3USRA

Structure of y194f glycogenin mutant truncated at residue 270
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
259
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIFSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Mechanisms of monomeric and dimeric glycogenin autoglucosylation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 86
structure length 259
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3usrA00
1MP4A 1I52A 3DUVA 3QVBA 1FR9A 4HO6A 2JCOA 3PKQA 2YC3A 2D7IA 3FOQA 2FFUA 2BO7A 3CGXA 5IFYA 2RJ0A 4FROA 2RJ4A 3N9WA 2WEEA 3OGZA 3SXEA 1ZCUA 1H7TA 2BO8A 4L41C 2VFZA 2W0VA 4Y6NA 3Q7UA 4D11A 1ZI3A 2PGVA 3F1YA 3OKRA 5CMHA 4Y7GA 4KQLA 1O7OA 4J18A 4Y7VA 2AH9A 4JD0A 1ZDFA 1S4OA 3U2XA 3CU0A 1H5TA 3K8DA 4ECMA 2YQHA 3JUJA 1FO8A 3D8VA 4EE5A 2X5SA 1FWYA 3OH1A 1FOAA 2YQCA 4KC4A 1VGZA 1OQMB 1YROB 2I5KA 4B42A 3OC9A 1GWWA 1VICA 3CKVA 1VGUA 3SX5A 1QGQA 1WT3A 2FYAA 3IOIA 4FRAA 2Y4LA 4KNRA 4KXOA 1ON8A 4G87A 3ZLKA 4CJ8A 1H5RB 2AM4A 4D0TA 4P00A 3SXDA 2D7RA 2XWMA 1YP3A 2O1FA 2WE9A 1H4EA 2YQSA 1S4PA 3HL3A 1FXJA 3DJ4A 3GUEA 4IRQA 4UEGA 2P72A 4M28A 3JTJA 3V91A 1WVCA 4XWIA 2FYCB 1ZJOA 3RMVA 1ZCYA 2WVKA 2RJ5A 1V84A 2I5EA 4HOCA 4ZDQA 5BXCA 2Q4JA 1MC3A 1H7EA 4JISA 2I7BA 2ICYA 4C2SA 2WGZA 1MP5A 2O1GA 1NMMB 2FFVA 2RJ6A 4B5BA 5FV9A 4ARWA 5CMIA 1H5SC 4KC2A 3U2WA 5AJPA 1LL2A 3T7MA 5C1HA 5C1LA 2FYBA 3Q4SA 1JVGA 1H7FA 2YC5A 3D98A 1H5SB 3PNNA 4Y64A 1G2VA 5CMFX 1G97A 2GGOA 4E1KA 1E5KA 1VPAA 1YP4A 4M2AA 2RITA 4NAIA 1PZYB 4B4MA 1GWVA 5C4BA 4FCEA 3RSBA 2RJ7A 4FRPA 5C4EA 1S4NA 5CQLX 3V8ZA 1WT0A 1GQ9A 2JCKA 1LVWA 1H5RA 4KNXA 4LW3A 2BO6A 1R80A 1O7QA 1EZIA 2AM5A 1H4DA 5C49A 3I0DA 3ZF8A 3BCVA 2OEFA 1MP3A 4EE4A 3I0CA 1TVYA 4KPZA 1FR8A 1INJA 2YCMA 2RJ9A 3U2TA 1WT2A 5C1GA 1ZIZA 2XWNA 4B4GA 4G3QA 4B2WA 3I0KA 4MNDA 1ZCVA 2NXVA 1INIA 1K4VA 4KRVA 1LZJA 3LW6A 2VS5A 3TZTA 5L6VA 3V90A 4NALA 1IINA 1VZUA 2PA4A 4CJCA 2X5ZA 2VXMA 1ZI1A 1V83A 4AAWA 2E8BA 1JVDA 2QH5A 3CKQA 4M4KA 4D48A 1GA8A 2YQJA 5FYEA 3SX8A 3T7OA 3ZGGA 4B3UA 1HM9A 5C47A 5AJOA 2RIYA 1GQCA 4FRHA 3U2UA 4Y7FA 1JYKA 5IDTA 5AJNA 1HM0A 1VGTA 5FTSA 2OI7A 4FREA 1O0RA 1OMZA 3SXCA 5C3BA 5EJ1A 5FUHA 4EEOA 1O23B 4HO3A 1YP2A 4AC3A 2A8UA 1G8OA 1JV3A 1NKHB 3ST8A 2P73A 4B4BA 1NWGB 1SS9A 1WSZA 2BO4A 2Z86A 2WVMA 3I0EA 3TQDA 2V0IA 1FRWA 1R7UA 2OI5A 3OH0A 2VS4A 1EYRA 1G0RA 1ZJ3A 3I0IX 4CVHA 4HO0A 2ZU7A 4D11C 2V0JA 2V0LA 1R7YA 5C8RA 4G3PA 1IIMA 5C36A 2VSHA 2MZBA 4IRPA 4EEGA 1PZTA 1OMXA 5CQNX 1ZJ2A 2APCA 5C38A 2E3DA 4R7PA 2Y4KA 1FXOA 3U0YA 1FG5N 1VM8A 1GX0A 3SXBA 2UX8A 5CQPA 3PKPA 5CQOA 3ZLLA 1VH1A 2Y6PA 1H3MA 1W77A 1ZJ0A 2VS3A 1LL3A 2XMHA 2Y4MA 1XZ6A 5FU8A 4FRBA 2RJ1A 1ZCTA 3U0XA 5FTVA 2Z87A 3V0PA 2X60A 1G95A 2AGDA 4G3SA 2OEGA 1TW5A 3POLA 3Q80A 1NHEB 1GX4A 1V82A 4D0ZA 2AESA 5DDTA 3V0MA 2ZU9A 4EEMA 4HO9A 5I1FA 2VD4A 1W57A 1H4CA 2JCJA 2JCLA 1H7QA 1VZXA 2AECA 1LZ7A 1R7TA 3I0FA 2WVLA 3ZGFA 3SX7A 4Y7UA 1NF5B 4FRQA 2V0HA 4B2XA 5CMGX 4ASYA 1H7GA 3IOHA 5C4DA 1HJLA 4YS8A 4HG6A 1G93A 4AYLA 1TZFA 1R7VA 3DK5A 5CMJA 1W55A 3BRKX 2CU2A 1ZJPA 4EVWA 1QG8A 4FRDA 1LL0A 2DPWA 3R2WA 1HJJA 3D5NA 3I0LA 4NAKA 1H5SD 3SXAA 4DE7A 1G23A 1QWJA 4HO8A 4FQWA 3SX3A 1R81A 2PX7A 1H5SA 3RMWA 5EIYA 2FYDB 4EEAA 1VGWA 4K6RA 1FGXA 4EE3A 1VH3A 3OH2A 1HV9A 4KT7A 5J49A 3USQA 4AYJA 3V0NA 3F1CA 3FWWA 1FZWA 3IOJA 3V0OA 4DDZA 1QGSA 5C4CA 5JQQA 4HO2A 1HM8A 4DECA 2YESA 5L6SA 3E25A 2WAWA 2Y7AA 3OAMA 2FY7A 2XWLA 5C3DA 3I0JA 4BMAA 5C48A 5CQMX 2P6WA 3EE5A 2QKXA 1KWSA 2PGYA 5C4FA 2RIXA 2ZU8A 4HCQA 2X65A 2A8WA 2AE7A 4FRLA 1LZIA 3CKJA 3K8EA 