3A 4G3SA 3USRA 2XWNA 2JCLA 1ZJ0A 3RMWA 3T7MA 1H5RA 1EYRA 4ARWA 1G1LA 3PKPA 1YP3A 2A8WA 3D5NA 5FUHA 3GUEA 4LW6A 4FRDA 4EVWA 5HS2A 2ZU7A 4AYLA 2E3DA 1YP2A 1WVCA 5CMHA 2VS5A 4AAWA 3LW6A 1NKHB 1H4DA 3JTJA 3RSBA 5DDVA 1G95A 2Y4JA 2V0KA 2OEGA 4R7PA 2X5ZA 1ON8A 5AJOA 1HJLA 2BO7A 5C1HA 4IRPA 3SXCA 2Y4MA 5C4CA 1R7TA 4Y7UA 3CKQA 2WVMA 1FWYA 3SX3A 4B42A 1MP3A 1OMZA 4Y6UA 3V0QA 4FRMA 4HO6A 4D0TA 1ZJ1A 1G23A 3QVBA 3DK5A 2RJ4A 1NQIB 4C2SA 4P00A 3I0JA 1NMMB 4KC2A 4M2BA 1VPAA 4EEGA 1MP5A 5I1FA 1FO8A 5C36A 2GGQA 1KWSA 4M2AA 1VH1A 3ST8A 2ICXA 3PKQA 5IDTA 1HJJA 1LZJA 1H5TA 5IDSA 1VH3A 2VSHA 3CU0A 1LL2A 1PZTA 2VXLA 1FO9A 1TW1A 1R7YA 5CQOA 1FXJA 2JCKA 1R7UA 5DDTA 3FWWA 3OH0A 3V8ZA 4B4GA 1VZUA 2AGDA 2RJ1A 1QGSA 1YROB 4FRHA 5CQLX 3IOJA 1LZIA 3N9WA 2WEEA 3CKNA 5C1GA 3SXAA 3SX5A 2Y6PA 3OH1A 1V83A 3SX8A 3D8VA 2I7BA 4D11C 1GWWA 4CJ8A 5BXCA 3O3PA 4Y63A 1GWVA 5FV9A 2MZBA 3PNNA 1ZHJA 2O1HA 3JUKA 4HO0A 2RJ0A 4HG6A 5C4BA 1FR8A 2ICYA 2D7IA 1R7VA 2VSIA 2GGOA 3V8YA 2WVKA 1SS9A 5C3DA 1PZYB 1ZCUA 1E5KA 4D0ZA 3SXEA 4HO3A 2AE7A 3U0XA 5FTSA 2WAWA 2V0JA 2Y4KA 2J0BA 4FQWA 2Z86A 4JD0A 1FR9A 4B4MA 5J49A 3I0DA 1JVDA 1H5SC 1IINA 4EE3A 3ZGGA 1W77A 2VD4A 1YP4A 1FZWA 3HL3A 3OKRA 3ZLKA 2QGIA 2RJ7A 2X5SA 1ZCTA 3OH3A 4FRAA 4FIYA 5EJ1A 5CQMX 3V0OA 4FROA 1MC3A 2I5KA 2BO6A 3F1CA 2RIXA 4DDZA 2YQCA 5CQPA 2YQSA 1ZI5A 3CKVA 2FY7A 3SXDA 1O0RA 4Y9XA 1LL0A 1ZCVA 4LW3A 3IOHA 1QWJA 1ZCYA 3SXBA 3T7NA 5C3AA 1ZI4A 2VS3A 4KT7A 1HM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX4 A;  5C8R A;  5FYE A;  4MYB A;  2PX7 A;  2W0W A;  4D48 A;  1XHB A;  4HO2 A;  3K8E A;  3POL A;  1HM9 A;  3Q80 A;  4BMA A;  3BRK X;  3I0F A;  1HV9 A;  3I0K A;  4FRE A;  5C4F A;  1FRW A;  2RJ6 A;  3V0N A;  4KPZ A;  3I0H A;  2O1F A;  4Y7G A;  1WSZ A;  2V0I A;  5JQQ A;  3F1Y A;  1G8O A;  3CKJ A;  1ON6 A;  1VGZ A;  1VZX A;  1S4P A;  2CU2 A;  2OI7 A;  2Z87 A;  1QGQ A;  2RJ8 A;  3TQD A;  4G87 A;  1GQC A;  1VIC A;  1FGX A;  1JYK A;  4EEA A;  4FCE A;  5CMF X;  1EZI A;  3I0C A;  2BO8 A;  2QH5 A;  1FOA A;  1R81 A;  4YS8 A;  2ZU8 A;  3OH2 A;  5C38 A;  4GBP A;  4B2X A;  5FU8 A;  1TW5 A;  3SX7 A;  3ZLL A;  2AEC A;  5C4D A;  4EE5 A;  4BQH A;  1S4O A;  1G9R A;  2RIY A;  4NAN A;  5EIY A;  1GA8 A;  1H5S B;  4Y7V A;  1H4C A;  2FFV