3USRA

Structure of y194f glycogenin mutant truncated at residue 270
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
259
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIFSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Mechanisms of monomeric and dimeric glycogenin autoglucosylation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 86
structure length 259
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3usrA00
5FTVA 1QGQA 3LW6A 4GBPA 1G2VA 2V0KA 5L6VA 3SXDA 1Z90A 1VGZA 1VGUA 1JV1A 4Y62A 5EJZA 4ZDQA 3DK5A 3V0OA 3DUVA 4FRMA 1GX0A 3I0KA 1G97A 1H5TA 1FXJA 5C4EA 1VPAA 5C4DA 5IFYA 2ICYA 2YQHA 3OC9A 5FU0A 3BRKX 1XZ6A 2E3DA 1WT0A 4NAKA 4M2AA 4Y9XA 1MP3A 2AE7A 1NKHB 2VXMA 4MNDA 5C4CA 4HOCA 4CJBA 3OGZA 3Q80A 4G3SA 5FU8A 4J18A 1OQMB 4D0TA 4B4GA 5L6SA 4MYBA 1VH1A 2PX7A 3U2VA 1TZFA 4JISA 1IIMA 5C1GA 4Y63A 1ZDFA 2Y4JA 1VM8A 3V0MA 4EEOA 1FR9A 1HM0A 1W57A 1WT2A 2X65A 1O0RA 3V0QA 4Y64A 3RSBA 2OI5A 3SXAA 5CMJA 2PA4A 1R7XA 2FYBA 2RJ7A 2GGOA 1GWVA 1LZ7A 1VICA 5C3AA 4DECA 1FXOA 1W55A 2BO6A 2OEGA 5EIYA 2X5SA 4LW6A 2AGDA 1PZTA 3U2XA 1FRWA 5C4BA 1R7YA 3CKQA 2X60A 1ZJ1A 1G3LA 4FRQA 3ST8A 1HJJA 2WVMA 1FOAA 1VZTA 2ZU7A 1XHBA 4KRVA 2X5ZA 3F1CA 4KT7A 2FYDB 4P00A 2YESA 5AJPA 4Y7TA 1R82A 1K4VA 3K8EA 1H7QA 3FOQA 1TVYA 4CJCA 1WT3A 1INJA 1O7OA 4KPZA 2RJ0A 3DJ4A 1JVDA 4KC1A 4KNRA 2ICXA 2PGVA 1YP3A 2OI7A 3K8DA 1HV9A 2RJ9A 3V0PA 2Z86A 3CGXA 3HL3A 2AECA 1YP2A 4HO5A 3SXCA 1ZCTA 3E26A 3T7OA 2JCKA 2I7BA 4EEAA 3FWWA 3JTJA 1SS9A 1H7EA 1H4CA 1HJLA 3O3PA 3USRA 1HM8A 1FGXA 4HG6A 4FRHA 4D48A 3U2WA 1H7GA 2UX8A 1VH3A 1ON6A 4IRQA 3U2TA 5C48A 1ZCVA 2WGZA 1QWJA 4L41C 2VFZA 1S4OA 3TQDA 1G8OA 1R7UA 1NQIB 4FRLA 2AM4A 1G9RA 1FO8A 5CMHA 3RMWA 1ZI3A 2YCMA 4KQLA 4ASJA 2OEFA 2XWLA 1FGGA 1ZJ0A 1FZWA 4FCUA 4Y7UA 4B4BA 2W0VA 2P72A 4AYJA 4NANA 2VD4A 4HO0A 1H4DA 4HO3A 3POLA 5AJNA 1LZ0A 3V0LA 3RMVA 3JUKA 1ZI5A 1ZJ3A 2YQJA 2D7IA 1QG8A 3U2UA 3CKNA 2Z87A 1JV3A 4R7PA 4KC2A 3ZLKA 2P6WA 1FR8A 1H5RA 1WT1A 5C8RA 3EE5A 1GWWA 4HCQA 5IDSA 2AM3A 4FRAA 2V0LA 2YC5A 4FQWA 3I0CA 3D5NA 2D0JA 3CKVA 2RIXA 1LZJA 2BO7A 3F1YA 1NHEB 1ZCUA 2V0JA 2AH9A 2YQSA 5FV9A 4FRBA 5C36A 3T7NA 3ZGFA 1JVGA 3OH2A 1R81A 1G0RA 2RITA 4D11C 4FRPA 4B4MA 3I0FA 3IOJA 3KIAA 3USQA 2Y4KA 5C47A 2XWMA 3PKPA 3E25A 1I52A 4UEGA 2WE9A 4K6RA 1H5SB 4NALA 3R3IA 4LW3A 4E1KA 2VSIA 1H5SD 2RJ1A 4DDZA 5BXCA 2JCLA 2A8WA 4B3UA 1LL2A 2O1FA 4B5BA 3I0GA 4Y7FA 4FCEA 2RJ8A 