4ASJA 2QGIA 3JUKA 2O1HA 3T7NA 1H7LA 3USRA 5C3AA 2W0WA 4FRMA 4GBPA 1R82A 1ZDGA 2XMEA 1G1LA 4MYBA 5HS2A 2V0KA 1G9RA 1ZHJA 1FO9A 3NGWA 3OH3A 1XHBA 4KPXA 3OH4A 3CKOA 1TW1A 4Y6UA 1H5TB 5FU0A 3SPTA 3SXGA 4KC1A 5IDSA 5EJZA 5DDVA 2VSIA 3R3IA 1R7XA 3CKNA 4HO4A 2D0JA 1NQIB 4FCUA 3V0LA 1WT1A 4HO5A 4BQHA 2GGQA 4Y7TA 1ZJ1A 4P02A 3E26A 3V0QA 1VZTA 4NANA 4CJBA 2RIZA 1H7HA 3O3PA 4Y62A 1Z90A 3KIAA 3I0HA 2RJ8A 3V8YA 1FGGA 2ICXA 3I0GA 1JV1A 4LW6A 4Y9XA 2AM3A 4M2BA 1JYLA 1ON6A 2Y4JA 4Y63A 1ZI5A 3U2VA 1G3LA 1LZ0A 1ZI4A 2VXLA 2OI6A
chains in the Genus database with same CATH superfamily
1MP4A 1I52A 3DUVA 3QVBA 1FR9A 5D92A 4HO6A 2JCOA 3PKQA 2YC3A 2D7IA 3FOQA 2FFUA 2BO7A 3CGXA 5IFYA 2RJ0A 4FROA 2RJ4A 3N9WA 2WEEA 3OGZA 3SXEA 1ZCUA 1H7TA 2BO8A 4L41C 2VFZA 2W0VA 4O6MA 4Y6NA 3Q7UA 4D11A 1ZI3A 2PGVA 3F1YA 3OKRA 5CMHA 4Y7GA 4KQLA 1O7OA 4J18A 4Y7VA 2AH9A 4JD0A 1ZDFA 1S4OA 3U2XA 3CU0A 1H5TA 3K8DA 4ECMA 2YQHA 3JUJA 1FO8A 3D8VA 4EE5A 2X5SA 1FWYA 3OH1A 1FOAA 2YQCA 4KC4A 1VGZA 1OQMB 1YROB 2I5KA 4B42A 3OC9A 1GWWA 1VICA 3CKVA 1VGUA 3SX5A 1QGQA 1WT3A 2FYAA 3IOIA 4FRAA 2Y4LA 4KNRA 4MIXA 4KXOA 1ON8A 4G87A 3ZLKA 4CJ8A 1H5RB 2AM4A 4D0TA 4P00A 3SXDA 2D7RA 2XWMA 1YP3A 2O1FA 2WE9A 1H4EA 2YQSA 1S4PA 3HL3A 4FIXA 1FXJA 3DJ4A 3GUEA 4IRQA 4UEGA 2P72A 4M28A 3JTJA 3V91A 1WVCA 4XWIA 2FYCB 1ZJOA 3RMVA 1ZCYA 2WVKA 2RJ5A 1V84A 2I5EA 4HOCA 4ZDQA 5BXCA 2Q4JA 1MC3A 1H7EA 4JISA 2I7BA 2ICYA 4C2SA 2WGZA 1MP5A 2O1GA 1NMMB 2FFVA 2RJ6A 4B5BA 5FV9A 4ARWA 5CMIA 1H5SC 4KC2A 3U2WA 5AJPA 1LL2A 3T7MA 5C1HA 5C1LA 2FYBA 3Q4SA 1JVGA 1H7FA 2YC5A 3D98A 1H5SB 3PNNA 4Y64A 1G2VA 5CMFX 1G97A 2GGOA 4E1KA 1E5KA 1VPAA 1YP4A 4M2AA 2RITA 4NAIA 1PZYB 4B4MA 1GWVA 5C4BA 4FCEA 3RSBA 2RJ7A 4FRPA 5C4EA 1S4NA 4FIYA 5CQLX 1WT0A 3V8ZA 1GQ9A 2JCKA 1LVWA 1H5RA 4KNXA 4LW3A 2BO6A 2J0BA 1R80A 1O7QA 1EZIA 2AM5A 1H4DA 5C49A 3I0DA 4Q7CA 3BCVA 3ZF8A 2OEFA 1MP3A 4EE4A 3I0CA 1TVYA 4KPZA 1FR8A 1INJA 2YCMA 2RJ9A 3U2TA 1WT2A 5C1GA 1ZIZA 2XWNA 4B4GA 4G3QA 4B2WA 3I0KA 4MNDA 1ZCVA 2NXVA 1INIA 1K4VA 2VK9A 4KRVA 1LZJA 3LW6A 2VS5A 3TZTA 2J0AA 3V90A 4NALA 5L6VA 1IINA 1VZUA 2PA4A 4CJCA 2X5ZA 2VXMA 1ZI1A 1V83A 4AAWA 2E8BA 1JVDA 2QH5A 3CKQA 4M4KA 4D48A 1GA8A 2YQJA 5FYEA 3SX8A 3T7OA 3ZGGA 4B3UA 1HM9A 5C47A 5AJOA 2RIYA 1GQCA 4FRHA 3U2UA 4Y7FA 1JYKA 5IDTA 5AJNA 1HM0A 1VGTA 5FTSA 2OI7A 4FREA 1O0RA 1OMZA 3SXCA 5C3BA 5EJ1A 5FUHA 4EEOA 1O23B 4HO3A 1YP2A 4AC3A 2A8UA 1G8OA 1JV3A 1NKHB 3ST8A 2P73A 4B4BA 1NWGB 1SS9A 1WSZA 2BO4A 2Z86A 2WVMA 3I0EA 3TQDA 2V0IA 1FRWA 1R7UA 2OI5A 3OH0A 2VS4A 1EYRA 1G0RA 1ZJ3A 3I0IX 4CVHA 4HO0A 2ZU7A 4D11C 2V0JA 2V0LA 1R7YA 5C8RA 4G3PA 1IIMA 5C36A 2VSHA 2MZBA 4IRPA 4EEGA 1PZTA 1OMXA 5CQNX 1ZJ2A 2APCA 5C38A 2E3DA 4R7PA 2Y4KA 1FXOA 3U0YA 1FG5N 1VM8A 1GX0A 3SXBA 2UX8A 4O6NA 5CQPA 3PKPA 5CQOA 3ZLLA 1VH1A 2Y6PA 1H3MA 1W77A 1ZJ0A 2VS3A 1LL3A 2XMHA 2Y4MA 1XZ6A 5FU8A 4FRBA 2RJ1A 1ZCTA 3U0XA 5FTVA 2Z87A 3V0PA 2X60A 1G95A 2AGDA 4G3SA 2OEGA 1TW5A 3POLA 3Q80A 1NHEB 1GX4A 1V82A 4D0ZA 2AESA 5DDTA 3V0MA 2ZU9A 4EEMA 4HO9A 5I1FA 2VD4A 1W57A 1H4CA 2JCJA 2JCLA 1H7QA 1VZXA 2AECA 1LZ7A 1R7TA 3I0FA 2WVLA 3ZGFA 3SX7A 4Y7UA 1NF5B 4FRQA 2V0HA 4B2XA 5CMGX 4ASYA 1H7GA 3IOHA 5C4DA 1HJLA 4YS8A 4HG6A 1G93A 4AYLA 1TZFA 1R7VA 3DK5A 5CMJA 1W55A 3BRKX 2CU2A 1ZJPA 4EVWA 1QG8A 4FRDA 1LL0A 2DPWA 3R2WA 1HJJA 3D5NA 3I0LA 4NAKA 1H5SD 3SXAA 4DE7A 1G23A 1QWJA 4HO8A 4FQWA 3SX3A 1R81A 2PX7A 1H5SA 3RMWA 5EIYA 2FYDB 4EEAA 1VGWA 4K6RA 1FGXA 4EE3A 1VH3A 3OH2A 1HV9A 4KT7A 5J49A 3USQA 4AYJA 3V0NA 3F1CA 5D91A 3FWWA 1FZWA 3IOJA 3V0OA 4DDZA 1QGSA 5C4CA 