A;  1R80 A;  1XZ6 A;  4J18 A;  3USQ A;  2YCM A;  1G0R A;  1INJ A;  3CGX A;  4FRL A;  3I0G A;  1VGU A;  4EEO A;  4HO4 A;  2D7R A;  2ZU9 A;  4B4B A;  3D98 A;  4HOC A;  2D0J A;  1G3L A;  2YC5 A;  1LZ7 A;  1WT2 A;  1H7Q A;  4AC3 A;  3BCV A;  1H7H A;  2W0V A;  3RMV A;  4KC1 A;  5CMJ A;  2YC3 A;  3K8D A;  4UEG A;  3SPT A;  4FRP A;  2RJ9 A;  5CMI A;  1K4V A;  5CMG X;  1JYL A;  2Y4L A;  1WT3 A;  4Y7F A;  4CVH A;  2JCJ A;  3EE5 A;  5L6V A;  4AYJ A;  5IFY A;  2XMH A;  4KRV A;  1G2V A;  3FOQ A;  3U2U A;  2YES A;  5AJP A;  4ASJ A;  1ZI1 A;  4HO9 A;  2FYC B;  4DE7 A;  1VM8 A;  1H7L A;  1FGG A;  4HCQ A;  3T7O A;  4B5B A;  4E1K A;  4K6R A;  1ZJP A;  4NAL A;  4Y64 A;  1NHE B;  1S4N A;  2P6W A;  1OMX A;  4P02 A;  1H5R B;  3Q7U A;  1H7F A;  5C3B A;  2AM3 A;  5C4E A;  3DJ4 A;  3ZF8 A;  3TZT A;  4HO8 A;  3OH4 A;  1TVY A;  4FRB A;  4CJC A;  3V0M A;  3I0L A;  4M4K A;  3ZGF A;  5FU0 A;  4B3U A;  2AH9 A;  1QG8 A;  3SXG A;  1O23 B;  1H7T A;  3IOI A;  1ZI3 A;  1R82 A;  4KNX A;  1TZF A;  2BO4 A;  1FG5 N;  4EEM A;  3CKO A;  2FYB A;  4Y7T A;  1W57 A;  1H3M A;  1H7E A;  4FCU A;  2X60 A;  5C49 A;  2OI5 A;  4ASY A;  2RIT A;  3I0E A;  4KNR A;  5C48 A;  1ZDG A;  4NAK A;  1IIM A;  2RIZ A;  1VGW A;  3OGZ A;  1Z90 A;  5CQN X;  5FTV A;  1V84 A;  1ZJ3 A;  1JV1 A;  4JIS A;  5L6S A;  2O1G A;  3V90 A;  2P72 A;  2QKX A;  1OQM B;  3E26 A;  2A8U A;  1FXO A;  1V82 A;  3U0Y A;  3Q4S A;  1GQ9 A;  3U2W A;  2WE9 A;  1ZJO A;  2XWM A;  4KQL A;  4MND A;  4L41 C;  1LVW A;  4FRQ A;  4XWI A;  2YQJ A;  4D11 A;  2FFU A;  1O7O A;  1WT1 A;  1H5T B;  4CJB A;  1ZDF A;  2I5E A;  3OC9 A;  1W55 A;  2RJ5 A;  1R7X A;  2PGY A;  3V0P A;  1LL3 A;  2APC A;  2OEF A;  5C1L A;  1ZIZ A;  2PA4 A;  4Y62 A;  1LZ0 A;  2V0H A;  1VGT A;  2VFZ A;  1G97 A;  2Y7A A;  2AES A;  2X65 A;  2V0L A;  2UX8 A;  4NAI A;  1G93 A;  1NWG B;  1NF5 B;  2Q4J A;  4HO5 A;  2AM4 A;  1H5S A;  5AJN A;  2FYA A;  3R3I A;  4KPX A;  4Y6N A;  4IRQ A;  3R2W A;  2JCO A;  1I52 A;  5C47 A;  2P73 A;  2XME A;  2VS4 A;  1HM0 A;  1H5S D;  3U2X A;  1WT0 A;  4G3P A;  1VZT A;  4DEC A;  3U2T A;  2AM5 A;  2PGV A;  3OAM A;  1JVG A;  1ZJ2 A;  2E8B A;  4ZDQ A;  3JUJ A;  1INI A;  2DPW A;  4M28 A;  4KC4 A;  2XWL A;  4EE4 A;  3I0I X;  1O7Q A;  3NGW