3USRA

Structure of y194f glycogenin mutant truncated at residue 270
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
259
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIFSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Mechanisms of monomeric and dimeric glycogenin autoglucosylation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 86
structure length 259
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3usrA00
4MNDA 1NWGB 5BXCA 2AESA 1WT3A 3SX7A 1ZDFA 5C4FA 2VXLA 1FZWA 4G3PA 1VM8A 1H5TB 1LVWA 1FXOA 1S4PA 3I0HA 5C8RA 1VZUA 2W0VA 1TZFA 1KWSA 5CQOA 3BCVA 1H5SD 1H4DA 1FGGA 3TZTA 2X5ZA 2VFZA 5EJ1A 2RJ8A 2Y6PA 1GX0A 2WEEA 4JD0A 4B5BA 4DECA 2JCKA 5HS2A 5C3BA 1ZIZA 2Z86A 3I0JA 1G23A 4AYJA 4K6RA 3IOHA 2YESA 4EEGA 1LZ7A 4HO0A 4KPZA 2JCOA 1GA8A 2O1HA 1W77A 2VD4A 4EEOA 1G1LA 4CJCA 1R81A 4M2BA 2I5EA 1INIA 4Y7TA 1LL3A 4EE5A 2VXMA 1FG5N 4XWIA 4DE7A 1R82A 1H5SB 1H4EA 4HO2A 3V8YA 1QG8A 3U0YA 1FGXA 1H7EA 2BO6A 2PGYA 1WVCA 5AJNA 3N9WA 4Y7GA 4AYLA 3SXAA 1VICA 4D11A 1EZIA 2PA4A 3RSBA 2OI7A 3SXEA 1HJLA 2Y4KA 2ZU7A 4Y6UA 4JISA 2QGIA 2VSIA 5C4EA 2GGOA 1R7VA 1OQMB 3SX8A 4B4GA 1VZXA 1G9RA 2APCA 4GBPA 4FREA 3D98A 4J18A 4KPXA 3RMVA 4NAKA 1H5SC 2V0IA 3T7OA 1FOAA 4KXOA 1R80A 1YROB 1H7GA 2RJ4A 3OH3A 1GWWA 2AM4A 4UEGA 4Y7VA 3SPTA 4C2SA 1ZI5A 4KC1A 1GWVA 5C47A 2V0HA 5C4CA 2FYCB 2FY7A 1H5SA 5JQQA 4KQLA 4Y64A 1HJJA 4ECMA 4FCEA 1MP5A 3EE5A 2X5SA 2AM3A 1VGZA 3V0MA 2ZU9A 4B2WA 4EVWA 4FRLA 1TW1A 5C3AA 4B4MA 1EYRA 2WAWA 4KT7A 4NALA 1H4CA 2O1FA 1JVGA 1IINA 2QKXA 3SXCA 4MYBA 2AECA 4HO9A 5FV9A 2RIYA 5AJPA 2Y4MA 3OH1A 4KNXA 4B2XA 4B42A 1VGUA 3I0KA 1VGWA 1FR9A 2Y4JA 2I5KA 1V83A 4HO8A 4Y7FA 2OEGA 4FRBA 2I7BA 4LW6A 3USRA 1PZTA 4B4BA 3OAMA 5CQPA 3Q4SA 2Y7AA 2RJ7A 2YQCA 1H3MA 1G97A 1V84A 4EEAA 5L6VA 5CMIA 5CMGX 4HOCA 4YS8A 1YP3A 3U0XA 1LZ0A 2WVMA 5FTVA 3O3PA 3OH2A 1YP2A 4ZDQA 3I0LA 5FYEA 2CU2A 5C1HA 4G3SA 1H7LA 2FYAA 1ZJ0A 1YP4A 1ZJPA 3ST8A 2BO8A 5C4BA 4FQWA 3E25A 5C48A 4Y63A 2E8BA 4FRQA 4Y7UA 1OMXA 4FRMA 4M2AA 2YC5A 1NF5B 4E1KA 1NMMB 4D11C 2RJ5A 1IIMA 1SS9A 2Q4JA 3PNNA 3T7NA 3U2XA 2RITA 2VS3A 3CKNA 1GQCA 4Y9XA 5AJOA 4HO5A 4HO4A 4ARWA 3CKJA 5DDTA 1ON8A 3LW6A 5CMHA 4KC2A 3DK5A 2JCJA 2X60A 5I1FA 3PKPA 3V0OA 2V0LA 1H7TA 1H7HA 1MP4A 1ZCVA 3V0NA 1ZJ2A 2JCLA 1ZCYA 3Q7UA 4Y6NA 4L41C 3NGWA 1OMZA 5C4DA 2BO7A 3ZLLA 1FR8A 2A8WA 1R7TA 3CGXA 3V0LA 3JTJA 3V0QA 2FYDB 2BO4A 2V0KA 4P02A 3R3IA 5FTSA 5C3DA 1O0RA 1ZI1A 3T7MA 3CU0A 3I0DA 5CQLX 3ZF8A 1WSZA 2RJ9A 3V90A 1NQIB 2AH9A 2PX7A 2NXVA 5C38A 1G8OA 2O1GA 2YC3A 1S4OA 5CQNX 3U2VA 1MP3A 2ZU8A 4ASYA 4Y62A 1VZTA 3CKQA 3OH4A 1W57A 3GUEA 1H5RA 3F1CA 3D5NA 1JVDA 1VH1A 4CJ8A 1I52A 3CKOA 3RMWA 1W55A 4M4KA 4AAWA 1S4NA 1H7FA 4HO3A 5IFYA 2YQHA 4R7PA 1VH3A 5C36A 3V8ZA 3I0EA 1PZYB 2XMHA 5IDTA 2VSHA 3DUVA 3I0CA 3V91A 4FCUA 4HO6A 1GX4A 2YCMA 2RJ1A 5J49A 3ZGGA 4CVHA 2P72A 3K8EA 1HM0A 1JV1A 2V0JA 3D8VA 2VS4A 2P73A 1O7OA 3K8DA 5DDVA 2YQSA 1XHBA 2PGVA 5C49A 2OI5A 1QWJA 3PKQA 2X65A 2P6WA 3POLA 1JYKA 5FU0A 1TVYA 2DPWA 2OEFA 3F1YA 1JV3A 4D0TA 4CJBA 2WVKA 4LW3A 1LZJA 4FRHA 1H7QA 2AGDA 2FFVA 3USQA 1K4VA 1VPAA 1WT0A 2D7IA 4FRDA 2VS5A 1NKHB 1R7UA 2Y4LA 2WGZA 3U2TA 2W0WA 1LL2A 5C1LA 2FFUA 1Z90A 4P00A 4FROA 3JUJA 1JYLA 1ON6A 1ZI3A 5FU8A 2GGQA 1ZJ1A 2YQJA 1LZIA 5IDSA 3U2WA 1QGSA 1FRWA 1G2VA 4HG6A 1GQ9A 2RJ6A 5C1GA 1NHEB 2AM5A 2XWLA 1HM9A 3U2UA 1R7XA 1ZCTA 1TW5A 1H5RB 1WT1A 3E26A 2QH5A 3SXGA 3SX3A 1MC3A 5L6SA 2RJ0A 1G95A 1LL0A 1H5TA 1G93A 4HCQA 3DJ4A 1FO8A 3OC9A 5FUHA 3SXDA 1XZ6A 4D48A 2ICYA 4NAIA 4G87A 2XWNA 5CMFX 3R2WA 