5JQQA 4HO2A 1HM8A 4DECA 2YESA 5L6SA 3E25A 2WAWA 2Y7AA 3OAMA 2FY7A 2XWLA 5C3DA 3I0JA 4BMAA 5C48A 5CQMX 2P6WA 3EE5A 2QKXA 1KWSA 2PGYA 5C4FA 2RIXA 2ZU8A 4HCQA 2X65A 2A8WA 2AE7A 4FRLA 1LZIA 3CKJA 3K8EA 4ASJA 2QGIA 3JUKA 2O1HA 3T7NA 1H7LA 3USRA 5C3AA 2W0WA 4FRMA 4GBPA 1R82A 1ZDGA 2XMEA 1G1LA 4MYBA 2C0NA 5HS2A 2V0KA 1G9RA 1ZHJA 1FO9A 3NGWA 3OH3A 1XHBA 4KPXA 3OH4A 3CKOA 1TW1A 4Y6UA 1H5TB 5FU0A 3SPTA 3SXGA 4KC1A 5IDSA 5EJZA 5DDVA 2VSIA 3R3IA 1R7XA 3CKNA 4HO4A 2D0JA 1NQIB 4FCUA 3V0LA 1WT1A 4HO5A 4BQHA 2GGQA 4Y7TA 1ZJ1A 4P02A 3E26A 3V0QA 1VZTA 4NANA 4CJBA 2RIZA 1H7HA 3O3PA 4Y62A 1Z90A 3KIAA 3I0HA 2RJ8A 3V8YA 1FGGA 2ICXA 3I0GA 1JV1A 4LW6A 4Y9XA 2AM3A 4M2BA 1JYLA 1ON6A 2Y4JA 4Y63A 1ZI5A 3U2VA 1G3LA 1LZ0A 1ZI4A 2VXLA 2OI6A
chains in the Genus database with same CATH topology
1MP4A 1I52A 3DUVA 3QVBA 1FR9A 5D92A 4HO6A 2JCOA 3PKQA 2YC3A 2D7IA 3FOQA 2FFUA 2BO7A 3CGXA 5IFYA 2RJ0A 4FROA 2RJ4A 3N9WA 2WEEA 3OGZA 3SXEA 1ZCUA 1H7TA 2BO8A 4L41C 2VFZA 2W0VA 4O6MA 4Y6NA 3Q7UA 4D11A 1ZI3A 2PGVA 3F1YA 3OKRA 5CMHA 4Y7GA 4KQLA 1O7OA 4J18A 4Y7VA 2AH9A 4JD0A 1ZDFA 1S4OA 3U2XA 3CU0A 1H5TA 3K8DA 4ECMA 2YQHA 3JUJA 1FO8A 3D8VA 4EE5A 2X5SA 1FWYA 3OH1A 1FOAA 2YQCA 4KC4A 1VGZA 1OQMB 1YROB 2I5KA 4B42A 3OC9A 1GWWA 1VICA 3CKVA 1VGUA 3SX5A 1QGQA 1WT3A 2FYAA 3IOIA 4FRAA 2Y4LA 4KNRA 4MIXA 4KXOA 1ON8A 4G87A 3ZLKA 4CJ8A 1H5RB 2AM4A 4D0TA 4P00A 3SXDA 2D7RA 2XWMA 1YP3A 2O1FA 2WE9A 1H4EA 2YQSA 1S4PA 3HL3A 4FIXA 1FXJA 3DJ4A 3GUEA 4IRQA 4UEGA 2P72A 4M28A 3JTJA 3V91A 1WVCA 4XWIA 2FYCB 1ZJOA 3RMVA 1ZCYA 2WVKA 2RJ5A 1V84A 2I5EA 4HOCA 4ZDQA 5BXCA 2Q4JA 1MC3A 1H7EA 4JISA 2I7BA 2ICYA 4C2SA 2WGZA 1MP5A 2O1GA 1NMMB 2FFVA 2RJ6A 4B5BA 5FV9A 4ARWA 5CMIA 1H5SC 4KC2A 3U2WA 5AJPA 1LL2A 3T7MA 5C1HA 5C1LA 2FYBA 3Q4SA 1JVGA 1H7FA 2YC5A 3D98A 1H5SB 3PNNA 4Y64A 1G2VA 5CMFX 1G97A 2GGOA 4E1KA 1E5KA 1VPAA 1YP4A 4M2AA 2RITA 4NAIA 1PZYB 4B4MA 1GWVA 5C4BA 4FCEA 3RSBA 2RJ7A 4FRPA 5C4EA 1S4NA 4FIYA 5CQLX 1WT0A 3V8ZA 1GQ9A 2JCKA 1LVWA 1H5RA 4KNXA 4LW3A 2BO6A 2J0BA 1R80A 1O7QA 1EZIA 2AM5A 1H4DA 5C49A 3I0DA 4Q7CA 3BCVA 3ZF8A 2OEFA 1MP3A 4EE4A 3I0CA 1TVYA 4KPZA 1FR8A 1INJA 2YCMA 2RJ9A 3U2TA 1WT2A 5C1GA 1ZIZA 2XWNA 4B4GA 4G3QA 4B2WA 3I0KA 4MNDA 1ZCVA 2NXVA 1INIA 1K4VA 2VK9A 4KRVA 1LZJA 3LW6A 2VS5A 3TZTA 2J0AA 3V90A 4NALA 5L6VA 1IINA 1VZUA 2PA4A 4CJCA 2X5ZA 2VXMA 1ZI1A 1V83A 4AAWA 2E8BA 1JVDA 2QH5A 3CKQA 4M4KA 4D48A 1GA8A 2YQJA 5FYEA 3SX8A 3T7OA 3ZGGA 4B3UA 1HM9A 5C47A 5AJOA 2RIYA 1GQCA 4FRHA 3U2UA 4Y7FA 1JYKA 5IDTA 5AJNA 1HM0A 1VGTA 5FTSA 2OI7A 4FREA 1O0RA 1OMZA 3SXCA 5C3BA 5EJ1A 5FUHA 4EEOA 1O23B 4HO3A 1YP2A 4AC3A 2A8UA 1G8OA 1JV3A 1NKHB 3ST8A 2P73A 4B4BA 1NWGB 1SS9A 1WSZA 2BO4A 2Z86A 2WVMA 3I0EA 3TQDA 2V0IA 1FRWA 1R7UA 2OI5A 3OH0A 2VS4A 1EYRA 1G0RA 1ZJ3A 3I0IX 4CVHA 4HO0A 2ZU7A 4D11C 2V0JA 2V0LA 1R7YA 5C8RA 4G3PA 1IIMA 5C36A 2VSHA 2MZBA 4IRPA 4EEGA 1PZTA 1OMXA 5CQNX 1ZJ2A 2APCA 5C38A 2E3DA 4R7PA 2Y4KA 1FXOA 3U0YA 1FG5N 1VM8A 1GX0A 3SXBA 2UX8A 4O6NA 5CQPA 3PKPA 5CQOA 3ZLLA 1VH1A 2Y6PA 1H3MA 1W77A 1ZJ0A 2VS3A 1LL3A 2XMHA 2Y4MA 1XZ6A 5FU8A 4FRBA 2RJ1A 1ZCTA 3U0XA 5FTVA 2Z87A 3V0PA 2X60A 1G95A 2AGDA 4G3SA 2OEGA 1TW5A 3POLA 3Q80A 1NHEB 1GX4A 1V82A 4D0ZA 2AESA 5DDTA 3V0MA 2ZU9A 4EEMA 4HO9A 5I1FA 2VD4A 1W57A 1H4CA 2JCJA 2JCLA 1H7QA 1VZXA 2AECA 1LZ7A 1R7TA 3I0FA 2WVLA 3ZGFA 3SX7A 4Y7UA 1NF5B 4FRQA 2V0HA 4B2XA 5CMGX 4ASYA 1H7GA 3IOHA 5C4DA 1HJLA 4YS8A 4HG6A 1G93A 4AYLA 1TZFA 1R7VA 3DK5A 5CMJA 1W55A 3BRKX 2CU2A 1ZJPA 4EVWA 1QG8A 4FRDA 1LL0A 2DPWA 3R2WA 1HJJA 3D5NA 3I0LA 4NAKA 1H5SD 3SXAA 4DE7A 