A;  2VXM A;  1GX0 A;  3KIA A;  2YQH A;  3V0L A;  2WVL A;  3V91 A;  4KXO A;  2WGZ A;  1H4E A;  3DUV A;  1MP4 A;  4G3Q A;  3E25 A;  4ECM A;  5EJZ A;  2OI6 A;  2NXV A;  1H7G A;  2FYD B;  3U2V A;  4B2W A;  1JV3 A;  4G3S A;  3USR A;  2XWN A;  2JCL A;  1ZJ0 A;  3RMW A;  3T7M A;  1H5R A;  1EYR A;  4ARW A;  1G1L A;  3PKP A;  1YP3 A;  2A8W A;  3D5N A;  5FUH A;  3GUE A;  4LW6 A;  4FRD A;  4EVW A;  5HS2 A;  2ZU7 A;  4AYL A;  2E3D A;  1YP2 A;  1WVC A;  5CMH A;  2VS5 A;  4AAW A;  3LW6 A;  1NKH B;  1H4D A;  3JTJ A;  3RSB A;  5DDV A;  1G95 A;  2Y4J A;  2V0K A;  2OEG A;  4R7P A;  2X5Z A;  1ON8 A;  5AJO A;  1HJL A;  2BO7 A;  5C1H A;  4IRP A;  3SXC A;  2Y4M A;  5C4C A;  1R7T A;  4Y7U A;  3CKQ A;  2WVM A;  1FWY A;  3SX3 A;  4B42 A;  1MP3 A;  1OMZ A;  4Y6U A;  3V0Q A;  4FRM A;  4HO6 A;  4D0T A;  1ZJ1 A;  1G23 A;  3QVB A;  3DK5 A;  2RJ4 A;  1NQI B;  4C2S A;  4P00 A;  3I0J A;  1NMM B;  4KC2 A;  4M2B A;  1VPA A;  4EEG A;  1MP5 A;  5I1F A;  1FO8 A;  5C36 A;  2GGQ A;  1KWS A;  4M2A A;  1VH1 A;  3ST8 A;  2ICX A;  3PKQ A;  5IDT A;  1HJJ A;  1LZJ A;  1H5T A;  5IDS A;  1VH3 A;  2VSH A;  3CU0 A;  1LL2 A;  1PZT A;  2VXL A;  1FO9 A;  1TW1 A;  1R7Y A;  5CQO A;  1FXJ A;  2JCK A;  1R7U A;  5DDT A;  3FWW A;  3OH0 A;  3V8Z A;  4B4G A;  1VZU A;  2AGD A;  2RJ1 A;  1QGS A;  1YRO B;  4FRH A;  5CQL X;  3IOJ A;  1LZI A;  3N9W A;  2WEE A;  3CKN A;  5C1G A;  3SXA A;  3SX5 A;  2Y6P A;  3OH1 A;  1V83 A;  3SX8 A;  3D8V A;  2I7B A;  4D11 C;  1GWW A;  4CJ8 A;  5BXC A;  3O3P A;  4Y63 A;  1GWV A;  5FV9 A;  2MZB A;  3PNN A;  1ZHJ A;  2O1H A;  3JUK A;  4HO0 A;  2RJ0 A;  4HG6 A;  5C4B A;  1FR8 A;  2ICY A;  2D7I A;  1R7V A;  2VSI A;  2GGO A;  3V8Y A;  2WVK A;  1SS9 A;  5C3D A;  1PZY B;  1ZCU A;  1E5K A;  4D0Z A;  3SXE A;  4HO3 A;  2AE7 A;  3U0X A;  5FTS A;  2WAW A;  2V0J A;  2Y4K A;  4FQW A;  2Z86 A;  4JD0 A;  1FR9 A;  4B4M A;  5J49 A;  3I0D A;  1JVD A;  1H5S C;  1IIN A;  4EE3 A;  3ZGG A;  1W77 A;  2VD4 A;  1YP4 A;  1FZW A;  3HL3 A;  3OKR A;  3ZLK A;  2QGI A;  2RJ7 A;  2X5S A;  1ZCT A;  3OH3 A;  4FRA A;  5EJ1 A;  5CQM X;  3V0O A;  4FRO A;  1MC3 A;  2I5K A;  2BO6 A;  3F1C A;  2RIX A;  4DDZ A;  2YQC A;  5CQP A;  2YQS A;  1ZI5 A;  3CKV A;  2FY7 A;  3SXD A;  1O0R A;  4Y9X A;  1LL0 A;  1ZCV A;  4LW3 A;  3IOH A;  1QWJ A;  1ZCY A;  3SXB A;  3T7N A;  5C3A A;  1ZI4 A;  2VS3 A;  4KT7 A;  1HM8 A; 