1MP4A 3ZF8A 2P73A 1G23A 1ZJ2A 5FTSA 5JQQA 1JYKA 3SXBA 1QGSA 3SX7A 1H3MA 4KNXA 1R80A 3D8VA 2O1GA 2NXVA 2YC3A 3SXEA 1MP5A 2APCA 2GGQA 5AJOA 4D0ZA 5DDVA 2XMHA 2W0WA 4EEMA 4Y6NA 1FWYA 2ZU9A 2XMEA 1R7VA 3I0IX 1PZYB 4KC4A 1ZI1A 5I1FA 2QH5A 1OMZA 1GQCA 3JUJA 4M4KA 1HM9A 3OH3A 4EE5A 4Y7VA 2VS4A 4HO6A 1G95A 1ZJOA 1LL3A 1H7HA 2XWNA 1VZXA 3IOIA 5FUHA 2RIYA 1V82A 5C1LA 2YQCA 4AC3A 1ZCYA 1H5TB 3PKQA 5EJ1A 4D11A 5CQOA 5C38A 2BO8A 3IOHA 3Q7UA 4B42A 2RJ5A 3CU0A 4ASYA 1H7TA 3SX5A 2RIZA 3U0YA 3Q4SA 4NAIA 3OAMA 1LZIA 2BO4A 3OH1A 5CMFX 4CVHA 1INIA 1ZIZA 3I0JA 2V0IA 2PGYA 3CKJA 1WVCA 3OH4A 1W77A 1E5KA 1NMMB 4XWIA 2RJ4A 2QKXA 1FO9A 5J49A 2ZU8A 2VS5A 2Y4LA 4BMAA 4M28A 3I0HA 2WVLA 1O7QA 5HS2A 4HO2A 4ECMA 3BCVA 3T7MA 4FROA 2Y7AA 2A8UA 3QVBA 1O23B 2FFUA 3I0EA 5CQLX 2CU2A 1KWSA 5C3BA 1H5SC 3OH0A 1TW1A 1EYRA 3V0NA 5C49A 3SPTA 1TW5A 3V8ZA 4EE3A 1MC3A 3V91A 2V0HA 4ARWA 5C4FA 4AAWA 3PNNA 2WVKA 2FYCB 4P02A 2JCOA 3U0XA 5CMIA 1V84A 3SXGA 2Q4JA 2D7RA 4C2SA 5FYEA 1ZHJA 4FREA 3I0LA 5CMGX 4FRDA 2DPWA 2E8BA 4G87A 1G1LA 2JCJA 1YP4A 3N9WA 1VZUA 3TZTA 1V83A 1VGWA 4HO9A 4AYLA 1JYLA 4B2XA 4HO8A 5DDTA 1WSZA 4BQHA 1OMXA 4YS8A 3GUEA 3V90A 1G93A 1LL0A 3NGWA 3V8YA 5C1HA 2WEEA 4DE7A 1GA8A 1GQ9A 2I5EA 3CKOA 4G3QA 1ZDGA 2AESA 2FYAA 4B2WA 2FY7A 5CQNX 2QGIA 2VXLA 2O1HA 1VGTA 1NWGB 2VS3A 4IRPA 2RJ6A 3R2WA 2AM5A 1S4NA 1NF5B 3ZLLA 1H5SA 2Y4MA 1ZI4A 4HO4A 5C3DA 3OKRA 4EEGA 1H7LA 2MZBA 1H7FA 4Y6UA 3I0DA 1GX4A 4M2BA 1H4EA 4KPXA 1IINA 1S4PA 3D98A 1FG5N 3SX3A 4EVWA 4EE4A 2WAWA 4G3PA 1LVWA 5CQPA 3ZGGA 1YROB 1H5RB 1EZIA 4KXOA 5IDTA 2OI6A 1ZJPA 2FFVA 2Y6PA 5CQMX 1ON8A 3SX8A 4CJ8A 1R7TA 4Y7GA 4JD0A 2VSHA 2I5KA
chains in the Genus database with same CATH superfamily
5FTVA 1QGQA 3LW6A 4GBPA 1G2VA 2V0KA 5L6VA 3SXDA 1Z90A 1VGZA 1VGUA 1JV1A 4Y62A 5EJZA 4ZDQA 3DK5A 3V0OA 3DUVA 4FRMA 1GX0A 3I0KA 1G97A 1H5TA 1FXJA 5C4EA 1VPAA 5C4DA 5IFYA 2ICYA 2YQHA 3OC9A 5FU0A 3BRKX 1XZ6A 2E3DA 1WT0A 4NAKA 4M2AA 4Y9XA 1MP3A 2AE7A 1NKHB 2VXMA 4MNDA 5C4CA 4HOCA 4CJBA 3OGZA 3Q80A 4G3SA 5FU8A 4J18A 1OQMB 4O6NA 4D0TA 4B4GA 5L6SA 4MYBA 1VH1A 2PX7A 3U2VA 1TZFA 4JISA 1IIMA 5C1GA 4Y63A 1ZDFA 2Y4JA 1VM8A 3V0MA 4EEOA 1FR9A 1HM0A 1W57A 1WT2A 2X65A 1O0RA 3V0QA 4Y64A 3RSBA 2OI5A 3SXAA 5CMJA 2PA4A 1R7XA 2FYBA 2RJ7A 2GGOA 1GWVA 1LZ7A 1VICA 5C3AA 4DECA 1FXOA 1W55A 2BO6A 2OEGA 5EIYA 2X5SA 4LW6A 2AGDA 1PZTA 3U2XA 1FRWA 5C4BA 1R7YA 3CKQA 2X60A 1ZJ1A 4MIXA 5D92A 1G3LA 4FRQA 3ST8A 