1G23A 1QWJA 4HO8A 4FQWA 3SX3A 1R81A 2PX7A 1H5SA 3RMWA 5EIYA 2FYDB 4EEAA 1VGWA 4K6RA 1FGXA 4EE3A 1VH3A 3OH2A 1HV9A 4KT7A 5J49A 3USQA 4AYJA 3V0NA 3F1CA 5D91A 3FWWA 1FZWA 3IOJA 3V0OA 4DDZA 1QGSA 5C4CA 5JQQA 4HO2A 1HM8A 4DECA 2YESA 5L6SA 3E25A 2WAWA 2Y7AA 3OAMA 2FY7A 2XWLA 5C3DA 3I0JA 4BMAA 5C48A 5CQMX 2P6WA 3EE5A 2QKXA 1KWSA 2PGYA 5C4FA 2RIXA 2ZU8A 4HCQA 2X65A 2A8WA 2AE7A 4FRLA 1LZIA 3CKJA 3K8EA 4ASJA 2QGIA 3JUKA 2O1HA 3T7NA 1H7LA 3USRA 5C3AA 2W0WA 4FRMA 4GBPA 1R82A 1ZDGA 2XMEA 1G1LA 4MYBA 2C0NA 5HS2A 2V0KA 1G9RA 1ZHJA 1FO9A 3NGWA 3OH3A 1XHBA 4KPXA 3OH4A 3CKOA 1TW1A 4Y6UA 1H5TB 5FU0A 3SPTA 3SXGA 4KC1A 5IDSA 5EJZA 5DDVA 2VSIA 3R3IA 1R7XA 3CKNA 4HO4A 2D0JA 1NQIB 4FCUA 3V0LA 1WT1A 4HO5A 4BQHA 2GGQA 4Y7TA 1ZJ1A 4P02A 3E26A 3V0QA 1VZTA 4NANA 4CJBA 2RIZA 1H7HA 3O3PA 4Y62A 1Z90A 3KIAA 3I0HA 2RJ8A 3V8YA 1FGGA 2ICXA 3I0GA 1JV1A 4LW6A 4Y9XA 2AM3A 4M2BA 1JYLA 1ON6A 2Y4JA 4Y63A 1ZI5A 3U2VA 1G3LA 1LZ0A 1ZI4A 2VXLA 2OI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MP4 A;  1I52 A;  3DUV A;  3QVB A;  1FR9 A;  4HO6 A;  2JCO A;  3PKQ A;  2YC3 A;  2D7I A;  3FOQ A;  2FFU A;  2BO7 A;  3CGX A;  5IFY A;  2RJ0 A;  4FRO A;  2RJ4 A;  3N9W A;  2WEE A;  3OGZ A;  3SXE A;  1ZCU A;  1H7T A;  2BO8 A;  4L41 C;  2VFZ A;  2W0V A;  4Y6N A;  3Q7U A;  4D11 A;  1ZI3 A;  2PGV A;  3F1Y A;  3OKR A;  5CMH A;  4Y7G A;  4KQL A;  1O7O A;  4J18 A;  4Y7V A;  2AH9 A;  4JD0 A;  1ZDF A;  1S4O A;  3U2X A;  3CU0 A;  1H5T A;  3K8D A;  4ECM A;  2YQH A;  3JUJ A;  1FO8 A;  3D8V A;  4EE5 A;  2X5S A;  1FWY A;  3OH1 A;  1FOA A;  2YQC A;  4KC4 A;  1VGZ A;  1OQM B;  1YRO B;  2I5K A;  4B42 A;  3OC9 A;  1GWW A;  1VIC A;  3CKV A;  1VGU A;  3SX5 A;  1QGQ A;  1WT3 A;  2FYA A;  3IOI A;  4FRA A;  2Y4L A;  4KNR A;  4KXO A;  1ON8 A;  4G87 A;  3ZLK A;  4CJ8 A;  1H5R B;  2AM4 A;  4D0T A;  4P00 A;  3SXD A;  2D7R A;  2XWM A;  1YP3 A;  2O1F A;  2WE9 A;  1H4E A;  2YQS A;  1S4P A;  3HL3 A;  1FXJ A;  3DJ4 A;  3GUE A;  4IRQ A;  4UEG A;  2P72 A;  4M28 A;  3JTJ A;  3V91 A;  1WVC A;  4XWI A;  2FYC B;  1ZJO A;  3RMV A;  1ZCY A;  2WVK A;  2RJ5 A;  1V84 A;  2I5E A;  4HOC A;  4ZDQ A;  5BXC A;  2Q4J A;  1MC3 A;  1H7E A;  4JIS A;  2I7B A;  2ICY A;  4C2S A;  2WGZ A;  1MP5 A;  2O1G A;  1NMM B;  2FFV A;  2RJ6 A;  4B5B A;  5FV9 A;  4ARW A;  5CMI A;  1H5S C;  4KC2 A;  3U2W A;  5AJP A;  1LL2 A;  3T7M A;  5C1H A;  5C1L A;  2FYB A;  3Q4S A;  1JVG A;  1H7F A;  2YC5 A;  3D98 A;  1H5S B;  3PNN A;  4Y64 A;  1G2V A;  5CMF X;  1G97 A;  2GGO A;  4E1K A;  1E5K A;  1VPA A;  1YP4 A;  4M2A A;  2RIT A;  4NAI A;  1PZY B;  4B4M A;  1GWV A;  5C4B A;  4FCE A;  3RSB A;  2RJ7 A;  4FRP A;  5C4E A;  1S4N A;  5CQL X;  3V8Z A;  1WT0 A;  1GQ9 A;  2JCK A;  1LVW A;  1H5R A;  4KNX A;  4LW3 A;  2BO6 A;  1R80 A;  1O7Q A;  1EZI A;  2AM5 A;  1H4D A;  5C49 A;  3I0D A;  3ZF8 A;  3BCV A;  2OEF A;  1MP3 A;  4EE4 A;  3I0C A;  1TVY A;  4KPZ A;  1FR8 A;  1INJ A;  2YCM A;  2RJ9 A;  3U2T A;  1WT2 A;  5C1G A;  1ZIZ A;  2XWN A;  4B4G A;  4G3Q A;  4B2W A;  3I0K A;  4MND A;  1ZCV A;  2NXV A;  1INI A;  1K4V A;  4KRV A;  1LZJ A;  3LW6 A;  2VS5 A;  3TZT A;  5L6V A;  3V90 A;  4NAL A;  1IIN A;  1VZU A;  2PA4 A;  4CJC A;  2X5Z A;  2VXM A;  1ZI1 A;  1V83 A;  4AAW A;  2E8B A;  1JVD A;  2QH5 A;  3CKQ A;  4M4K A;  4D48 A;  1GA8 A;  2YQJ A;  5FYE A;  3SX8 A;  3T7O A;  3ZGG A;  4B3U A;  1HM9 A;  5C47 A;  5AJO A;  2RIY A;  1GQC A;  4FRH A;  3U2U A;  4Y7F A;  1JYK A;  5IDT A;  5AJN A;  1HM0 A;  1VGT A;  5FTS A;  2OI7 A;  4FRE A;  1O0R A;  1OMZ A;  