#chains in the Genus database with same CATH topology
 1GX4 A;  5C8R A;  5FYE A;  4MYB A;  2PX7 A;  2W0W A;  4D48 A;  1XHB A;  4HO2 A;  3K8E A;  3POL A;  1HM9 A;  3Q80 A;  4BMA A;  3BRK X;  3I0F A;  1HV9 A;  3I0K A;  4FRE A;  5C4F A;  1FRW A;  2RJ6 A;  3V0N A;  4KPZ A;  3I0H A;  2O1F A;  4Y7G A;  1WSZ A;  2V0I A;  5JQQ A;  3F1Y A;  1G8O A;  3CKJ A;  1ON6 A;  1VGZ A;  1VZX A;  1S4P A;  2CU2 A;  2OI7 A;  2Z87 A;  1QGQ A;  2RJ8 A;  3TQD A;  4G87 A;  1GQC A;  1VIC A;  1FGX A;  1JYK A;  4EEA A;  4FCE A;  5CMF X;  1EZI A;  3I0C A;  2BO8 A;  2QH5 A;  4Q7C A;  1FOA A;  1R81 A;  4YS8 A;  2ZU8 A;  3OH2 A;  5C38 A;  2VK9 A;  4GBP A;  4B2X A;  5FU8 A;  1TW5 A;  3SX7 A;  3ZLL A;  2AEC A;  5C4D A;  4EE5 A;  4BQH A;  1S4O A;  1G9R A;  2RIY A;  4NAN A;  5EIY A;  1GA8 A;  1H5S B;  4Y7V A;  5D91 A;  1H4C A;  2FFV A;  1R80 A;  1XZ6 A;  4J18 A;  3USQ A;  2YCM A;  1G0R A;  1INJ A;  3CGX A;  4FRL A;  3I0G A;  1VGU A;  4EEO A;  4HO4 A;  2D7R A;  2ZU9 A;  4B4B A;  3D98 A;  4HOC A;  2D0J A;  1G3L A;  2YC5 A;  1LZ7 A;  1WT2 A;  1H7Q A;  4AC3 A;  3BCV A;  4O6N A;  1H7H A;  2W0V A;  3RMV A;  4KC1 A;  5CMJ A;  2YC3 A;  3K8D A;  4UEG A;  3SPT A;  4FRP A;  2RJ9 A;  5CMI A;  1K4V A;  5CMG X;  1JYL A;  2Y4L A;  1WT3 A;  4Y7F A;  4CVH A;  2JCJ A;  3EE5 A;  5L6V A;  4AYJ A;  5IFY A;  2XMH A;  4KRV A;  1G2V A;  3FOQ A;  3U2U A;  2YES A;  5AJP A;  4ASJ A;  1ZI1 A;  4HO9 A;  2FYC B;  4DE7 A;  1VM8 A;  1H7L A;  1FGG A;  4HCQ A;  4MIX A;  3T7O A;  4B5B A;  4E1K A;  4K6R A;  1ZJP A;  4NAL A;  4Y64 A;  1NHE B;  1S4N A;  2P6W A;  1OMX A;  4P02 A;  1H5R B;  3Q7U A;  1H7F A;  5C3B A;  2AM3 A;  5C4E A;  3DJ4 A;  3ZF8 A;  3TZT A;  4HO8 A;  3OH4 A;  5D92 A;  1TVY A;  4FRB A;  4CJC A;  3V0M A;  3I0L A;  4M4K A;  4O6M A;  3ZGF A;  5FU0 A;  4B3U A;  2AH9 A;  1QG8 A;  3SXG A;  1O23 B;  1H7T A;  3IOI A;  1ZI3 A;  1R82 A;  4KNX A;  1TZF A;  2BO4 A;  1FG5 N;  4EEM A;  3CKO A;  2FYB A;  4Y7T A;  1W57 A;  1H3M A;  1H7E A;  4FCU A;  2X60 A;  5C49 A;  2OI5 A;  4ASY A;  2RIT A;  3I0E A;  4KNR A;  5C48 A;  1ZDG A;  4NAK A;  1IIM A;  2RIZ A;  1VGW A;  3OGZ A;  1Z90 A;  5CQN