1HJJA 2WVMA 1FOAA 1VZTA 2ZU7A 1XHBA 4KRVA 2X5ZA 3F1CA 4KT7A 2FYDB 4P00A 2YESA 5AJPA 4Y7TA 1R82A 1K4VA 3K8EA 1H7QA 3FOQA 1TVYA 4CJCA 1WT3A 1INJA 1O7OA 4KPZA 2RJ0A 3DJ4A 1JVDA 4KC1A 4KNRA 2ICXA 2PGVA 1YP3A 2OI7A 3K8DA 1HV9A 2RJ9A 3V0PA 2Z86A 3CGXA 3HL3A 2AECA 1YP2A 4HO5A 3SXCA 1ZCTA 4O6MA 3E26A 3T7OA 2JCKA 2I7BA 4EEAA 3FWWA 3JTJA 1SS9A 1H7EA 1H4CA 1HJLA 3O3PA 3USRA 1HM8A 1FGXA 4HG6A 4FRHA 4D48A 3U2WA 1H7GA 2UX8A 1VH3A 1ON6A 4IRQA 3U2TA 5C48A 1ZCVA 2WGZA 1QWJA 4L41C 2VFZA 1S4OA 3TQDA 1G8OA 1R7UA 1NQIB 4FRLA 2AM4A 1G9RA 1FO8A 5CMHA 3RMWA 1ZI3A 2YCMA 4KQLA 4ASJA 2OEFA 2XWLA 1FGGA 1ZJ0A 1FZWA 4FCUA 4Y7UA 4B4BA 2W0VA 2P72A 4AYJA 4NANA 2VD4A 4HO0A 1H4DA 4HO3A 3POLA 5AJNA 1LZ0A 3V0LA 3RMVA 3JUKA 1ZI5A 1ZJ3A 2YQJA 2D7IA 1QG8A 3U2UA 3CKNA 2Z87A 1JV3A 4R7PA 4KC2A 3ZLKA 2P6WA 1FR8A 1H5RA 1WT1A 5C8RA 3EE5A 1GWWA 4HCQA 5IDSA 2AM3A 4FRAA 2V0LA 2YC5A 4FQWA 3I0CA 3D5NA 2D0JA 3CKVA 2RIXA 1LZJA 2BO7A 3F1YA 1NHEB 1ZCUA 2V0JA 2AH9A 2YQSA 5FV9A 4FRBA 5C36A 3T7NA 3ZGFA 1JVGA 3OH2A 1R81A 1G0RA 2RITA 4D11C 4FRPA 4B4MA 3I0FA 3IOJA 3KIAA 3USQA 2Y4KA 5C47A 2XWMA 3PKPA 3E25A 1I52A 4UEGA 2WE9A 4FIXA 1H5SB 4K6RA 4NALA 3R3IA 4LW3A 4E1KA 2VSIA 1H5SD 2RJ1A 4DDZA 5BXCA 2JCLA 2A8WA 4B3UA 1LL2A 2O1FA 4B5BA 3I0GA 4Y7FA 4FCEA 2RJ8A 1MP4A 3ZF8A 2P73A 1G23A 1ZJ2A 5FTSA 5JQQA 1JYKA 3SXBA 1QGSA 3SX7A 1H3MA 4KNXA 1R80A 3D8VA 2O1GA 2NXVA 2YC3A 3SXEA 1MP5A 2APCA 2GGQA 5AJOA 4D0ZA 5DDVA 2XMHA 2W0WA 4EEMA 4Y6NA 1FWYA 2ZU9A 2XMEA 1R7VA 3I0IX 1PZYB 4KC4A 1ZI1A 5I1FA 2QH5A 1OMZA 1GQCA 2C0NA 3JUJA 4M4KA 1HM9A 3OH3A 4EE5A 4Y7VA 2VS4A 4HO6A 1G95A 1ZJOA 1LL3A 1H7HA 2XWNA 1VZXA 3IOIA 5FUHA 2RIYA 1V82A 5C1LA 2YQCA 4AC3A 1ZCYA 1H5TB 3PKQA 2VK9A 5EJ1A 4D11A 5CQOA 5C38A 2BO8A 3IOHA 3Q7UA 4B42A 2RJ5A 3CU0A 4ASYA 1H7TA 3SX5A 4FIYA 2RIZA 3U0YA 3Q4SA 4NAIA 3OAMA 1LZIA 2BO4A 3OH1A 5CMFX 4CVHA 1INIA 1ZIZA 3I0JA 2V0IA 2PGYA 3CKJA 1WVCA 3OH4A 1W77A 1E5KA 1NMMB 4XWIA 2RJ4A 2QKXA 1FO9A 5J49A 2ZU8A 2VS5A 2Y4LA 4BMAA 4M28A 3I0HA 2WVLA 1O7QA 5HS2A 4HO2A 4ECMA 3BCVA 3T7MA 4FROA 2Y7AA 2A8UA 3QVBA 1O23B 2FFUA 3I0EA 5CQLX 2CU2A 1KWSA 5C3BA 1H5SC 3OH0A 1TW1A 1EYRA 3V0NA 5C49A 3SPTA 1TW5A 3V8ZA 2J0BA 4EE3A 1MC3A 3V91A 2V0HA 4ARWA 5C4FA 4AAWA 3PNNA 2WVKA 2FYCB 4Q7CA 4P02A 2JCOA 3U0XA 5CMIA 1V84A 3SXGA 2Q4JA 2D7RA 4C2SA 5FYEA 1ZHJA 4FREA 3I0LA 5CMGX 4FRDA 2DPWA 2E8BA 4G87A 1G1LA 2JCJA 1YP4A 3N9WA 1VZUA 3TZTA 1V83A 1VGWA 4HO9A 4AYLA 1JYLA 4B2XA 