4NANA 3SX5A 4AC3A 4KRVA 5CMJA 3V0PA 4EEMA 1HM8A 4G3QA 1ZJ3A 4EE3A 3I0IX 4FRPA 5EJZA 4B3UA 4DDZA 5EIYA 1V82A 1O7QA 1ZI4A 2WVLA 4KNRA 3FOQA 2RIZA 4M28A 1O23B 3I0GA 3KIAA 3SXBA 3ZLKA 4EE4A 2UX8A 2XMEA 5CQMX 3OGZA 2WE9A 2D7RA 2RIXA 3HL3A 4FRAA 3ZGFA 3OKRA 1R7YA 1FXJA 2E3DA 1G0RA 1WT2A 3OH0A 3JUKA 4IRPA 2D0JA 1ZHJA 3TQDA 2XWMA 3BRKX 3IOJA 1ZDGA 1VGTA 4D0ZA 1ZCUA 2AE7A 4ASJA 4BQHA 2OI6A 3Q80A 2MZBA 4IRQA 1G3LA 1E5KA 3IOIA 2A8UA 1QGQA 1FWYA 3FWWA 1INJA 3I0FA 3QVBA 4BMAA 1ZJOA 2ICXA 4KC4A 1FO9A 2FYBA 1HV9A 3CKVA 2Z87A
chains in the Genus database with same CATH superfamily
4MNDA 1NWGB 5BXCA 2AESA 1WT3A 3SX7A 1ZDFA 5C4FA 2VXLA 1FZWA 4G3PA 1VM8A 1H5TB 1LVWA 1FXOA 1S4PA 3I0HA 5C8RA 1VZUA 2W0VA 1TZFA 1KWSA 5CQOA 3BCVA 1H5SD 1H4DA 1FGGA 3TZTA 2X5ZA 2VFZA 5EJ1A 2RJ8A 5D92A 2Y6PA 1GX0A 2WEEA 4JD0A 4O6NA 4B5BA 4DECA 2JCKA 5HS2A 5C3BA 1ZIZA 2Z86A 3I0JA 1G23A 4AYJA 4K6RA 3IOHA 2YESA 4EEGA 1LZ7A 4HO0A 4KPZA 2JCOA 1GA8A 2O1HA 1W77A 2VD4A 4EEOA 2VK9A 1G1LA 4CJCA 1R81A 4M2BA 2I5EA 1INIA 4Y7TA 1LL3A 4EE5A 2VXMA 1FG5N 4XWIA 4DE7A 1R82A 1H5SB 1H4EA 4HO2A 3V8YA 1QG8A 3U0YA 1FGXA 1H7EA 2BO6A 2PGYA 1WVCA 5AJNA 3N9WA 4Y7GA 4AYLA 3SXAA 1VICA 4D11A 1EZIA 2PA4A 3RSBA 2OI7A 3SXEA 1HJLA 2Y4KA 2ZU7A 4Y6UA 4JISA 2QGIA 2VSIA 5C4EA 2GGOA 1R7VA 1OQMB 3SX8A 4B4GA 1VZXA 1G9RA 2APCA 4GBPA 4FREA 3D98A 4J18A 4KPXA 3RMVA 4NAKA 4FIYA 1H5SC 2V0IA 3T7OA 1FOAA 4KXOA 1R80A 1YROB 1H7GA 2RJ4A 3OH3A 1GWWA 2AM4A 4UEGA 4Y7VA 3SPTA 4C2SA 1ZI5A 4KC1A 1GWVA 5C47A 2V0HA 5C4CA 2FYCB 2FY7A 1H5SA 5JQQA 4KQLA 4Y64A 1HJJA 4ECMA 4FCEA 1MP5A 3EE5A 2X5SA 2AM3A 1VGZA 3V0MA 2ZU9A 4B2WA 4EVWA 4FRLA 1TW1A 5C3AA 4B4MA 1EYRA 2WAWA 4KT7A 4NALA 1H4CA 2O1FA 1JVGA 1IINA 2QKXA 3SXCA 4MYBA 2AECA 4HO9A 5FV9A 2RIYA 5AJPA 2Y4MA 3OH1A 4KNXA 4B2XA 4B42A 1VGUA 3I0KA 1VGWA 1FR9A 2Y4JA 2J0AA 2I5KA 1V83A 4HO8A 4Y7FA 2OEGA 4FRBA 2I7BA 4LW6A 3USRA 1PZTA 4B4BA 3OAMA 5CQPA 3Q4SA 2Y7AA 2RJ7A 2YQCA 1H3MA 1G97A 1V84A 4EEAA 5L6VA 5CMIA 5CMGX 4HOCA 4YS8A 1YP3A 3U0XA 1LZ0A 2WVMA 5FTVA 3O3PA 3OH2A 1YP2A 4ZDQA 3I0LA 5FYEA 2CU2A 5C1HA 4G3SA 4FIXA 1H7LA 2FYAA 1ZJ0A 1YP4A 1ZJPA 3ST8A 2BO8A 5C4BA 4FQWA 3E25A 5C48A 4Y63A 2E8BA 4FRQA 4Y7UA 1OMXA 4FRMA 4M2AA 2YC5A 1NF5B 4E1KA 1NMMB 4D11C 2RJ5A 1IIMA 1SS9A 2Q4JA 3PNNA 3T7NA 3U2XA 2RITA 2VS3A 3CKNA 1GQCA 4Y9XA 5AJOA 4HO5A 4HO4A 4ARWA 3CKJA 5DDTA 1ON8A 3LW6A 5CMHA 4KC2A 3DK5A 2JCJA 2X60A 5I1FA 3PKPA 3V0OA 2V0LA 1H7TA 1H7HA 1MP4A 1ZCVA 3V0NA 1ZJ2A 2JCLA 1ZCYA 3Q7UA 4Y6NA 4L41C 3NGWA 1OMZA 5C4DA 2BO7A 3ZLLA 1FR8A 2A8WA 1R7TA 3CGXA 3V0LA 3JTJA 3V0QA 2FYDB 2BO4A 2V0KA 4P02A 3R3IA 5FTSA 5C3DA 1O0RA 1ZI1A 3T7MA 3CU0A 3I0DA 5CQLX 3ZF8A 1WSZA 2RJ9A 3V90A 1NQIB 2AH9A 2PX7A 2NXVA 4Q7CA 1G8OA 5C38A 2O1GA 2YC3A 1S4OA 5CQNX 3U2VA 1MP3A 2ZU8A 4ASYA 4Y62A 1VZTA 3CKQA 3OH4A 1W57A 3GUEA 1H5RA 3F1CA 3D5NA 1JVDA 1VH1A 4CJ8A 1I52A 3CKOA 3RMWA 1W55A 4M4KA 4AAWA 1S4NA 1H7FA 4HO3A 5IFYA 2YQHA 4R7PA 1VH3A 5C36A 3V8ZA 3I0EA 1PZYB 2XMHA 5IDTA 2VSHA 3DUVA 3I0CA 3V91A 4FCUA 4HO6A 1GX4A 2YCMA 2RJ1A 5J49A 3ZGGA 4CVHA 2P72A 3K8EA 1HM0A 1JV1A 2V0JA 3D8VA 2VS4A 2P73A 1O7OA 3K8DA 5DDVA 2YQSA 1XHBA 2PGVA 5C49A 2OI5A 1QWJA 3PKQA 2X65A 2P6WA 3POLA 1JYKA 5FU0A 1TVYA 2DPWA 2OEFA 3F1YA 1JV3A 4D0TA 4CJBA 2WVKA 4LW3A 1LZJA 4FRHA 1H7QA 2AGDA 2FFVA 3USQA 1K4VA 1VPAA 1WT0A 2D7IA 4FRDA 2VS5A 1NKHB 1R7UA 2Y4LA 2WGZA 3U2TA 2W0WA 1LL2A 5C1LA 2FFUA 1Z90A 4P00A 4FROA 5D91A 3JUJA 1JYLA 1ON6A 1ZI3A 5FU8A 2GGQA 1ZJ1A 2YQJA 1LZIA 5IDSA 3U2WA 1QGSA 1FRWA 1G2VA 4HG6A 1GQ9A 2RJ6A 5C1GA 1NHEB 2AM5A 2XWLA 1HM9A 3U2UA 