X;  5FTV A;  1V84 A;  1ZJ3 A;  1JV1 A;  4JIS A;  5L6S A;  2O1G A;  3V90 A;  2P72 A;  2QKX A;  1OQM B;  3E26 A;  2A8U A;  1FXO A;  1V82 A;  3U0Y A;  3Q4S A;  1GQ9 A;  3U2W A;  2WE9 A;  1ZJO A;  2XWM A;  4KQL A;  4MND A;  4L41 C;  1LVW A;  4FRQ A;  4XWI A;  2YQJ A;  4D11 A;  2FFU A;  1O7O A;  1WT1 A;  1H5T B;  4CJB A;  4FIX A;  1ZDF A;  2I5E A;  3OC9 A;  1W55 A;  2RJ5 A;  1R7X A;  2PGY A;  3V0P A;  1LL3 A;  2APC A;  2OEF A;  5C1L A;  1ZIZ A;  2PA4 A;  4Y62 A;  1LZ0 A;  2V0H A;  1VGT A;  2VFZ A;  1G97 A;  2Y7A A;  2AES A;  2X65 A;  2V0L A;  2UX8 A;  4NAI A;  1G93 A;  1NWG B;  1NF5 B;  2Q4J A;  4HO5 A;  2AM4 A;  1H5S A;  5AJN A;  2J0A A;  2FYA A;  3R3I A;  4KPX A;  4Y6N A;  4IRQ A;  3R2W A;  2C0N A;  2JCO A;  1I52 A;  5C47 A;  2P73 A;  2XME A;  2VS4 A;  1HM0 A;  1H5S D;  3U2X A;  1WT0 A;  4G3P A;  1VZT A;  4DEC A;  3U2T A;  2AM5 A;  2PGV A;  3OAM A;  1JVG A;  1ZJ2 A;  2E8B A;  4ZDQ A;  3JUJ A;  1INI A;  2DPW A;  4M28 A;  4KC4 A;  2XWL A;  4EE4 A;  3I0I X;  1O7Q A;  3NGW A;  2VXM A;  1GX0 A;  3KIA A;  2YQH A;  3V0L A;  2WVL A;  3V91 A;  4KXO A;  2WGZ A;  1H4E A;  3DUV A;  1MP4 A;  4G3Q A;  3E25 A;  4ECM A;  5EJZ A;  2OI6 A;  2NXV A;  1H7G A;  2FYD B;  3U2V A;  4B2W A;  1JV3 A;  4G3S A;  3USR A;  2XWN A;  2JCL A;  1ZJ0 A;  3RMW A;  3T7M A;  1H5R A;  1EYR A;  4ARW A;  1G1L A;  3PKP A;  1YP3 A;  2A8W A;  3D5N A;  5FUH A;  3GUE A;  4LW6 A;  4FRD A;  4EVW A;  5HS2 A;  2ZU7 A;  4AYL A;  2E3D A;  1YP2 A;  1WVC A;  5CMH A;  2VS5 A;  4AAW A;  3LW6 A;  1NKH B;  1H4D A;  3JTJ A;  3RSB A;  5DDV A;  1G95 A;  2Y4J A;  2V0K A;  2OEG A;  4R7P A;  2X5Z A;  1ON8 A;  5AJO A;  1HJL A;  2BO7 A;  5C1H A;  4IRP A;  3SXC A;  2Y4M A;  5C4C A;  1R7T A;  4Y7U A;  3CKQ A;  2WVM A;  1FWY A;  3SX3 A;  4B42 A;  1MP3 A;  1OMZ A;  4Y6U A;  3V0Q A;  4FRM A;  4HO6 A;  4D0T A;  1ZJ1 A;  1G23 A;  3QVB A;  3DK5 A;  2RJ4 A;  1NQI B;  4C2S A;  4P00 A;  3I0J A;  1NMM B;  4KC2 A;  4M2B A;  1VPA A;  4EEG A;  1MP5 A;  5I1F A;  1FO8 A;  5C36 A;  2GGQ A;  1KWS A;  4M2A A;  1VH1 A;  3ST8 A;  2ICX A;  3PKQ A;  5IDT A;  1HJJ A;  1LZJ A;  1H5T A;  5IDS A;  1VH3 A;  2VSH A;  3CU0 A;  1LL2 A;  1PZT A;  2VXL A;  1FO9 A;  1TW1 A;  1R7Y A;  5CQO A;  1FXJ A;  2JCK A;  1R7U A;  5DDT