4HO8A 5DDTA 1WSZA 4BQHA 1OMXA 4YS8A 3GUEA 3V90A 1G93A 1LL0A 3NGWA 3V8YA 5C1HA 2WEEA 4DE7A 1GA8A 1GQ9A 2I5EA 3CKOA 4G3QA 1ZDGA 2AESA 2FYAA 4B2WA 2FY7A 5CQNX 2QGIA 2VXLA 2O1HA 1VGTA 1NWGB 2VS3A 4IRPA 2RJ6A 3R2WA 5D91A 2AM5A 1S4NA 1NF5B 3ZLLA 1H5SA 2Y4MA 1ZI4A 4HO4A 5C3DA 3OKRA 4EEGA 1H7LA 2MZBA 1H7FA 4Y6UA 3I0DA 1GX4A 4M2BA 2J0AA 1H4EA 4KPXA 1IINA 1S4PA 3D98A 1FG5N 3SX3A 4EVWA 4EE4A 2WAWA 4G3PA 1LVWA 5CQPA 3ZGGA 1YROB 1H5RB 1EZIA 4KXOA 5IDTA 2OI6A 1ZJPA 2FFVA 2Y6PA 5CQMX 1ON8A 3SX8A 4CJ8A 1R7TA 4Y7GA 4JD0A 2VSHA 2I5KA
chains in the Genus database with same CATH topology
5FTVA 1QGQA 3LW6A 4GBPA 1G2VA 2V0KA 5L6VA 3SXDA 1Z90A 1VGZA 1VGUA 1JV1A 4Y62A 5EJZA 4ZDQA 3DK5A 3V0OA 3DUVA 4FRMA 1GX0A 3I0KA 1G97A 1H5TA 1FXJA 5C4EA 1VPAA 5C4DA 5IFYA 2ICYA 2YQHA 3OC9A 5FU0A 3BRKX 1XZ6A 2E3DA 1WT0A 4NAKA 4M2AA 4Y9XA 1MP3A 2AE7A 1NKHB 2VXMA 4MNDA 5C4CA 4HOCA 4CJBA 3OGZA 3Q80A 4G3SA 5FU8A 4J18A 1OQMB 4O6NA 4D0TA 4B4GA 5L6SA 4MYBA 1VH1A 2PX7A 3U2VA 1TZFA 4JISA 1IIMA 5C1GA 4Y63A 1ZDFA 2Y4JA 1VM8A 3V0MA 4EEOA 1FR9A 1HM0A 1W57A 1WT2A 2X65A 1O0RA 3V0QA 4Y64A 3RSBA 2OI5A 3SXAA 5CMJA 2PA4A 1R7XA 2FYBA 2RJ7A 2GGOA 1GWVA 1LZ7A 1VICA 5C3AA 4DECA 1FXOA 1W55A 2BO6A 2OEGA 5EIYA 2X5SA 4LW6A 2AGDA 1PZTA 3U2XA 1FRWA 5C4BA 1R7YA 3CKQA 2X60A 1ZJ1A 4MIXA 5D92A 1G3LA 4FRQA 3ST8A 1HJJA 2WVMA 1FOAA 1VZTA 2ZU7A 1XHBA 4KRVA 2X5ZA 3F1CA 4KT7A 2FYDB 4P00A 2YESA 5AJPA 4Y7TA 1R82A 1K4VA 3K8EA 1H7QA 3FOQA 1TVYA 4CJCA 1WT3A 1INJA 1O7OA 4KPZA 2RJ0A 3DJ4A 1JVDA 4KC1A 4KNRA 2ICXA 2PGVA 1YP3A 2OI7A 3K8DA 1HV9A 2RJ9A 3V0PA 2Z86A 3CGXA 3HL3A 2AECA 1YP2A 4HO5A 3SXCA 1ZCTA 4O6MA 3E26A 3T7OA 2JCKA 2I7BA 4EEAA 3FWWA 3JTJA 1SS9A 1H7EA 1H4CA 1HJLA 3O3PA 3USRA 1HM8A 1FGXA 4HG6A 4FRHA 4D48A 3U2WA 1H7GA 2UX8A 1VH3A 1ON6A 4IRQA 3U2TA 5C48A 1ZCVA 2WGZA 1QWJA 4L41C 2VFZA 1S4OA 3TQDA 1G8OA 1R7UA 1NQIB 4FRLA 2AM4A 1G9RA 1FO8A 5CMHA 3RMWA 1ZI3A 2YCMA 4KQLA 4ASJA 2OEFA 2XWLA 1FGGA 1ZJ0A 1FZWA 4FCUA 4Y7UA 4B4BA 2W0VA 2P72A 4AYJA 4NANA 2VD4A 4HO0A 1H4DA 4HO3A 3POLA 5AJNA 1LZ0A 3V0LA 3RMVA 3JUKA 1ZI5A 1ZJ3A 2YQJA 2D7IA 1QG8A 3U2UA 3CKNA 2Z87A 1JV3A 4R7PA 4KC2A 3ZLKA 2P6WA 1FR8A 1H5RA 1WT1A 5C8RA 3EE5A 1GWWA 4HCQA 5IDSA 2AM3A 4FRAA 2V0LA 2YC5A 4FQWA 3I0CA 3D5NA 2D0JA 3CKVA 2RIXA 1LZJA 2BO7A 3F1YA 1NHEB 1ZCUA 2V0JA 2AH9A 2YQSA 5FV9A 4FRBA 5C36A 3T7NA 3ZGFA 1JVGA 3OH2A 1R81A 1G0RA 2RITA 4D11C 4FRPA 4B4MA 3I0FA 3IOJA 3KIAA 3USQA 2Y4KA 5C47A 2XWMA 