3SXC A;  5C3B A;  5EJ1 A;  5FUH A;  4EEO A;  1O23 B;  4HO3 A;  1YP2 A;  4AC3 A;  2A8U A;  1G8O A;  1JV3 A;  1NKH B;  3ST8 A;  2P73 A;  4B4B A;  1NWG B;  1SS9 A;  1WSZ A;  2BO4 A;  2Z86 A;  2WVM A;  3I0E A;  3TQD A;  2V0I A;  1FRW A;  1R7U A;  2OI5 A;  3OH0 A;  2VS4 A;  1EYR A;  1G0R A;  1ZJ3 A;  3I0I X;  4CVH A;  4HO0 A;  2ZU7 A;  4D11 C;  2V0J A;  2V0L A;  1R7Y A;  5C8R A;  4G3P A;  1IIM A;  5C36 A;  2VSH A;  2MZB A;  4IRP A;  4EEG A;  1PZT A;  1OMX A;  5CQN X;  1ZJ2 A;  2APC A;  5C38 A;  2E3D A;  4R7P A;  2Y4K A;  1FXO A;  3U0Y A;  1FG5 N;  1VM8 A;  1GX0 A;  3SXB A;  2UX8 A;  5CQP A;  3PKP A;  5CQO A;  3ZLL A;  1VH1 A;  2Y6P A;  1H3M A;  1W77 A;  1ZJ0 A;  2VS3 A;  1LL3 A;  2XMH A;  2Y4M A;  1XZ6 A;  5FU8 A;  4FRB A;  2RJ1 A;  1ZCT A;  3U0X A;  5FTV A;  2Z87 A;  3V0P A;  2X60 A;  1G95 A;  2AGD A;  4G3S A;  2OEG A;  1TW5 A;  3POL A;  3Q80 A;  1NHE B;  1GX4 A;  1V82 A;  4D0Z A;  2AES A;  5DDT A;  3V0M A;  2ZU9 A;  4EEM A;  4HO9 A;  5I1F A;  2VD4 A;  1W57 A;  1H4C A;  2JCJ A;  2JCL A;  1H7Q A;  1VZX A;  2AEC A;  1LZ7 A;  1R7T A;  3I0F A;  2WVL A;  3ZGF A;  3SX7 A;  4Y7U A;  1NF5 B;  4FRQ A;  2V0H A;  4B2X A;  5CMG X;  4ASY A;  1H7G A;  3IOH A;  5C4D A;  1HJL A;  4YS8 A;  4HG6 A;  1G93 A;  4AYL A;  1TZF A;  1R7V A;  3DK5 A;  5CMJ A;  1W55 A;  3BRK X;  2CU2 A;  1ZJP A;  4EVW A;  1QG8 A;  4FRD A;  1LL0 A;  2DPW A;  3R2W A;  1HJJ A;  3D5N A;  3I0L A;  4NAK A;  1H5S D;  3SXA A;  4DE7 A;  1G23 A;  1QWJ A;  4HO8 A;  4FQW A;  3SX3 A;  1R81 A;  2PX7 A;  1H5S A;  3RMW A;  5EIY A;  2FYD B;  4EEA A;  1VGW A;  4K6R A;  1FGX A;  4EE3 A;  1VH3 A;  3OH2 A;  1HV9 A;  4KT7 A;  5J49 A;  3USQ A;  4AYJ A;  3V0N A;  3F1C A;  3FWW A;  1FZW A;  3IOJ A;  3V0O A;  4DDZ A;  1QGS A;  5C4C A;  5JQQ A;  4HO2 A;  1HM8 A;  4DEC A;  2YES A;  5L6S A;  3E25 A;  2WAW A;  2Y7A A;  3OAM A;  2FY7 A;  2XWL A;  5C3D A;  3I0J A;  4BMA A;  5C48 A;  5CQM X;  2P6W A;  3EE5 A;  2QKX A;  1KWS A;  2PGY A;  5C4F A;  2RIX A;  2ZU8 A;  4HCQ A;  2X65 A;  2A8W A;  2AE7 A;  4FRL A;  1LZI A;  3CKJ A;  3K8E A;  4ASJ A;  2QGI A;  3JUK A;  2O1H A;  3T7N A;  1H7L A;  3USR A;  5C3A A;  2W0W A;  4FRM A;  4GBP A;  1R82 A;  1ZDG A;  2XME A;  1G1L A;  4MYB A;  5HS2 A;  2V0K A;  1G9R A;  1ZHJ A;  1FO9 A;  3NGW A;  3OH3 A;  1XHB A;  4KPX A;  3OH4 A;  3CKO A;  1TW1 A;  4Y6U A;  1H5T B;  5FU0 A;  3SPT A;  3SXG A;  4KC1 A;  5IDS A;  5EJZ A;  5DDV A;  2VSI A;  3R3I A;  1R7X A;  3CKN A;  4HO4 A;  2D0J A;  1NQI B;  4FCU A;  3V0L A;  1WT1 A;  4HO5 A;  4BQH A;  2GGQ A;  4Y7T A;  1ZJ1 A;  4P02 A;  3E26 A;  3V0Q A;  1VZT A;  4NAN A;  4CJB A;  2RIZ A;  1H7H A;  3O3P A;  4Y62 A;  1Z90 A;  3KIA A;  3I0H A;  2RJ8 A;  3V8Y A;  1FGG A;  2ICX A;  3I0G A;  1JV1 A;  4LW6 A;  4Y9X A;  2AM3 A;  4M2B A;  1JYL A;  1ON6 A;  2Y4J A;  4Y63 A;  1ZI5 A;  3U2V A;  1G3L A;  1LZ0 A;  1ZI4 A;  2VXL A;  2OI6 A; 
#chains in the Genus database with same CATH topology
 1MP4 A;  1I52 A;  3DUV A;  3QVB A;  1FR9 A;  5D92 A;  4HO6 A;  2JCO A;  3PKQ A;  2YC3 A;  2D7I A;  3FOQ A;  2FFU A;  2BO7 A;  3CGX A;  5IFY A;  2RJ0 A;  4FRO A;  2RJ4 A;  3N9W A;  2WEE A;  3OGZ A;  3SXE A;  1ZCU A;  1H7T A;  2BO8 A;  4L41 C;  2VFZ A;  2W0V A;  4O6M A;  4Y6N A;  3Q7U A;  4D11 A;  1ZI3 A;  2PGV A;  3F1Y A;  3OKR A;  5CMH A;  4Y7G A;  4KQL A;  1O7O A;  4J18 A;  4Y7V A;  2AH9 A;  4JD0 A;  1ZDF A;  1S4O A;  3U2X A;  3CU0 A;  1H5T A;  3K8D A;  4ECM A;  2YQH A;  3JUJ A;  1FO8 A;  3D8V A;  4EE5 A;  2X5S A;  1FWY A;  3OH1 A;  1FOA