A;  3FWW A;  3OH0 A;  3V8Z A;  4B4G A;  1VZU A;  2AGD A;  2RJ1 A;  1QGS A;  1YRO B;  4FRH A;  5CQL X;  3IOJ A;  1LZI A;  3N9W A;  2WEE A;  3CKN A;  5C1G A;  3SXA A;  3SX5 A;  2Y6P A;  3OH1 A;  1V83 A;  3SX8 A;  3D8V A;  2I7B A;  4D11 C;  1GWW A;  4CJ8 A;  5BXC A;  3O3P A;  4Y63 A;  1GWV A;  5FV9 A;  2MZB A;  3PNN A;  1ZHJ A;  2O1H A;  3JUK A;  4HO0 A;  2RJ0 A;  4HG6 A;  5C4B A;  1FR8 A;  2ICY A;  2D7I A;  1R7V A;  2VSI A;  2GGO A;  3V8Y A;  2WVK A;  1SS9 A;  5C3D A;  1PZY B;  1ZCU A;  1E5K A;  4D0Z A;  3SXE A;  4HO3 A;  2AE7 A;  3U0X A;  5FTS A;  2WAW A;  2V0J A;  2Y4K A;  2J0B A;  4FQW A;  2Z86 A;  4JD0 A;  1FR9 A;  4B4M A;  5J49 A;  3I0D A;  1JVD A;  1H5S C;  1IIN A;  4EE3 A;  3ZGG A;  1W77 A;  2VD4 A;  1YP4 A;  1FZW A;  3HL3 A;  3OKR A;  3ZLK A;  2QGI A;  2RJ7 A;  2X5S A;  1ZCT A;  3OH3 A;  4FRA A;  4FIY A;  5EJ1 A;  5CQM X;  3V0O A;  4FRO A;  1MC3 A;  2I5K A;  2BO6 A;  3F1C A;  2RIX A;  4DDZ A;  2YQC A;  5CQP A;  2YQS A;  1ZI5 A;  3CKV A;  2FY7 A;  3SXD A;  1O0R A;  4Y9X A;  1LL0 A;  1ZCV A;  4LW3 A;  3IOH A;  1QWJ A;  1ZCY A;  3SXB A;  3T7N A;  5C3A A;  1ZI4 A;  2VS3 A;  4KT7 A;  1HM8 A; 
#chains in the Genus database with same CATH homology
 1GX4 A;  5C8R A;  5FYE A;  4MYB A;  2PX7 A;  2W0W A;  4D48 A;  1XHB A;  4HO2 A;  3K8E A;  3POL A;  1HM9 A;  3Q80 A;  4BMA A;  3BRK X;  3I0F A;  1HV9 A;  3I0K A;  4FRE A;  5C4F A;  1FRW A;  2RJ6 A;  3V0N A;  4KPZ A;  3I0H A;  2O1F A;  4Y7G A;  1WSZ A;  2V0I A;  5JQQ A;  3F1Y A;  1G8O A;  3CKJ A;  1ON6 A;  1VGZ A;  1VZX A;  1S4P A;  2CU2 A;  2OI7 A;  2Z87 A;  1QGQ A;  2RJ8 A;  3TQD A;  4G87 A;  1GQC A;  1VIC A;  1FGX A;  1JYK A;  4EEA A;  4FCE A;  5CMF X;  1EZI A;  3I0C A;  2BO8 A;  2QH5 A;  4Q7C A;  1FOA A;  1R81 A;  4YS8 A;  2ZU8 A;  3OH2 A;  5C38 A;  2VK9 A;  4GBP A;  4B2X A;  5FU8 A;  1TW5 A;  3SX7 A;  3ZLL A;  2AEC A;  5C4D A;  4EE5 A;  4BQH A;  1S4O A;  1G9R A;  2RIY A;  4NAN A;  5EIY A;  1GA8 A;  1H5S B;  4Y7V A;  5D91 A;  1H4C A;  2FFV A;  1R80 A;  1XZ6 A;  4J18 A;  3USQ A;  2YCM A;  1G0R A;  1INJ A;  3CGX A;  4FRL A;  3I0G A;  1VGU A;  4EEO A;  4HO4 A;  2D7R A;  2ZU9 A;  4B4B A;  3D98 A;  4HOC A;  2D0J A;  1G3L A;  2YC5 A;  1LZ7 A;  1WT2 A;  1H7Q A;  4AC3 A;  3BCV A;  4O6N