3PKPA 3E25A 1I52A 4UEGA 2WE9A 4FIXA 1H5SB 4K6RA 4NALA 3R3IA 4LW3A 4E1KA 2VSIA 1H5SD 2RJ1A 4DDZA 5BXCA 2JCLA 2A8WA 4B3UA 1LL2A 2O1FA 4B5BA 3I0GA 4Y7FA 4FCEA 2RJ8A 1MP4A 3ZF8A 2P73A 1G23A 1ZJ2A 5FTSA 5JQQA 1JYKA 3SXBA 1QGSA 3SX7A 1H3MA 4KNXA 1R80A 3D8VA 2O1GA 2NXVA 2YC3A 3SXEA 1MP5A 2APCA 2GGQA 5AJOA 4D0ZA 5DDVA 2XMHA 2W0WA 4EEMA 4Y6NA 1FWYA 2ZU9A 2XMEA 1R7VA 3I0IX 1PZYB 4KC4A 1ZI1A 5I1FA 2QH5A 1OMZA 1GQCA 2C0NA 3JUJA 4M4KA 1HM9A 3OH3A 4EE5A 4Y7VA 2VS4A 4HO6A 1G95A 1ZJOA 1LL3A 1H7HA 2XWNA 1VZXA 3IOIA 5FUHA 2RIYA 1V82A 5C1LA 2YQCA 4AC3A 1ZCYA 1H5TB 3PKQA 2VK9A 5EJ1A 4D11A 5CQOA 5C38A 2BO8A 3IOHA 3Q7UA 4B42A 2RJ5A 3CU0A 4ASYA 1H7TA 3SX5A 4FIYA 2RIZA 3U0YA 3Q4SA 4NAIA 3OAMA 1LZIA 2BO4A 3OH1A 5CMFX 4CVHA 1INIA 1ZIZA 3I0JA 2V0IA 2PGYA 3CKJA 1WVCA 3OH4A 1W77A 1E5KA 1NMMB 4XWIA 2RJ4A 2QKXA 1FO9A 5J49A 2ZU8A 2VS5A 2Y4LA 4BMAA 4M28A 3I0HA 2WVLA 1O7QA 5HS2A 4HO2A 4ECMA 3BCVA 3T7MA 4FROA 2Y7AA 2A8UA 3QVBA 1O23B 2FFUA 3I0EA 5CQLX 2CU2A 1KWSA 5C3BA 1H5SC 3OH0A 1TW1A 1EYRA 3V0NA 5C49A 3SPTA 1TW5A 3V8ZA 2J0BA 4EE3A 1MC3A 3V91A 2V0HA 4ARWA 5C4FA 4AAWA 3PNNA 2WVKA 2FYCB 4Q7CA 4P02A 2JCOA 3U0XA 5CMIA 1V84A 3SXGA 2Q4JA 2D7RA 4C2SA 5FYEA 1ZHJA 4FREA 3I0LA 5CMGX 4FRDA 2DPWA 2E8BA 4G87A 1G1LA 2JCJA 1YP4A 3N9WA 1VZUA 3TZTA 1V83A 1VGWA 4HO9A 4AYLA 1JYLA 4B2XA 4HO8A 5DDTA 1WSZA 4BQHA 1OMXA 4YS8A 3GUEA 3V90A 1G93A 1LL0A 3NGWA 3V8YA 5C1HA 2WEEA 4DE7A 1GA8A 1GQ9A 2I5EA 3CKOA 4G3QA 1ZDGA 2AESA 2FYAA 4B2WA 2FY7A 5CQNX 2QGIA 2VXLA 2O1HA 1VGTA 1NWGB 2VS3A 4IRPA 2RJ6A 3R2WA 5D91A 2AM5A 1S4NA 1NF5B 3ZLLA 1H5SA 2Y4MA 1ZI4A 4HO4A 5C3DA 3OKRA 4EEGA 1H7LA 2MZBA 1H7FA 4Y6UA 3I0DA 1GX4A 4M2BA 2J0AA 1H4EA 4KPXA 1IINA 1S4PA 3D98A 1FG5N 3SX3A 4EVWA 4EE4A 2WAWA 4G3PA 1LVWA 5CQPA 3ZGGA 1YROB 1H5RB 1EZIA 4KXOA 5IDTA 2OI6A 1ZJPA 2FFVA 2Y6PA 5CQMX 1ON8A 3SX8A 4CJ8A 1R7TA 4Y7GA 4JD0A 2VSHA 2I5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTV A;  1QGQ A;  3LW6 A;  4GBP A;  1G2V A;  2V0K A;  5L6V A;  3SXD A;  1Z90 A;  1VGZ A;  1VGU A;  1JV1 A;  4Y62 A;  5EJZ A;  4ZDQ A;  3DK5 A;  3V0O A;  3DUV A;  4FRM A;  1GX0 A;  3I0K A;  1G97 A;  1H5T A;  1FXJ A;  5C4E A;  1VPA A;  5C4D A;  5IFY A;  2ICY A;  2YQH A;  3OC9 A;  5FU0 A;  3BRK X;  1XZ6 A;  2E3D A;  1WT0 A;  4NAK A;  4M2A A;  4Y9X A;  1MP3 A;  2AE7 A;  1NKH B;  2VXM A;  4MND A;  5C4C A;  4HOC A;  4CJB A;  3OGZ A;  3Q80 A;  4G3S A;  5FU8 A;  4J18 A;  1OQM B;  4D0T A;  