1R7XA 1ZCTA 1TW5A 1H5RB 1WT1A 3E26A 2QH5A 3SXGA 3SX3A 4MIXA 1MC3A 5L6SA 2RJ0A 1G95A 1LL0A 1H5TA 1G93A 4HCQA 3DJ4A 1FO8A 3OC9A 5FUHA 3SXDA 1XZ6A 4D48A 2ICYA 4NAIA 4G87A 2XWNA 5CMFX 3R2WA 4NANA 3SX5A 4AC3A 4KRVA 5CMJA 2J0BA 3V0PA 4EEMA 1HM8A 4G3QA 1ZJ3A 4EE3A 3I0IX 4FRPA 5EJZA 4B3UA 4DDZA 5EIYA 1V82A 1O7QA 1ZI4A 4O6MA 2WVLA 4KNRA 3FOQA 2RIZA 4M28A 1O23B 3I0GA 3KIAA 3SXBA 3ZLKA 4EE4A 2UX8A 2XMEA 5CQMX 3OGZA 2WE9A 2D7RA 2RIXA 3HL3A 4FRAA 3ZGFA 3OKRA 1R7YA 1FXJA 2E3DA 1G0RA 1WT2A 3OH0A 3JUKA 4IRPA 2D0JA 1ZHJA 3TQDA 2XWMA 3BRKX 3IOJA 1ZDGA 1VGTA 4D0ZA 1ZCUA 2AE7A 2C0NA 4ASJA 4BQHA 2OI6A 3Q80A 2MZBA 4IRQA 1G3LA 1E5KA 3IOIA 2A8UA 1QGQA 1FWYA 3FWWA 1INJA 3I0FA 3QVBA 4BMAA 1ZJOA 2ICXA 4KC4A 1FO9A 2FYBA 1HV9A 3CKVA 2Z87A
chains in the Genus database with same CATH topology
4MNDA 1NWGB 5BXCA 2AESA 1WT3A 3SX7A 1ZDFA 5C4FA 2VXLA 1FZWA 4G3PA 1VM8A 1H5TB 1LVWA 1FXOA 1S4PA 3I0HA 5C8RA 1VZUA 2W0VA 1TZFA 1KWSA 5CQOA 3BCVA 1H5SD 1H4DA 1FGGA 3TZTA 2X5ZA 2VFZA 5EJ1A 2RJ8A 5D92A 2Y6PA 1GX0A 2WEEA 4JD0A 4O6NA 4B5BA 4DECA 2JCKA 5HS2A 5C3BA 1ZIZA 2Z86A 3I0JA 1G23A 4AYJA 4K6RA 3IOHA 2YESA 4EEGA 1LZ7A 4HO0A 4KPZA 2JCOA 1GA8A 2O1HA 1W77A 2VD4A 4EEOA 2VK9A 1G1LA 4CJCA 1R81A 4M2BA 2I5EA 1INIA 4Y7TA 1LL3A 4EE5A 2VXMA 1FG5N 4XWIA 4DE7A 1R82A 1H5SB 1H4EA 4HO2A 3V8YA 1QG8A 3U0YA 1FGXA 1H7EA 2BO6A 2PGYA 1WVCA 5AJNA 3N9WA 4Y7GA 4AYLA 3SXAA 1VICA 4D11A 1EZIA 2PA4A 3RSBA 2OI7A 3SXEA 1HJLA 2Y4KA 2ZU7A 4Y6UA 4JISA 2QGIA 2VSIA 5C4EA 2GGOA 1R7VA 1OQMB 3SX8A 4B4GA 1VZXA 1G9RA 2APCA 4GBPA 4FREA 3D98A 4J18A 4KPXA 3RMVA 4NAKA 4FIYA 1H5SC 2V0IA 3T7OA 1FOAA 4KXOA 1R80A 1YROB 1H7GA 2RJ4A 3OH3A 1GWWA 2AM4A 4UEGA 4Y7VA 3SPTA 4C2SA 1ZI5A 4KC1A 1GWVA 5C47A 2V0HA 5C4CA 2FYCB 2FY7A 1H5SA 5JQQA 4KQLA 4Y64A 1HJJA 4ECMA 4FCEA 1MP5A 3EE5A 2X5SA 2AM3A 1VGZA 3V0MA 2ZU9A 4B2WA 4EVWA 4FRLA 1TW1A 5C3AA 4B4MA 1EYRA 2WAWA 4KT7A 4NALA 1H4CA 2O1FA 1JVGA 1IINA 2QKXA 3SXCA 4MYBA 2AECA 4HO9A 5FV9A 2RIYA 5AJPA 2Y4MA 3OH1A 4KNXA 4B2XA 4B42A 1VGUA 3I0KA 1VGWA 1FR9A 2Y4JA 2J0AA 2I5KA 1V83A 4HO8A 4Y7FA 2OEGA 4FRBA 2I7BA 4LW6A 3USRA 1PZTA 4B4BA 3OAMA 5CQPA 3Q4SA 2Y7AA 2RJ7A 2YQCA 1H3MA 1G97A 1V84A 4EEAA 5L6VA 5CMIA 5CMGX 4HOCA 4YS8A 1YP3A 3U0XA 1LZ0A 2WVMA 5FTVA 3O3PA 3OH2A 1YP2A 4ZDQA 3I0LA 5FYEA 2CU2A 5C1HA 4G3SA 4FIXA 1H7LA 2FYAA 1ZJ0A 1YP4A 1ZJPA 3ST8A 2BO8A 5C4BA 4FQWA 3E25A 5C48A 4Y63A 2E8BA 4FRQA 4Y7UA 1OMXA 4FRMA 4M2AA 2YC5A 1NF5B 4E1KA 1NMMB 4D11C 2RJ5A 1IIMA 1SS9A 2Q4JA 3PNNA 3T7NA 3U2XA 2RITA 2VS3A 3CKNA 1GQCA 4Y9XA 5AJOA 4HO5A 4HO4A 4ARWA 3CKJA 5DDTA 1ON8A 3LW6A 5CMHA 4KC2A 3DK5A 2JCJA 2X60A 5I1FA 3PKPA 3V0OA 2V0LA 1H7TA 1H7HA 1MP4A 1ZCVA 3V0NA 1ZJ2A 2JCLA 1ZCYA 3Q7UA 4Y6NA 4L41C 3NGWA 1OMZA 5C4DA 2BO7A 3ZLLA 1FR8A 2A8WA 1R7TA 3CGXA 3V0LA 3JTJA 3V0QA 2FYDB 2BO4A 2V0KA 4P02A 3R3IA 5FTSA 5C3DA 1O0RA 1ZI1A 3T7MA 3CU0A 3I0DA 5CQLX 3ZF8A 1WSZA 2RJ9A 3V90A 1NQIB 2AH9A 2PX7A 2NXVA 4Q7CA 1G8OA 5C38A 2O1GA 2YC3A 1S4OA 5CQNX 3U2VA 1MP3A 2ZU8A 4ASYA 4Y62A 1VZTA 3CKQA 3OH4A 1W57A 3GUEA 1H5RA 3F1CA 3D5NA 1JVDA 1VH1A 4CJ8A 1I52A 3CKOA 3RMWA 1W55A 4M4KA 4AAWA 1S4NA 1H7FA 4HO3A 5IFYA 2YQHA 4R7PA 1VH3A 5C36A 3V8ZA 3I0EA 1PZYB 2XMHA 5IDTA 2VSHA 3DUVA 3I0CA 3V91A 4FCUA 4HO6A 1GX4A 2YCMA 2RJ1A 5J49A 3ZGGA 4CVHA 2P72A 3K8EA 1HM0A 1JV1A 2V0JA 3D8VA 2VS4A 2P73A 1O7OA 3K8DA 5DDVA 2YQSA 1XHBA 2PGVA 5C49A 2OI5A 1QWJA 3PKQA 2X65A 2P6WA 3POLA 1JYKA 5FU0A 1TVYA 2DPWA 2OEFA 3F1YA 1JV3A 4D0TA 4CJBA 2WVKA 4LW3A 1LZJA 4FRHA 1H7QA 2AGDA 2FFVA 3USQA 1K4VA 1VPAA 1WT0A 2D7IA 4FRDA 2VS5A 1NKHB 1R7UA 2Y4LA 