A;  2YQC A;  4KC4 A;  1VGZ A;  1OQM B;  1YRO B;  2I5K A;  4B42 A;  3OC9 A;  1GWW A;  1VIC A;  3CKV A;  1VGU A;  3SX5 A;  1QGQ A;  1WT3 A;  2FYA A;  3IOI A;  4FRA A;  2Y4L A;  4KNR A;  4MIX A;  4KXO A;  1ON8 A;  4G87 A;  3ZLK A;  4CJ8 A;  1H5R B;  2AM4 A;  4D0T A;  4P00 A;  3SXD A;  2D7R A;  2XWM A;  1YP3 A;  2O1F A;  2WE9 A;  1H4E A;  2YQS A;  1S4P A;  3HL3 A;  4FIX A;  1FXJ A;  3DJ4 A;  3GUE A;  4IRQ A;  4UEG A;  2P72 A;  4M28 A;  3JTJ A;  3V91 A;  1WVC A;  4XWI A;  2FYC B;  1ZJO A;  3RMV A;  1ZCY A;  2WVK A;  2RJ5 A;  1V84 A;  2I5E A;  4HOC A;  4ZDQ A;  5BXC A;  2Q4J A;  1MC3 A;  1H7E A;  4JIS A;  2I7B A;  2ICY A;  4C2S A;  2WGZ A;  1MP5 A;  2O1G A;  1NMM B;  2FFV A;  2RJ6 A;  4B5B A;  5FV9 A;  4ARW A;  5CMI A;  1H5S C;  4KC2 A;  3U2W A;  5AJP A;  1LL2 A;  3T7M A;  5C1H A;  5C1L A;  2FYB A;  3Q4S A;  1JVG A;  1H7F A;  2YC5 A;  3D98 A;  1H5S B;  3PNN A;  4Y64 A;  1G2V A;  5CMF X;  1G97 A;  2GGO A;  4E1K A;  1E5K A;  1VPA A;  1YP4 A;  4M2A A;  2RIT A;  4NAI A;  1PZY B;  4B4M A;  1GWV A;  5C4B A;  4FCE A;  3RSB A;  2RJ7 A;  4FRP A;  5C4E A;  1S4N A;  4FIY A;  5CQL X;  1WT0 A;  3V8Z A;  1GQ9 A;  2JCK A;  1LVW A;  1H5R A;  4KNX A;  4LW3 A;  2BO6 A;  2J0B A;  1R80 A;  1O7Q A;  1EZI A;  2AM5 A;  1H4D A;  5C49 A;  3I0D A;  4Q7C A;  3BCV A;  3ZF8 A;  2OEF A;  1MP3 A;  4EE4 A;  3I0C A;  1TVY A;  4KPZ A;  1FR8 A;  1INJ A;  2YCM A;  2RJ9 A;  3U2T A;  1WT2 A;  5C1G A;  1ZIZ A;  2XWN A;  4B4G A;  4G3Q A;  4B2W A;  3I0K A;  4MND A;  1ZCV A;  2NXV A;  1INI A;  1K4V A;  2VK9 A;  4KRV A;  1LZJ A;  3LW6 A;  2VS5 A;  3TZT A;  2J0A A;  3V90 A;  4NAL A;  5L6V A;  1IIN A;  1VZU A;  2PA4 A;  4CJC A;  2X5Z A;  2VXM A;  1ZI1 A;  1V83 A;  4AAW A;  2E8B A;  1JVD A;  2QH5 A;  3CKQ A;  4M4K A;  4D48 A;  1GA8 A;  2YQJ A;  5FYE A;  3SX8 A;  3T7O A;  3ZGG A;  4B3U A;  1HM9 A;  5C47 A;  5AJO A;  2RIY A;  1GQC A;  4FRH A;  3U2U A;  4Y7F A;  1JYK A;  5IDT A;  5AJN A;  1HM0 A;  1VGT A;  5FTS A;  2OI7 A;  4FRE A;  1O0R A;  1OMZ A;  3SXC A;  5C3B A;  5EJ1 A;  5FUH A;  4EEO A;  1O23 B;  4HO3 A;  1YP2 A;  4AC3 A;  2A8U A;  1G8O A;  1JV3 A;  1NKH B;  3ST8 A;  2P73 A;  4B4B A;  1NWG B;  1SS9 A;  1WSZ A;  2BO4 A;  2Z86 A;  2WVM A;  3I0E A;  3TQD A;  2V0I A;  1FRW A;  1R7U A;  2OI5 A;  3OH0 A;  2VS4 A;  1EYR A;  1G0R A;  1ZJ3 A;  3I0I X;  4CVH A;  4HO0 A;  2ZU7 A;  4D11 C;  2V0J A;  2V0L A;  1R7Y A;  5C8R A;  4G3P A;  1IIM A;  5C36 A;  2VSH A;  2MZB A;  4IRP A;  4EEG A;  1PZT A;  1OMX A;  5CQN X;  1ZJ2 A;  2APC A;  5C38 A;  2E3D A;  4R7P A;  2Y4K A;  1FXO A;  3U0Y A;  1FG5 N;  1VM8 A;  1GX0 A;  3SXB A;  2UX8 A;  4O6N A;  5CQP A;  3PKP A;  5CQO A;  3ZLL A;  1VH1 A;  2Y6P A;  1H3M A;  1W77 A;  1ZJ0 A;  2VS3 A;  1LL3 A;  2XMH A;  2Y4M A;  1XZ6 A;  5FU8 A;  4FRB A;  2RJ1 A;  1ZCT A;  3U0X A;  5FTV A;  2Z87 A;  3V0P A;  2X60 A;  1G95 A;  2AGD A;  4G3S A;  2OEG A;  1TW5 A;  3POL A;  3Q80 A;  1NHE B;  1GX4 A;  1V82 A;  4D0Z A;  2AES A;  5DDT A;  3V0M A;  2ZU9 A;  4EEM A;  4HO9 A;  5I1F A;  2VD4 A;  1W57 A;  1H4C A;  2JCJ A;  2JCL A;  1H7Q A;  1VZX A;  2AEC A;  1LZ7 A;  1R7T A;  3I0F A;  2WVL A;  3ZGF A;  3SX7 A;  4Y7U A;  1NF5 B;  4FRQ A;  2V0H A;  4B2X A;  5CMG X;  4ASY A;  1H7G A;  3IOH A;  5C4D A;  1HJL A;  4YS8 A;  4HG6 A;  1G93 A;  4AYL A;  1TZF A;  1R7V A;  3DK5 A;  5CMJ A;  1W55 A;  3BRK X;  2CU2 A;  1ZJP A;  4EVW A;  1QG8 A;  4FRD A;  1LL0 A;  2DPW A;  3R2W A;  1HJJ A;  3D5N A;  3I0L A;  4NAK A;  1H5S D;  3SXA A;  4DE7 A;  1G23 A;  1QWJ A;  4HO8 