A;  1H7H A;  2W0V A;  3RMV A;  4KC1 A;  5CMJ A;  2YC3 A;  3K8D A;  4UEG A;  3SPT A;  4FRP A;  2RJ9 A;  5CMI A;  1K4V A;  5CMG X;  1JYL A;  2Y4L A;  1WT3 A;  4Y7F A;  4CVH A;  2JCJ A;  3EE5 A;  5L6V A;  4AYJ A;  5IFY A;  2XMH A;  4KRV A;  1G2V A;  3FOQ A;  3U2U A;  2YES A;  5AJP A;  4ASJ A;  1ZI1 A;  4HO9 A;  2FYC B;  4DE7 A;  1VM8 A;  1H7L A;  1FGG A;  4HCQ A;  4MIX A;  3T7O A;  4B5B A;  4E1K A;  4K6R A;  1ZJP A;  4NAL A;  4Y64 A;  1NHE B;  1S4N A;  2P6W A;  1OMX A;  4P02 A;  1H5R B;  3Q7U A;  1H7F A;  5C3B A;  2AM3 A;  5C4E A;  3DJ4 A;  3ZF8 A;  3TZT A;  4HO8 A;  3OH4 A;  5D92 A;  1TVY A;  4FRB A;  4CJC A;  3V0M A;  3I0L A;  4M4K A;  4O6M A;  3ZGF A;  5FU0 A;  4B3U A;  2AH9 A;  1QG8 A;  3SXG A;  1O23 B;  1H7T A;  3IOI A;  1ZI3 A;  1R82 A;  4KNX A;  1TZF A;  2BO4 A;  1FG5 N;  4EEM A;  3CKO A;  2FYB A;  4Y7T A;  1W57 A;  1H3M A;  1H7E A;  4FCU A;  2X60 A;  5C49 A;  2OI5 A;  4ASY A;  2RIT A;  3I0E A;  4KNR A;  5C48 A;  1ZDG A;  4NAK A;  1IIM A;  2RIZ A;  1VGW A;  3OGZ A;  1Z90 A;  5CQN X;  5FTV A;  1V84 A;  1ZJ3 A;  1JV1 A;  4JIS A;  5L6S A;  2O1G A;  3V90 A;  2P72 A;  2QKX A;  1OQM B;  3E26 A;  2A8U A;  1FXO A;  1V82 A;  3U0Y A;  3Q4S A;  1GQ9 A;  3U2W A;  2WE9 A;  1ZJO A;  2XWM A;  4KQL A;  4MND A;  4L41 C;  1LVW A;  4FRQ A;  4XWI A;  2YQJ A;  4D11 A;  2FFU A;  1O7O A;  1WT1 A;  1H5T B;  4CJB A;  4FIX A;  1ZDF A;  2I5E A;  3OC9 A;  1W55 A;  2RJ5 A;  1R7X A;  2PGY A;  3V0P A;  1LL3 A;  2APC A;  2OEF A;  5C1L A;  1ZIZ A;  2PA4 A;  4Y62 A;  1LZ0 A;  2V0H A;  1VGT A;  2VFZ A;  1G97 A;  2Y7A A;  2AES A;  2X65 A;  2V0L A;  2UX8 A;  4NAI A;  1G93 A;  1NWG B;  1NF5 B;  2Q4J A;  4HO5 A;  2AM4 A;  1H5S A;  5AJN A;  2J0A A;  2FYA A;  3R3I A;  4KPX A;  4Y6N A;  4IRQ A;  3R2W A;  2C0N A;  2JCO A;  1I52 A;  5C47 A;  2P73 A;  2XME A;  2VS4 A;  1HM0 A;  1H5S D;  3U2X A;  1WT0 A;  4G3P A;  1VZT A;  4DEC A;  3U2T A;  2AM5 A;  2PGV A;  3OAM A;  1JVG A;  1ZJ2 A;  2E8B A;  4ZDQ A;  3JUJ A;  1INI A;  2DPW A;  4M28 A;  4KC4 A;  2XWL A;  4EE4 A;  3I0I X;  1O7Q A;  3NGW A;  2VXM A;  1GX0 A;  3KIA A;  2YQH A;  3V0L A;  2WVL A;  3V91 A;  4KXO A;  2WGZ A;  1H4E A;  3DUV A;  1MP4 A;  4G3Q A;  3E25 A;  4ECM A;  5EJZ A;  2OI6 A;  2NXV A;  1H7G A;  2FYD