2WGZA 3U2TA 2W0WA 1LL2A 5C1LA 2FFUA 1Z90A 4P00A 4FROA 5D91A 3JUJA 1JYLA 1ON6A 1ZI3A 5FU8A 2GGQA 1ZJ1A 2YQJA 1LZIA 5IDSA 3U2WA 1QGSA 1FRWA 1G2VA 4HG6A 1GQ9A 2RJ6A 5C1GA 1NHEB 2AM5A 2XWLA 1HM9A 3U2UA 1R7XA 1ZCTA 1TW5A 1H5RB 1WT1A 3E26A 2QH5A 3SXGA 3SX3A 4MIXA 1MC3A 5L6SA 2RJ0A 1G95A 1LL0A 1H5TA 1G93A 4HCQA 3DJ4A 1FO8A 3OC9A 5FUHA 3SXDA 1XZ6A 4D48A 2ICYA 4NAIA 4G87A 2XWNA 5CMFX 3R2WA 4NANA 3SX5A 4AC3A 4KRVA 5CMJA 2J0BA 3V0PA 4EEMA 1HM8A 4G3QA 1ZJ3A 4EE3A 3I0IX 4FRPA 5EJZA 4B3UA 4DDZA 5EIYA 1V82A 1O7QA 1ZI4A 4O6MA 2WVLA 4KNRA 3FOQA 2RIZA 4M28A 1O23B 3I0GA 3KIAA 3SXBA 3ZLKA 4EE4A 2UX8A 2XMEA 5CQMX 3OGZA 2WE9A 2D7RA 2RIXA 3HL3A 4FRAA 3ZGFA 3OKRA 1R7YA 1FXJA 2E3DA 1G0RA 1WT2A 3OH0A 3JUKA 4IRPA 2D0JA 1ZHJA 3TQDA 2XWMA 3BRKX 3IOJA 1ZDGA 1VGTA 4D0ZA 1ZCUA 2AE7A 2C0NA 4ASJA 4BQHA 2OI6A 3Q80A 2MZBA 4IRQA 1G3LA 1E5KA 3IOIA 2A8UA 1QGQA 1FWYA 3FWWA 1INJA 3I0FA 3QVBA 4BMAA 1ZJOA 2ICXA 4KC4A 1FO9A 2FYBA 1HV9A 3CKVA 2Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MND A;  1NWG B;  5BXC A;  2AES A;  1WT3 A;  3SX7 A;  1ZDF A;  5C4F A;  2VXL A;  1FZW A;  4G3P A;  1VM8 A;  1H5T B;  1LVW A;  1FXO A;  1S4P A;  3I0H A;  5C8R A;  1VZU A;  2W0V A;  1TZF A;  1KWS A;  5CQO A;  3BCV A;  1H5S D;  1H4D A;  1FGG A;  3TZT A;  2X5Z A;  2VFZ A;  5EJ1 A;  2RJ8 A;  2Y6P A;  1GX0 A;  2WEE A;  4JD0 A;  4B5B A;  4DEC A;  2JCK A;  5HS2 A;  5C3B A;  1ZIZ A;  2Z86 A;  3I0J A;  1G23 A;  4AYJ A;  4K6R A;  3IOH A;  2YES A;  4EEG A;  1LZ7 A;  4HO0 A;  4KPZ A;  2JCO A;  1GA8 A;  2O1H A;  1W77 A;  2VD4 A;  4EEO A;  1G1L A;  4CJC A;  1R81 A;  4M2B A;  2I5E A;  1INI A;  4Y7T A;  1LL3 A;  4EE5 A;  2VXM A;  1FG5 N;  4XWI A;  4DE7 A;  1R82 A;  1H5S B;  1H4E A;  4HO2 A;  3V8Y A;  1QG8 A;  3U0Y A;  1FGX A;  1H7E A;  2BO6 A;  2PGY A;  1WVC A;  5AJN A;  3N9W A;  4Y7G A;  4AYL A;  3SXA A;  1VIC A;  4D11 A;  1EZI A;  2PA4 A;  3RSB A;  2OI7 A;  3SXE A;  1HJL A;  2Y4K A;  2ZU7 A;  4Y6U A;  4JIS A;  2QGI A;  2VSI A;  5C4E A;  2GGO A;  1R7V A;  1OQM B;  3SX8 A;  4B4G A;  1VZX A;  1G9R A;  2APC A;  4GBP A;  4FRE A;  3D98 A;  4J18 A;  4KPX A;  3RMV A;  4NAK A;  1H5S C;  2V0I A;  3T7O A;  1FOA A;  4KXO A;  1R80 A;  1YRO B;  1H7G A;  2RJ4 A;  3OH3 A;  1GWW A;  2AM4 A;  4UEG A;  4Y7V A;  3SPT A;  4C2S A;  1ZI5 A;  4KC1 A;  1GWV A;  5C47 A;  2V0H A;  5C4C A;  2FYC B;  2FY7 A;  1H5S A;  5JQQ A;  4KQL A;  4Y64 A;  1HJJ A;  4ECM A;  4FCE A;  1MP5 A;  3EE5 A;  2X5S A;  2AM3 A;  1VGZ A;  3V0M A;  2ZU9 A;  4B2W A;  4EVW A;  4FRL A;  1TW1 A;  5C3A A;  4B4M A;  1EYR A;  2WAW A;  4KT7 A;  4NAL A;  1H4C A;  2O1F A;  1JVG A;  1IIN A;  2QKX A;  3SXC A;  4MYB A;  2AEC A;  4HO9 A;  5FV9 A;  2RIY A;  5AJP A;  2Y4M A;  3OH1 A;  4KNX A;  4B2X A;  4B42 A;  1VGU A;  3I0K A;  1VGW A;  1FR9 A;  2Y4J A;  2I5K A;  1V83 A;  4HO8 A;  4Y7F A;  2OEG A;  4FRB A;  2I7B A;  4LW6 A;  3USR A;  1PZT A;  4B4B A;  3OAM A;  5CQP A;  3Q4S A;  2Y7A A;  2RJ7 A;  2YQC A;  1H3M A;  1G97 A;  1V84 A;  4EEA A;  5L6V A;  5CMI A;  5CMG X;  4HOC A;  4YS8 A;  1YP3 A;  3U0X A;  1LZ0 A;  2WVM A;  5FTV A;  3O3P A;  3OH2 A;  1YP2 A;  4ZDQ A;  3I0L A;  5FYE A;  2CU2 A;  5C1H A;  4G3S A;  1H7L A;  2FYA A;  1ZJ0 A;  1YP4 A;  1ZJP A;  3ST8 A;  2BO8 A;  5C4B A;  4FQW A;  3E25 A;  5C48 A;  4Y63 A;  2E8B A;  4FRQ A;  4Y7U A;  1OMX A;  4FRM A;  4M2A A;  2YC5 A;  1NF5 B;  4E1K A;  1NMM B;  4D11 C;  2RJ5 A;  1IIM A;  1SS9 A;  2Q4J A;  3PNN A;  3T7N A;  3U2X A;  2RIT A;  2VS3 A;  3CKN A;  1GQC A;  4Y9X A;  5AJO A;  4HO5 A;  