A;  4FQW A;  3SX3 A;  1R81 A;  2PX7 A;  1H5S A;  3RMW A;  5EIY A;  2FYD B;  4EEA A;  1VGW A;  4K6R A;  1FGX A;  4EE3 A;  1VH3 A;  3OH2 A;  1HV9 A;  4KT7 A;  5J49 A;  3USQ A;  4AYJ A;  3V0N A;  3F1C A;  5D91 A;  3FWW A;  1FZW A;  3IOJ A;  3V0O A;  4DDZ A;  1QGS A;  5C4C A;  5JQQ A;  4HO2 A;  1HM8 A;  4DEC A;  2YES A;  5L6S A;  3E25 A;  2WAW A;  2Y7A A;  3OAM A;  2FY7 A;  2XWL A;  5C3D A;  3I0J A;  4BMA A;  5C48 A;  5CQM X;  2P6W A;  3EE5 A;  2QKX A;  1KWS A;  2PGY A;  5C4F A;  2RIX A;  2ZU8 A;  4HCQ A;  2X65 A;  2A8W A;  2AE7 A;  4FRL A;  1LZI A;  3CKJ A;  3K8E A;  4ASJ A;  2QGI A;  3JUK A;  2O1H A;  3T7N A;  1H7L A;  3USR A;  5C3A A;  2W0W A;  4FRM A;  4GBP A;  1R82 A;  1ZDG A;  2XME A;  1G1L A;  4MYB A;  2C0N A;  5HS2 A;  2V0K A;  1G9R A;  1ZHJ A;  1FO9 A;  3NGW A;  3OH3 A;  1XHB A;  4KPX A;  3OH4 A;  3CKO A;  1TW1 A;  4Y6U A;  1H5T B;  5FU0 A;  3SPT A;  3SXG A;  4KC1 A;  5IDS A;  5EJZ A;  5DDV A;  2VSI A;  3R3I A;  1R7X A;  3CKN A;  4HO4 A;  2D0J A;  1NQI B;  4FCU A;  3V0L A;  1WT1 A;  4HO5 A;  4BQH A;  2GGQ A;  4Y7T A;  1ZJ1 A;  4P02 A;  3E26 A;  3V0Q A;  1VZT A;  4NAN A;  4CJB A;  2RIZ A;  1H7H A;  3O3P A;  4Y62 A;  1Z90 A;  3KIA A;  3I0H A;  2RJ8 A;  3V8Y A;  1FGG A;  2ICX A;  3I0G A;  1JV1 A;  4LW6 A;  4Y9X A;  2AM3 A;  4M2B A;  1JYL A;  1ON6 A;  2Y4J A;  4Y63 A;  1ZI5 A;  3U2V A;  1G3L A;  1LZ0 A;  1ZI4 A;  2VXL A;  2OI6 A; 
#chains in the Genus database with same CATH homology
 1MP4 A;  1I52 A;  3DUV A;  3QVB A;  1FR9 A;  5D92 A;  4HO6 A;  2JCO A;  3PKQ A;  2YC3 A;  2D7I A;  3FOQ A;  2FFU A;  2BO7 A;  3CGX A;  5IFY A;  2RJ0 A;  4FRO A;  2RJ4 A;  3N9W A;  2WEE A;  3OGZ A;  3SXE A;  1ZCU A;  1H7T A;  2BO8 A;  4L41 C;  2VFZ A;  2W0V A;  4O6M A;  4Y6N A;  3Q7U A;  4D11 A;  1ZI3 A;  2PGV A;  3F1Y A;  3OKR A;  5CMH A;  4Y7G A;  4KQL A;  1O7O A;  4J18 A;  4Y7V A;  2AH9 A;  4JD0 A;  1ZDF A;  1S4O A;  3U2X A;  3CU0 A;  1H5T A;  3K8D A;  4ECM A;  2YQH A;  3JUJ A;  1FO8 A;  3D8V A;  4EE5 A;  2X5S A;  1FWY A;  3OH1 A;  1FOA A;  2YQC A;  4KC4 A;  1VGZ A;  1OQM B;  1YRO B;  2I5K A;  4B42 A;  3OC9 A;  1GWW A;  1VIC A;  3CKV A;  1VGU A;  3SX5 A;  1QGQ A;  1WT3 A;  2FYA A;  3IOI A;  4FRA A;  2Y4L A;  4KNR A;  4MIX A;  4KXO A;  1ON8 A;  4G87 A;  3ZLK A;  4CJ8 A;  1H5R B;  2AM4 A;  4D0T A;  4P00 A;  3SXD A;  2D7R A;  2XWM A;  1YP3 A;  2O1F A;  2WE9 A;  1H4E A;  2YQS A;  1S4P A;  3HL3 A;  4FIX A;  1FXJ A;  3DJ4 A;  3GUE A;  4IRQ A;  4UEG A;  2P72 A;  4M28 A;  3JTJ A;  3V91 A;  1WVC A;  4XWI A;  2FYC B;  1ZJO A;  3RMV A;  1ZCY A;  2WVK A;  2RJ5 A;  1V84 A;  2I5E A;  4HOC A;  4ZDQ A;  5BXC A;  2Q4J A;  1MC3 A;  1H7E A;  4JIS A;  2I7B A;  2ICY A;  4C2S A;  2WGZ A;  1MP5 A;  2O1G A;  1NMM B;  2FFV A;  2RJ6 A;  4B5B A;  5FV9 A;  4ARW A;  5CMI A;  1H5S C;  4KC2 A;  3U2W A;  5AJP A;  1LL2 A;  3T7M A;  5C1H A;  5C1L A;  2FYB A;  3Q4S A;  1JVG A;  1H7F A;  2YC5 A;  3D98 A;  1H5S B;  3PNN A;  4Y64 A;  1G2V A;  5CMF X;  1G97 A;  2GGO A;  4E1K A;  1E5K A;  1VPA A;  1YP4 A;  4M2A A;  2RIT A;  4NAI A;  1PZY B;  4B4M A;  1GWV A;  5C4B A;  4FCE A;  3RSB A;  2RJ7 A;  4FRP A;  5C4E A;  1S4N A;  4FIY A;  5CQL X;  1WT0 A;  3V8Z A;  1GQ9 A;  2JCK A;  1LVW A;  1H5R A;  4KNX A;  4LW3 A;  2BO6 A;  2J0B A;  1R80 A;  1O7Q A;  1EZI A;  2AM5 A;  1H4D A;  5C49 A;  3I0D A;  4Q7C A;  3BCV A;  3ZF8 A;  2OEF A;  1MP3 A;  4EE4 A;  3I0C A;  1TVY A;  4KPZ A;  1FR8 A;  1INJ A;  2YCM A;  2RJ9 A;  3U2T A;  1WT2 A;  5C1G A;  1ZIZ A;  2XWN A;  4B4G A;  