B;  3U2V A;  4B2W A;  1JV3 A;  4G3S A;  3USR A;  2XWN A;  2JCL A;  1ZJ0 A;  3RMW A;  3T7M A;  1H5R A;  1EYR A;  4ARW A;  1G1L A;  3PKP A;  1YP3 A;  2A8W A;  3D5N A;  5FUH A;  3GUE A;  4LW6 A;  4FRD A;  4EVW A;  5HS2 A;  2ZU7 A;  4AYL A;  2E3D A;  1YP2 A;  1WVC A;  5CMH A;  2VS5 A;  4AAW A;  3LW6 A;  1NKH B;  1H4D A;  3JTJ A;  3RSB A;  5DDV A;  1G95 A;  2Y4J A;  2V0K A;  2OEG A;  4R7P A;  2X5Z A;  1ON8 A;  5AJO A;  1HJL A;  2BO7 A;  5C1H A;  4IRP A;  3SXC A;  2Y4M A;  5C4C A;  1R7T A;  4Y7U A;  3CKQ A;  2WVM A;  1FWY A;  3SX3 A;  4B42 A;  1MP3 A;  1OMZ A;  4Y6U A;  3V0Q A;  4FRM A;  4HO6 A;  4D0T A;  1ZJ1 A;  1G23 A;  3QVB A;  3DK5 A;  2RJ4 A;  1NQI B;  4C2S A;  4P00 A;  3I0J A;  1NMM B;  4KC2 A;  4M2B A;  1VPA A;  4EEG A;  1MP5 A;  5I1F A;  1FO8 A;  5C36 A;  2GGQ A;  1KWS A;  4M2A A;  1VH1 A;  3ST8 A;  2ICX A;  3PKQ A;  5IDT A;  1HJJ A;  1LZJ A;  1H5T A;  5IDS A;  1VH3 A;  2VSH A;  3CU0 A;  1LL2 A;  1PZT A;  2VXL A;  1FO9 A;  1TW1 A;  1R7Y A;  5CQO A;  1FXJ A;  2JCK A;  1R7U A;  5DDT A;  3FWW A;  3OH0 A;  3V8Z A;  4B4G A;  1VZU A;  2AGD A;  2RJ1 A;  1QGS A;  1YRO B;  4FRH A;  5CQL X;  3IOJ A;  1LZI A;  3N9W A;  2WEE A;  3CKN A;  5C1G A;  3SXA A;  3SX5 A;  2Y6P A;  3OH1 A;  1V83 A;  3SX8 A;  3D8V A;  2I7B A;  4D11 C;  1GWW A;  4CJ8 A;  5BXC A;  3O3P A;  4Y63 A;  1GWV A;  5FV9 A;  2MZB A;  3PNN A;  1ZHJ A;  2O1H A;  3JUK A;  4HO0 A;  2RJ0 A;  4HG6 A;  5C4B A;  1FR8 A;  2ICY A;  2D7I A;  1R7V A;  2VSI A;  2GGO A;  3V8Y A;  2WVK A;  1SS9 A;  5C3D A;  1PZY B;  1ZCU A;  1E5K A;  4D0Z A;  3SXE A;  4HO3 A;  2AE7 A;  3U0X A;  5FTS A;  2WAW A;  2V0J A;  2Y4K A;  2J0B A;  4FQW A;  2Z86 A;  4JD0 A;  1FR9 A;  4B4M A;  5J49 A;  3I0D A;  1JVD A;  1H5S C;  1IIN A;  4EE3 A;  3ZGG A;  1W77 A;  2VD4 A;  1YP4 A;  1FZW A;  3HL3 A;  3OKR A;  3ZLK A;  2QGI A;  2RJ7 A;  2X5S A;  1ZCT A;  3OH3 A;  4FRA A;  4FIY A;  5EJ1 A;  5CQM X;  3V0O A;  4FRO A;  1MC3 A;  2I5K A;  2BO6 A;  3F1C A;  2RIX A;  4DDZ A;  2YQC A;  5CQP A;  2YQS A;  1ZI5 A;  3CKV A;  2FY7 A;  3SXD A;  1O0R A;  4Y9X A;  1LL0 A;  1ZCV A;  4LW3 A;  3IOH A;  1QWJ A;  1ZCY A;  3SXB A;  3T7N A;  5C3A A;  1ZI4 A;  2VS3 A;  4KT7 A;  1HM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...