4B4G A;  5L6S A;  4MYB A;  1VH1 A;  2PX7 A;  3U2V A;  1TZF A;  4JIS A;  1IIM A;  5C1G A;  4Y63 A;  1ZDF A;  2Y4J A;  1VM8 A;  3V0M A;  4EEO A;  1FR9 A;  1HM0 A;  1W57 A;  1WT2 A;  2X65 A;  1O0R A;  3V0Q A;  4Y64 A;  3RSB A;  2OI5 A;  3SXA A;  5CMJ A;  2PA4 A;  1R7X A;  2FYB A;  2RJ7 A;  2GGO A;  1GWV A;  1LZ7 A;  1VIC A;  5C3A A;  4DEC A;  1FXO A;  1W55 A;  2BO6 A;  2OEG A;  5EIY A;  2X5S A;  4LW6 A;  2AGD A;  1PZT A;  3U2X A;  1FRW A;  5C4B A;  1R7Y A;  3CKQ A;  2X60 A;  1ZJ1 A;  1G3L A;  4FRQ A;  3ST8 A;  1HJJ A;  2WVM A;  1FOA A;  1VZT A;  2ZU7 A;  1XHB A;  4KRV A;  2X5Z A;  3F1C A;  4KT7 A;  2FYD B;  4P00 A;  2YES A;  5AJP A;  4Y7T A;  1R82 A;  1K4V A;  3K8E A;  1H7Q A;  3FOQ A;  1TVY A;  4CJC A;  1WT3 A;  1INJ A;  1O7O A;  4KPZ A;  2RJ0 A;  3DJ4 A;  1JVD A;  4KC1 A;  4KNR A;  2ICX A;  2PGV A;  1YP3 A;  2OI7 A;  3K8D A;  1HV9 A;  2RJ9 A;  3V0P A;  2Z86 A;  3CGX A;  3HL3 A;  2AEC A;  1YP2 A;  4HO5 A;  3SXC A;  1ZCT A;  3E26 A;  3T7O A;  2JCK A;  2I7B A;  4EEA A;  3FWW A;  3JTJ A;  1SS9 A;  1H7E A;  1H4C A;  1HJL A;  3O3P A;  3USR A;  1HM8 A;  1FGX A;  4HG6 A;  4FRH A;  4D48 A;  3U2W A;  1H7G A;  2UX8 A;  1VH3 A;  1ON6 A;  4IRQ A;  3U2T A;  5C48 A;  1ZCV A;  2WGZ A;  1QWJ A;  4L41 C;  2VFZ A;  1S4O A;  3TQD A;  1G8O A;  1R7U A;  1NQI B;  4FRL A;  2AM4 A;  1G9R A;  1FO8 A;  5CMH A;  3RMW A;  1ZI3 A;  2YCM A;  4KQL A;  4ASJ A;  2OEF A;  2XWL A;  1FGG A;  1ZJ0 A;  1FZW A;  4FCU A;  4Y7U A;  4B4B A;  2W0V A;  2P72 A;  4AYJ A;  4NAN A;  2VD4 A;  4HO0 A;  1H4D A;  4HO3 A;  3POL A;  5AJN A;  1LZ0 A;  3V0L A;  3RMV A;  3JUK A;  1ZI5 A;  1ZJ3 A;  2YQJ A;  2D7I A;  1QG8 A;  3U2U A;  3CKN A;  2Z87 A;  1JV3 A;  4R7P A;  4KC2 A;  3ZLK A;  2P6W A;  1FR8 A;  1H5R A;  1WT1 A;  5C8R A;  3EE5 A;  1GWW A;  4HCQ A;  5IDS A;  2AM3 A;  4FRA A;  2V0L A;  2YC5 A;  4FQW A;  3I0C A;  3D5N A;  2D0J A;  3CKV A;  2RIX A;  1LZJ A;  2BO7 A;  3F1Y A;  1NHE B;  1ZCU A;  2V0J A;  2AH9 A;  2YQS A;  5FV9 A;  4FRB A;  5C36 A;  3T7N A;  3ZGF A;  1JVG A;  3OH2 A;  1R81 A;  1G0R A;  2RIT A;  4D11 C;  4FRP A;  4B4M A;  3I0F A;  3IOJ A;  3KIA A;  3USQ A;  2Y4K A;  5C47 A;  2XWM A;  3PKP A;  3E25 A;  1I52 A;  4UEG A;  2WE9 A;  4K6R A;  1H5S B;  4NAL A;  3R3I A;  4LW3 A;  4E1K A;  2VSI A;  1H5S D;  2RJ1 A;  4DDZ A;  5BXC A;  2JCL A;  2A8W A;  4B3U A;  1LL2 A;  2O1F A;  4B5B A;  3I0G A;  4Y7F A;  4FCE A;  2RJ8 