4HO4 A;  4ARW A;  3CKJ A;  5DDT A;  1ON8 A;  3LW6 A;  5CMH A;  4KC2 A;  3DK5 A;  2JCJ A;  2X60 A;  5I1F A;  3PKP A;  3V0O A;  2V0L A;  1H7T A;  1H7H A;  1MP4 A;  1ZCV A;  3V0N A;  1ZJ2 A;  2JCL A;  1ZCY A;  3Q7U A;  4Y6N A;  4L41 C;  3NGW A;  1OMZ A;  5C4D A;  2BO7 A;  3ZLL A;  1FR8 A;  2A8W A;  1R7T A;  3CGX A;  3V0L A;  3JTJ A;  3V0Q A;  2FYD B;  2BO4 A;  2V0K A;  4P02 A;  3R3I A;  5FTS A;  5C3D A;  1O0R A;  1ZI1 A;  3T7M A;  3CU0 A;  3I0D A;  5CQL X;  3ZF8 A;  1WSZ A;  2RJ9 A;  3V90 A;  1NQI B;  2AH9 A;  2PX7 A;  2NXV A;  5C38 A;  1G8O A;  2O1G A;  2YC3 A;  1S4O A;  5CQN X;  3U2V A;  1MP3 A;  2ZU8 A;  4ASY A;  4Y62 A;  1VZT A;  3CKQ A;  3OH4 A;  1W57 A;  3GUE A;  1H5R A;  3F1C A;  3D5N A;  1JVD A;  1VH1 A;  4CJ8 A;  1I52 A;  3CKO A;  3RMW A;  1W55 A;  4M4K A;  4AAW A;  1S4N A;  1H7F A;  4HO3 A;  5IFY A;  2YQH A;  4R7P A;  1VH3 A;  5C36 A;  3V8Z A;  3I0E A;  1PZY B;  2XMH A;  5IDT A;  2VSH A;  3DUV A;  3I0C A;  3V91 A;  4FCU A;  4HO6 A;  1GX4 A;  2YCM A;  2RJ1 A;  5J49 A;  3ZGG A;  4CVH A;  2P72 A;  3K8E A;  1HM0 A;  1JV1 A;  2V0J A;  3D8V A;  2VS4 A;  2P73 A;  1O7O A;  3K8D A;  5DDV A;  2YQS A;  1XHB A;  2PGV A;  5C49 A;  2OI5 A;  1QWJ A;  3PKQ A;  2X65 A;  2P6W A;  3POL A;  1JYK A;  5FU0 A;  1TVY A;  2DPW A;  2OEF A;  3F1Y A;  1JV3 A;  4D0T A;  4CJB A;  2WVK A;  4LW3 A;  1LZJ A;  4FRH A;  1H7Q A;  2AGD A;  2FFV A;  3USQ A;  1K4V A;  1VPA A;  1WT0 A;  2D7I A;  4FRD A;  2VS5 A;  1NKH B;  1R7U A;  2Y4L A;  2WGZ A;  3U2T A;  2W0W A;  1LL2 A;  5C1L A;  2FFU A;  1Z90 A;  4P00 A;  4FRO A;  3JUJ A;  1JYL A;  1ON6 A;  1ZI3 A;  5FU8 A;  2GGQ A;  1ZJ1 A;  2YQJ A;  1LZI A;  5IDS A;  3U2W A;  1QGS A;  1FRW A;  1G2V A;  4HG6 A;  1GQ9 A;  2RJ6 A;  5C1G A;  1NHE B;  2AM5 A;  2XWL A;  1HM9 A;  3U2U A;  1R7X A;  1ZCT A;  1TW5 A;  1H5R B;  1WT1 A;  3E26 A;  2QH5 A;  3SXG A;  3SX3 A;  1MC3 A;  5L6S A;  2RJ0 A;  1G95 A;  1LL0 A;  1H5T A;  1G93 A;  4HCQ A;  3DJ4 A;  1FO8 A;  3OC9 A;  5FUH A;  3SXD A;  1XZ6 A;  4D48 A;  2ICY A;  4NAI A;  4G87 A;  2XWN A;  5CMF X;  3R2W A;  4NAN A;  3SX5 A;  4AC3 A;  4KRV A;  5CMJ A;  3V0P A;  4EEM A;  1HM8 A;  4G3Q A;  1ZJ3 A;  4EE3 A;  3I0I X;  4FRP A;  5EJZ A;  4B3U A;  4DDZ A;  5EIY A;  1V82 A;  1O7Q A;  1ZI4 A;  2WVL A;  4KNR A;  3FOQ A;  2RIZ A;  4M28 A;  1O23 B;  3I0G A;  3KIA A;  3SXB A;  3ZLK A;  4EE4 A;  2UX8 A;  2XME A;  5CQM X;  3OGZ A;  2WE9 A;  2D7R A;  2RIX A;  3HL3 A;  4FRA A;  3ZGF A;  3OKR A;  1R7Y A;  1FXJ A;  2E3D A;  1G0R A;  1WT2 A;  3OH0 A;  3JUK A;  4IRP A;  2D0J A;  1ZHJ A;  3TQD A;  2XWM A;  3BRK X;  3IOJ A;  1ZDG A;  1VGT A;  4D0Z A;  1ZCU A;  2AE7 A;  4ASJ A;  4BQH A;  2OI6 A;  3Q80 A;  2MZB A;  4IRQ A;  1G3L A;  1E5K A;  3IOI A;  2A8U A;  1QGQ A;  1FWY A;  3FWW A;  1INJ A;  3I0F A;  3QVB A;  4BMA A;  1ZJO A;  2ICX A;  4KC4 A;  1FO9 A;  2FYB A;  1HV9 A;  3CKV A;  2Z87 A; 
#chains in the Genus database with same CATH topology
 4MND A;  1NWG B;  5BXC A;  2AES A;  1WT3 A;  3SX7 A;  1ZDF A;  5C4F A;  2VXL A;  1FZW A;  4G3P A;  1VM8 A;  1H5T B;  1LVW A;  1FXO A;  1S4P A;  3I0H A;  5C8R A;  1VZU A;  2W0V A;  1TZF A;  1KWS A;  5CQO A;  3BCV A;  1H5S D;  1H4D A;  1FGG A;  3TZT A;  2X5Z A;  2VFZ A;  5EJ1 A;  2RJ8 A;  5D92 A;  2Y6P A;  1GX0 A;  2WEE A;  4JD0 A;  4O6N A;  4B5B A;  4DEC A;  2JCK A;  5HS2 A;  5C3B A;  1ZIZ A;  2Z86 A;  3I0J A;  1G23 A;  4AYJ A;  4K6R A;  3IOH A;  2YES A;  4EEG A;  1LZ7 A;  4HO0 A;  4KPZ A;  2JCO A;  1GA8 A;  2O1H A;  1W77 A;  2VD4 A;  4EEO