4G3Q A;  4B2W A;  3I0K A;  4MND A;  1ZCV A;  2NXV A;  1INI A;  1K4V A;  2VK9 A;  4KRV A;  1LZJ A;  3LW6 A;  2VS5 A;  3TZT A;  2J0A A;  3V90 A;  4NAL A;  5L6V A;  1IIN A;  1VZU A;  2PA4 A;  4CJC A;  2X5Z A;  2VXM A;  1ZI1 A;  1V83 A;  4AAW A;  2E8B A;  1JVD A;  2QH5 A;  3CKQ A;  4M4K A;  4D48 A;  1GA8 A;  2YQJ A;  5FYE A;  3SX8 A;  3T7O A;  3ZGG A;  4B3U A;  1HM9 A;  5C47 A;  5AJO A;  2RIY A;  1GQC A;  4FRH A;  3U2U A;  4Y7F A;  1JYK A;  5IDT A;  5AJN A;  1HM0 A;  1VGT A;  5FTS A;  2OI7 A;  4FRE A;  1O0R A;  1OMZ A;  3SXC A;  5C3B A;  5EJ1 A;  5FUH A;  4EEO A;  1O23 B;  4HO3 A;  1YP2 A;  4AC3 A;  2A8U A;  1G8O A;  1JV3 A;  1NKH B;  3ST8 A;  2P73 A;  4B4B A;  1NWG B;  1SS9 A;  1WSZ A;  2BO4 A;  2Z86 A;  2WVM A;  3I0E A;  3TQD A;  2V0I A;  1FRW A;  1R7U A;  2OI5 A;  3OH0 A;  2VS4 A;  1EYR A;  1G0R A;  1ZJ3 A;  3I0I X;  4CVH A;  4HO0 A;  2ZU7 A;  4D11 C;  2V0J A;  2V0L A;  1R7Y A;  5C8R A;  4G3P A;  1IIM A;  5C36 A;  2VSH A;  2MZB A;  4IRP A;  4EEG A;  1PZT A;  1OMX A;  5CQN X;  1ZJ2 A;  2APC A;  5C38 A;  2E3D A;  4R7P A;  2Y4K A;  1FXO A;  3U0Y A;  1FG5 N;  1VM8 A;  1GX0 A;  3SXB A;  2UX8 A;  4O6N A;  5CQP A;  3PKP A;  5CQO A;  3ZLL A;  1VH1 A;  2Y6P A;  1H3M A;  1W77 A;  1ZJ0 A;  2VS3 A;  1LL3 A;  2XMH A;  2Y4M A;  1XZ6 A;  5FU8 A;  4FRB A;  2RJ1 A;  1ZCT A;  3U0X A;  5FTV A;  2Z87 A;  3V0P A;  2X60 A;  1G95 A;  2AGD A;  4G3S A;  2OEG A;  1TW5 A;  3POL A;  3Q80 A;  1NHE B;  1GX4 A;  1V82 A;  4D0Z A;  2AES A;  5DDT A;  3V0M A;  2ZU9 A;  4EEM A;  4HO9 A;  5I1F A;  2VD4 A;  1W57 A;  1H4C A;  2JCJ A;  2JCL A;  1H7Q A;  1VZX A;  2AEC A;  1LZ7 A;  1R7T A;  3I0F A;  2WVL A;  3ZGF A;  3SX7 A;  4Y7U A;  1NF5 B;  4FRQ A;  2V0H A;  4B2X A;  5CMG X;  4ASY A;  1H7G A;  3IOH A;  5C4D A;  1HJL A;  4YS8 A;  4HG6 A;  1G93 A;  4AYL A;  1TZF A;  1R7V A;  3DK5 A;  5CMJ A;  1W55 A;  3BRK X;  2CU2 A;  1ZJP A;  4EVW A;  1QG8 A;  4FRD A;  1LL0 A;  2DPW A;  3R2W A;  1HJJ A;  3D5N A;  3I0L A;  4NAK A;  1H5S D;  3SXA A;  4DE7 A;  1G23 A;  1QWJ A;  4HO8 A;  4FQW A;  3SX3 A;  1R81 A;  2PX7 A;  1H5S A;  3RMW A;  5EIY A;  2FYD B;  4EEA A;  1VGW A;  4K6R A;  1FGX A;  4EE3 A;  1VH3 A;  3OH2 A;  1HV9 A;  4KT7 A;  5J49 A;  3USQ A;  4AYJ A;  3V0N A;  3F1C A;  5D91 A;  3FWW A;  1FZW A;  3IOJ A;  3V0O A;  4DDZ A;  1QGS A;  5C4C A;  5JQQ A;  4HO2 A;  1HM8 A;  4DEC A;  2YES A;  5L6S A;  3E25 A;  2WAW A;  2Y7A A;  3OAM A;  2FY7 A;  2XWL A;  5C3D A;  3I0J A;  4BMA A;  5C48 A;  5CQM X;  2P6W A;  3EE5 A;  2QKX A;  1KWS A;  2PGY A;  5C4F A;  2RIX A;  2ZU8 A;  4HCQ A;  2X65 A;  2A8W A;  2AE7 A;  4FRL A;  1LZI A;  3CKJ A;  3K8E A;  4ASJ A;  2QGI A;  3JUK A;  2O1H A;  3T7N A;  1H7L A;  3USR A;  5C3A A;  2W0W A;  4FRM A;  4GBP A;  1R82 A;  1ZDG A;  2XME A;  1G1L A;  4MYB A;  2C0N A;  5HS2 A;  2V0K A;  1G9R A;  1ZHJ A;  1FO9 A;  3NGW A;  3OH3 A;  1XHB A;  4KPX A;  3OH4 A;  3CKO A;  1TW1 A;  4Y6U A;  1H5T B;  5FU0 A;  3SPT A;  3SXG A;  4KC1 A;  5IDS A;  5EJZ A;  5DDV A;  2VSI A;  3R3I A;  1R7X A;  3CKN A;  4HO4 A;  2D0J A;  1NQI B;  4FCU A;  3V0L A;  1WT1 A;  4HO5 A;  4BQH A;  2GGQ A;  4Y7T A;  1ZJ1 A;  4P02 A;  3E26 A;  3V0Q A;  1VZT A;  4NAN A;  4CJB A;  2RIZ A;  1H7H A;  3O3P A;  4Y62 A;  1Z90 A;  3KIA A;  3I0H A;  2RJ8 A;  3V8Y A;  1FGG A;  2ICX A;  3I0G A;  1JV1 A;  4LW6 A;  4Y9X A;  2AM3 A;  4M2B A;  1JYL A;  1ON6 A;  2Y4J A;  4Y63 A;  1ZI5 A;  3U2V A;  1G3L A;  1LZ0 A;  1ZI4 A;  2VXL A;  2OI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...