A;  1MP4 A;  3ZF8 A;  2P73 A;  1G23 A;  1ZJ2 A;  5FTS A;  5JQQ A;  1JYK A;  3SXB A;  1QGS A;  3SX7 A;  1H3M A;  4KNX A;  1R80 A;  3D8V A;  2O1G A;  2NXV A;  2YC3 A;  3SXE A;  1MP5 A;  2APC A;  2GGQ A;  5AJO A;  4D0Z A;  5DDV A;  2XMH A;  2W0W A;  4EEM A;  4Y6N A;  1FWY A;  2ZU9 A;  2XME A;  1R7V A;  3I0I X;  1PZY B;  4KC4 A;  1ZI1 A;  5I1F A;  2QH5 A;  1OMZ A;  1GQC A;  3JUJ A;  4M4K A;  1HM9 A;  3OH3 A;  4EE5 A;  4Y7V A;  2VS4 A;  4HO6 A;  1G95 A;  1ZJO A;  1LL3 A;  1H7H A;  2XWN A;  1VZX A;  3IOI A;  5FUH A;  2RIY A;  1V82 A;  5C1L A;  2YQC A;  4AC3 A;  1ZCY A;  1H5T B;  3PKQ A;  5EJ1 A;  4D11 A;  5CQO A;  5C38 A;  2BO8 A;  3IOH A;  3Q7U A;  4B42 A;  2RJ5 A;  3CU0 A;  4ASY A;  1H7T A;  3SX5 A;  2RIZ A;  3U0Y A;  3Q4S A;  4NAI A;  3OAM A;  1LZI A;  2BO4 A;  3OH1 A;  5CMF X;  4CVH A;  1INI A;  1ZIZ A;  3I0J A;  2V0I A;  2PGY A;  3CKJ A;  1WVC A;  3OH4 A;  1W77 A;  1E5K A;  1NMM B;  4XWI A;  2RJ4 A;  2QKX A;  1FO9 A;  5J49 A;  2ZU8 A;  2VS5 A;  2Y4L A;  4BMA A;  4M28 A;  3I0H A;  2WVL A;  1O7Q A;  5HS2 A;  4HO2 A;  4ECM A;  3BCV A;  3T7M A;  4FRO A;  2Y7A A;  2A8U A;  3QVB A;  1O23 B;  2FFU A;  3I0E A;  5CQL X;  2CU2 A;  1KWS A;  5C3B A;  1H5S C;  3OH0 A;  1TW1 A;  1EYR A;  3V0N A;  5C49 A;  3SPT A;  1TW5 A;  3V8Z A;  4EE3 A;  1MC3 A;  3V91 A;  2V0H A;  4ARW A;  5C4F A;  4AAW A;  3PNN A;  2WVK A;  2FYC B;  4P02 A;  2JCO A;  3U0X A;  5CMI A;  1V84 A;  3SXG A;  2Q4J A;  2D7R A;  4C2S A;  5FYE A;  1ZHJ A;  4FRE A;  3I0L A;  5CMG X;  4FRD A;  2DPW A;  2E8B A;  4G87 A;  1G1L A;  2JCJ A;  1YP4 A;  3N9W A;  1VZU A;  3TZT A;  1V83 A;  1VGW A;  4HO9 A;  4AYL A;  1JYL A;  4B2X A;  4HO8 A;  5DDT A;  1WSZ A;  4BQH A;  1OMX A;  4YS8 A;  3GUE A;  3V90 A;  1G93 A;  1LL0 A;  3NGW A;  3V8Y A;  5C1H A;  2WEE A;  4DE7 A;  1GA8 A;  1GQ9 A;  2I5E A;  3CKO A;  4G3Q A;  1ZDG A;  2AES A;  2FYA A;  4B2W A;  2FY7 A;  5CQN X;  2QGI A;  2VXL A;  2O1H A;  1VGT A;  1NWG B;  2VS3 A;  4IRP A;  2RJ6 A;  3R2W A;  2AM5 A;  1S4N A;  1NF5 B;  3ZLL A;  1H5S A;  2Y4M A;  1ZI4 A;  4HO4 A;  5C3D A;  3OKR A;  4EEG A;  1H7L A;  2MZB A;  1H7F A;  4Y6U A;  3I0D A;  1GX4 A;  4M2B A;  1H4E A;  4KPX A;  1IIN A;  1S4P A;  3D98 A;  1FG5 N;  3SX3 A;  4EVW A;  4EE4 A;  2WAW A;  4G3P A;  1LVW A;  5CQP A;  3ZGG A;  1YRO B;  1H5R B;  1EZI A;  4KXO A;  5IDT A;  2OI6 A;  1ZJP A;  2FFV A;  2Y6P A;  5CQM X;  1ON8 A;  3SX8 A;  4CJ8 A;  1R7T A;  4Y7G A;  4JD0 A;  2VSH A;  2I5K A; 