A;  2VK9 A;  1G1L A;  4CJC A;  1R81 A;  4M2B A;  2I5E A;  1INI A;  4Y7T A;  1LL3 A;  4EE5 A;  2VXM A;  1FG5 N;  4XWI A;  4DE7 A;  1R82 A;  1H5S B;  1H4E A;  4HO2 A;  3V8Y A;  1QG8 A;  3U0Y A;  1FGX A;  1H7E A;  2BO6 A;  2PGY A;  1WVC A;  5AJN A;  3N9W A;  4Y7G A;  4AYL A;  3SXA A;  1VIC A;  4D11 A;  1EZI A;  2PA4 A;  3RSB A;  2OI7 A;  3SXE A;  1HJL A;  2Y4K A;  2ZU7 A;  4Y6U A;  4JIS A;  2QGI A;  2VSI A;  5C4E A;  2GGO A;  1R7V A;  1OQM B;  3SX8 A;  4B4G A;  1VZX A;  1G9R A;  2APC A;  4GBP A;  4FRE A;  3D98 A;  4J18 A;  4KPX A;  3RMV A;  4NAK A;  4FIY A;  1H5S C;  2V0I A;  3T7O A;  1FOA A;  4KXO A;  1R80 A;  1YRO B;  1H7G A;  2RJ4 A;  3OH3 A;  1GWW A;  2AM4 A;  4UEG A;  4Y7V A;  3SPT A;  4C2S A;  1ZI5 A;  4KC1 A;  1GWV A;  5C47 A;  2V0H A;  5C4C A;  2FYC B;  2FY7 A;  1H5S A;  5JQQ A;  4KQL A;  4Y64 A;  1HJJ A;  4ECM A;  4FCE A;  1MP5 A;  3EE5 A;  2X5S A;  2AM3 A;  1VGZ A;  3V0M A;  2ZU9 A;  4B2W A;  4EVW A;  4FRL A;  1TW1 A;  5C3A A;  4B4M A;  1EYR A;  2WAW A;  4KT7 A;  4NAL A;  1H4C A;  2O1F A;  1JVG A;  1IIN A;  2QKX A;  3SXC A;  4MYB A;  2AEC A;  4HO9 A;  5FV9 A;  2RIY A;  5AJP A;  2Y4M A;  3OH1 A;  4KNX A;  4B2X A;  4B42 A;  1VGU A;  3I0K A;  1VGW A;  1FR9 A;  2Y4J A;  2J0A A;  2I5K A;  1V83 A;  4HO8 A;  4Y7F A;  2OEG A;  4FRB A;  2I7B A;  4LW6 A;  3USR A;  1PZT A;  4B4B A;  3OAM A;  5CQP A;  3Q4S A;  2Y7A A;  2RJ7 A;  2YQC A;  1H3M A;  1G97 A;  1V84 A;  4EEA A;  5L6V A;  5CMI A;  5CMG X;  4HOC A;  4YS8 A;  1YP3 A;  3U0X A;  1LZ0 A;  2WVM A;  5FTV A;  3O3P A;  3OH2 A;  1YP2 A;  4ZDQ A;  3I0L A;  5FYE A;  2CU2 A;  5C1H A;  4G3S A;  4FIX A;  1H7L A;  2FYA A;  1ZJ0 A;  1YP4 A;  1ZJP A;  3ST8 A;  2BO8 A;  5C4B A;  4FQW A;  3E25 A;  5C48 A;  4Y63 A;  2E8B A;  4FRQ A;  4Y7U A;  1OMX A;  4FRM A;  4M2A A;  2YC5 A;  1NF5 B;  4E1K A;  1NMM B;  4D11 C;  2RJ5 A;  1IIM A;  1SS9 A;  2Q4J A;  3PNN A;  3T7N A;  3U2X A;  2RIT A;  2VS3 A;  3CKN A;  1GQC A;  4Y9X A;  5AJO A;  4HO5 A;  4HO4 A;  4ARW A;  3CKJ A;  5DDT A;  1ON8 A;  3LW6 A;  5CMH A;  4KC2 A;  3DK5 A;  2JCJ A;  2X60 A;  5I1F A;  3PKP A;  3V0O A;  2V0L A;  1H7T A;  1H7H A;  1MP4 A;  1ZCV A;  3V0N A;  1ZJ2 A;  2JCL A;  1ZCY A;  3Q7U A;  4Y6N A;  4L41 C;  3NGW A;  1OMZ A;  5C4D A;  2BO7 A;  3ZLL A;  1FR8 A;  2A8W A;  1R7T A;  3CGX A;  3V0L A;  3JTJ A;  3V0Q A;  2FYD B;  2BO4 A;  2V0K A;  4P02 A;  3R3I A;  5FTS A;  5C3D A;  1O0R A;  1ZI1 A;  3T7M A;  3CU0 A;  3I0D A;  5CQL X;  3ZF8 A;  1WSZ A;  2RJ9 A;  3V90 A;  1NQI B;  2AH9 A;  2PX7 A;  2NXV A;  4Q7C A;  1G8O A;  5C38 A;  2O1G A;  2YC3 A;  1S4O A;  5CQN X;  3U2V A;  1MP3 A;  2ZU8 A;  4ASY A;  4Y62 A;  1VZT A;  3CKQ A;  3OH4 A;  1W57 A;  3GUE A;  1H5R A;  3F1C A;  3D5N A;  1JVD A;  1VH1 A;  4CJ8 A;  1I52 A;  3CKO A;  3RMW A;  1W55 A;  4M4K A;  4AAW A;  1S4N A;  1H7F A;  4HO3 A;  5IFY A;  2YQH A;  4R7P A;  1VH3 A;  5C36 A;  3V8Z A;  3I0E A;  1PZY B;  2XMH A;  5IDT A;  2VSH A;  3DUV A;  3I0C A;  3V91 A;  4FCU A;  4HO6 A;  1GX4 A;  2YCM A;  2RJ1 A;  5J49 A;  3ZGG A;  4CVH A;  2P72 A;  3K8E A;  1HM0 A;  1JV1 A;  2V0J A;  3D8V A;  2VS4 A;  2P73 A;  1O7O A;  3K8D A;  5DDV A;  2YQS A;  1XHB A;  2PGV A;  5C49 A;  2OI5 A;  1QWJ A;  3PKQ A;  2X65 A;  2P6W A;  3POL A;  1JYK A;  5FU0 A;  1TVY A;  2DPW A;  2OEF A;  3F1Y A;  1JV3 A;  4D0T A;  4CJB A;  2WVK A;  4LW3 A;  1LZJ A;  4FRH A;  1H7Q A;  2AGD A;  2FFV A;  3USQ A;  1K4V A;  1VPA A;  1WT0 A;  2D7I A;  4FRD A;  2VS5 A;  1NKH B;  1R7U A;  2Y4L A;  2WGZ A;  3U2T A;  2W0W A;  1LL2 A;  5C1L A;  2FFU A;  1Z90 A;  4P00 A;  4FRO A;  5D91 A;  3JUJ A;  1JYL A;  1ON6 A;  1ZI3 A;  5FU8 A;  2GGQ A;  1ZJ1 A;  2YQJ A;  1LZI A;  5IDS A;  3U2W A;  1QGS A;  1FRW A;  1G2V A;  4HG6 A;  1GQ9 A;  2RJ6 A;  5C1G A;  1NHE B;  2AM5 A;  2XWL A;  1HM9 A;  3U2U A;  1R7X A;  1ZCT A;  1TW5 A;  1H5R B;  1WT1 A;  3E26 A;  2QH5 A;  3SXG A;  3SX3 A;  4MIX A;  1MC3 A;  5L6S A;  2RJ0 A;  1G95 A;  1LL0 A;  1H5T A;  1G93 A;  4HCQ A;  3DJ4 A;  1FO8 A;  3OC9 A;  5FUH A;  3SXD A;  1XZ6 A;  4D48 A;  2ICY A;  4NAI A;  4G87 A;  2XWN A;  5CMF X;  3R2W A;  4NAN A;  3SX5 A;  4AC3 A;  4KRV A;  5CMJ A;  2J0B A;  3V0P A;  4EEM A;  1HM8 A;  4G3Q A;  1ZJ3 A;  4EE3 A;  3I0I X;  4FRP A;  5EJZ A;  4B3U A;  4DDZ A;  5EIY A;  1V82 A;  1O7Q A;  1ZI4 A;  4O6M A;  2WVL A;  4KNR A;  3FOQ A;  2RIZ A;  4M28 A;  1O23 B;  3I0G A;  3KIA A;  3SXB A;  3ZLK A;  4EE4 A;  2UX8 A;  2XME A;  5CQM X;  3OGZ A;  2WE9 A;  2D7R A;  2RIX A;  3HL3 A;  4FRA A;  3ZGF A;  3OKR A;  1R7Y A;  1FXJ A;  2E3D A;  1G0R A;  1WT2 A;  3OH0 A;  3JUK A;  4IRP A;  2D0J A;  1ZHJ A;  3TQD A;  2XWM A;  3BRK X;  3IOJ A;  1ZDG A;  1VGT A;  4D0Z A;  1ZCU A;  2AE7 A;  2C0N A;  4ASJ A;  4BQH A;  2OI6 A;  3Q80 A;  2MZB A;  4IRQ A;  1G3L A;  1E5K A;  3IOI A;  2A8U A;  1QGQ A;  1FWY A;  3FWW A;  1INJ A;  3I0F A;  3QVB A;  4BMA A;  1ZJO A;  2ICX A;  4KC4 A;  1FO9 A;  2FYB A;  1HV9 A;  3CKV A;  2Z87 A; 
#chains in the Genus database with same CATH homology
 4MND A;  1NWG B;  5BXC A;  2AES A;  1WT3 A;  3SX7 A;  1ZDF A;  5C4F A;  2VXL A;  1FZW A;  4G3P A;  1VM8 A;  1H5T B;  1LVW A;  1FXO A;  1S4P A;  3I0H A;  5C8R A;  1VZU A;  2W0V A;  1TZF A;  1KWS A;  5CQO A;  3BCV A;  1H5S D;  1H4D A;  1FGG A;  3TZT A;  2X5Z A;  2VFZ A;  5EJ1 A;  2RJ8 A;  5D92 A;  2Y6P A;  1GX0 A;  2WEE A;  4JD0 A;  4O6N A;  4B5B A;  4DEC A;  2JCK A;  5HS2 A;  5C3B A;  1ZIZ A;  2Z86 A;  3I0J A;  1G23 A;  4AYJ A;  4K6R A;  3IOH A;  2YES A;  4EEG A;  1LZ7 A;  4HO0 A;  4KPZ A;  2JCO A;  1GA8 A;  2O1H A;  1W77 A;  2VD4 A;  4EEO A;  2VK9 A;  1G1L A;  4CJC A;  1R81 A;  4M2B A;  2I5E A;  1INI A;  4Y7T A;  1LL3 A;  4EE5 A;  2VXM A;  1FG5 N;  4XWI A;  4DE7 A;  1R82 A;  1H5S B;  1H4E A;  4HO2 A;  3V8Y A;  1QG8 A;  3U0Y A;  1FGX A;  1H7E A;  2BO6 A;  2PGY A;  1WVC A;  5AJN A;  3N9W A;  4Y7G A;  4AYL A;  3SXA A;  1VIC A;  4D11 A;  1EZI A;  2PA4 A;  3RSB A;  2OI7 A;  3SXE A;  1HJL A;  2Y4K A;  2ZU7 A;  4Y6U A;  4JIS A;  2QGI A;  2VSI A;  5C4E A;  2GGO A;  1R7V A;  1OQM B;  3SX8 A;  4B4G A;  1VZX A;  1G9R A;  2APC A;  4GBP A;  4FRE A;  3D98 A;  4J18 A;  4KPX A;  3RMV A;  4NAK A;  4FIY A;  1H5S C;  2V0I A;  3T7O A;  1FOA A;  4KXO A;  1R80 A;  1YRO B;  1H7G A;  2RJ4 A;  3OH3 A;  1GWW A;  2AM4 A;  4UEG A;  4Y7V A;  3SPT A;  4C2S A;  1ZI5 A;  4KC1 A;  1GWV A;  5C47 A;  2V0H A;  5C4C A;  2FYC B;  2FY7 A;  1H5S A;  5JQQ A;  4KQL A;  4Y64 A;  1HJJ A;  4ECM A;  4FCE A;  1MP5 A;  3EE5 A;  2X5S A;  2AM3 A;  1VGZ A;  3V0M A;  2ZU9 A;  4B2W A;  4EVW A;  4FRL A;  1TW1 A;  5C3A A;  4B4M A;  1EYR A;  2WAW A;  4KT7 A;  4NAL A;  1H4C A;  2O1F A;  1JVG A;  1IIN A;  2QKX A;  3SXC A;  4MYB A;  2AEC A;  4HO9 A;  5FV9 A;  2RIY A;  5AJP A;  2Y4M A;  3OH1 A;  4KNX A;  4B2X A;  4B42 A;  1VGU A;  3I0K A;  1VGW A;  1FR9 A;  2Y4J A;  2J0A A;  2I5K A;  1V83 A;  4HO8 A;  4Y7F A;  2OEG A;  4FRB A;  2I7B A;  4LW6 A;  3USR A;  1PZT A;  4B4B A;  3OAM A;  5CQP A;  3Q4S A;  2Y7A A;  2RJ7 A;  2YQC A;  1H3M A;  1G97 A;  1V84 A;  4EEA A;  5L6V A;  5CMI A;  5CMG X;  4HOC A;  4YS8 A;  1YP3 A;  3U0X A;  1LZ0 A;  2WVM A;  5FTV A;  3O3P A;  3OH2 A;  1YP2 A;  4ZDQ A;  3I0L A;  5FYE A;  2CU2 A;  5C1H A;  4G3S A;  4FIX A;  1H7L A;  2FYA A;  1ZJ0 A;  1YP4 A;  1ZJP A;  3ST8 A;  2BO8 A;  5C4B A;  4FQW A;  3E25 A;  5C48 A;  4Y63 A;  2E8B A;  4FRQ A;  4Y7U A;  1OMX A;  4FRM A;  4M2A A;  2YC5 A;  1NF5 B;  4E1K A;  1NMM B;  4D11 C;  2RJ5 A;  1IIM A;  1SS9 A;  2Q4J A;  3PNN A;  3T7N A;  3U2X A;  2RIT A;  2VS3 A;  3CKN A;  1GQC A;  4Y9X A;  5AJO A;  4HO5 A;  4HO4 A;  4ARW A;  3CKJ A;  5DDT A;  1ON8 A;  3LW6 A;  5CMH A;  4KC2 A;  3DK5 A;  2JCJ A;  2X60 A;  5I1F A;  3PKP A;  3V0O A;  2V0L A;  1H7T A;  1H7H A;  1MP4 A;  1ZCV A;  3V0N A;  1ZJ2 A;  2JCL A;  1ZCY A;  3Q7U A;  4Y6N A;  4L41 C;  3NGW A;  1OMZ A;  5C4D A;  2BO7 A;  3ZLL A;  1FR8 A;  2A8W A;  1R7T A;  3CGX A;  3V0L A;  3JTJ A;  3V0Q A;  2FYD B;  2BO4 A;  2V0K A;  4P02 A;  3R3I A;  5FTS A;  5C3D A;  1O0R A;  1ZI1 A;  3T7M A;  3CU0 A;  3I0D A;  5CQL X;  3ZF8 A;  1WSZ A;  2RJ9 A;  3V90 A;  1NQI B;  2AH9 A;  2PX7 A;  2NXV A;  4Q7C A;  1G8O A;  5C38 A;  2O1G A;  2YC3 A;  1S4O A;  5CQN X;  3U2V A;  1MP3 A;  2ZU8 A;  4ASY A;  4Y62 A;  1VZT A;  3CKQ A;  3OH4 A;  1W57 A;  3GUE A;  1H5R A;  3F1C A;  3D5N A;  1JVD A;  1VH1 A;  4CJ8 A;  1I52 A;  3CKO A;  3RMW A;  1W55 A;  4M4K A;  4AAW A;  1S4N A;  1H7F A;  4HO3 A;  5IFY A;  2YQH A;  4R7P A;  1VH3 A;  5C36 A;  3V8Z A;  3I0E A;  1PZY B;  2XMH A;  5IDT A;  2VSH A;  3DUV A;  3I0C A;  3V91 A;  4FCU A;  4HO6 A;  1GX4 A;  2YCM A;  2RJ1 A;  5J49 A;  3ZGG A;  4CVH A;  2P72 A;  3K8E A;  1HM0 A;  1JV1 A;  2V0J A;  3D8V A;  2VS4 A;  2P73 A;  1O7O A;  3K8D A;  5DDV A;  2YQS A;  1XHB A;  2PGV A;  5C49 A;  2OI5 A;  1QWJ A;  3PKQ A;  2X65 A;  2P6W A;  3POL A;  1JYK A;  5FU0 A;  1TVY A;  2DPW A;  2OEF A;  3F1Y A;  1JV3 A;  4D0T A;  4CJB A;  2WVK A;  4LW3 A;  1LZJ A;  4FRH A;  1H7Q A;  2AGD A;  2FFV A;  3USQ A;  1K4V A;  1VPA A;  1WT0 A;  2D7I A;  4FRD A;  2VS5 A;  1NKH B;  1R7U A;  2Y4L A;  2WGZ A;  3U2T A;  2W0W A;  1LL2 A;  5C1L A;  2FFU A;  1Z90 A;  4P00 A;  4FRO A;  5D91 A;  3JUJ A;  1JYL A;  1ON6 A;  1ZI3 A;  5FU8 A;  2GGQ A;  1ZJ1 A;  2YQJ A;  1LZI A;  5IDS A;  3U2W A;  1QGS A;  1FRW A;  1G2V A;  4HG6 A;  1GQ9 A;  2RJ6 A;  5C1G A;  1NHE B;  2AM5 A;  2XWL A;  1HM9 A;  3U2U A;  1R7X A;  1ZCT A;  1TW5 A;  1H5R B;  1WT1 A;  3E26 A;  2QH5 A;  3SXG A;  3SX3 A;  4MIX A;  1MC3 A;  5L6S A;  2RJ0 A;  1G95 A;  1LL0 A;  1H5T A;  1G93 A;  4HCQ A;  3DJ4 A;  1FO8 A;  3OC9 A;  5FUH A;  3SXD A;  1XZ6 A;  4D48 A;  2ICY A;  4NAI A;  4G87 A;  2XWN A;  5CMF X;  3R2W A;  4NAN A;  3SX5 A;  4AC3 A;  4KRV A;  5CMJ A;  2J0B A;  3V0P A;  4EEM A;  1HM8 A;  4G3Q A;  1ZJ3 A;  4EE3 A;  3I0I X;  4FRP A;  5EJZ A;  4B3U A;  4DDZ A;  5EIY A;  1V82 A;  1O7Q A;  1ZI4 A;  4O6M A;  2WVL A;  4KNR A;  3FOQ A;  2RIZ A;  4M28 A;  1O23 B;  3I0G A;  3KIA A;  3SXB A;  3ZLK A;  4EE4 A;  2UX8 A;  2XME A;  5CQM X;  3OGZ A;  2WE9 A;  2D7R A;  2RIX A;  3HL3 A;  4FRA A;  3ZGF A;  3OKR A;  1R7Y A;  1FXJ A;  2E3D A;  1G0R A;  1WT2 A;  3OH0 A;  3JUK A;  4IRP A;  2D0J A;  1ZHJ A;  3TQD A;  2XWM A;  3BRK X;  3IOJ A;  1ZDG A;  1VGT A;  4D0Z A;  1ZCU A;  2AE7 A;  2C0N A;  4ASJ A;  4BQH A;  2OI6 A;  3Q80 A;  2MZB A;  4IRQ A;  1G3L A;  1E5K A;  3IOI A;  2A8U A;  1QGQ A;  1FWY A;  3FWW A;  1INJ A;  3I0F A;  3QVB A;  4BMA A;  1ZJO A;  2ICX A;  4KC4 A;  1FO9 A;  2FYB A;  1HV9 A;  3CKV A;  2Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...