#chains in the Genus database with same CATH topology
 5FTV A;  1QGQ A;  3LW6 A;  4GBP A;  1G2V A;  2V0K A;  5L6V A;  3SXD A;  1Z90 A;  1VGZ A;  1VGU A;  1JV1 A;  4Y62 A;  5EJZ A;  4ZDQ A;  3DK5 A;  3V0O A;  3DUV A;  4FRM A;  1GX0 A;  3I0K A;  1G97 A;  1H5T A;  1FXJ A;  5C4E A;  1VPA A;  5C4D A;  5IFY A;  2ICY A;  2YQH A;  3OC9 A;  5FU0 A;  3BRK X;  1XZ6 A;  2E3D A;  1WT0 A;  4NAK A;  4M2A A;  4Y9X A;  1MP3 A;  2AE7 A;  1NKH B;  2VXM A;  4MND A;  5C4C A;  4HOC A;  4CJB A;  3OGZ A;  3Q80 A;  4G3S A;  5FU8 A;  4J18 A;  1OQM B;  4O6N A;  4D0T A;  4B4G A;  5L6S A;  4MYB A;  1VH1 A;  2PX7 A;  3U2V A;  1TZF A;  4JIS A;  1IIM A;  5C1G A;  4Y63 A;  1ZDF A;  2Y4J A;  1VM8 A;  3V0M A;  4EEO A;  1FR9 A;  1HM0 A;  1W57 A;  1WT2 A;  2X65 A;  1O0R A;  3V0Q A;  4Y64 A;  3RSB A;  2OI5 A;  3SXA A;  5CMJ A;  2PA4 A;  1R7X A;  2FYB A;  2RJ7 A;  2GGO A;  1GWV A;  1LZ7 A;  1VIC A;  5C3A A;  4DEC A;  1FXO A;  1W55 A;  2BO6 A;  2OEG A;  5EIY A;  2X5S A;  4LW6 A;  2AGD A;  1PZT A;  3U2X A;  1FRW A;  5C4B A;  1R7Y A;  3CKQ A;  2X60 A;  1ZJ1 A;  4MIX A;  5D92 A;  1G3L A;  4FRQ A;  3ST8 A;  1HJJ A;  2WVM A;  1FOA A;  1VZT A;  2ZU7 A;  1XHB A;  4KRV A;  2X5Z A;  3F1C A;  4KT7 A;  2FYD B;  4P00 A;  2YES A;  5AJP A;  4Y7T A;  1R82 A;  1K4V A;  3K8E A;  1H7Q A;  3FOQ A;  1TVY A;  4CJC A;  1WT3 A;  1INJ A;  1O7O A;  4KPZ A;  2RJ0 A;  3DJ4 A;  1JVD A;  4KC1 A;  4KNR A;  2ICX A;  2PGV A;  1YP3 A;  2OI7 A;  3K8D A;  1HV9 A;  2RJ9 A;  3V0P A;  2Z86 A;  3CGX A;  3HL3 A;  2AEC A;  1YP2 A;  4HO5 A;  3SXC A;  1ZCT A;  4O6M A;  3E26 A;  3T7O A;  2JCK A;  2I7B A;  4EEA A;  3FWW A;  3JTJ A;  1SS9 A;  1H7E A;  1H4C A;  1HJL A;  3O3P A;  3USR A;  1HM8 A;  1FGX A;  4HG6 A;  4FRH A;  4D48 A;  3U2W A;  1H7G A;  2UX8 A;  1VH3 A;  1ON6 A;  4IRQ A;  3U2T A;  5C48 A;  1ZCV A;  2WGZ A;  1QWJ A;  4L41 C;  2VFZ A;  1S4O A;  3TQD A;  1G8O A;  1R7U A;  1NQI B;  4FRL A;  2AM4 A;  1G9R A;  1FO8 A;  5CMH A;  3RMW A;  1ZI3 A;  2YCM A;  4KQL A;  4ASJ A;  2OEF A;  2XWL A;  1FGG A;  1ZJ0 A;  1FZW A;  4FCU A;  4Y7U A;  4B4B A;  2W0V A;  2P72 A;  4AYJ A;  4NAN A;  2VD4 A;  4HO0 A;  1H4D A;  4HO3 A;  3POL A;  5AJN A;  1LZ0 A;  3V0L A;  3RMV A;  3JUK A;  1ZI5 A;  1ZJ3 A;  2YQJ A;  2D7I A;  1QG8 A;  3U2U A;  3CKN A;  2Z87 A;  1JV3 A;  4R7P A;  4KC2 A;  3ZLK A;  2P6W A;  1FR8 A;  1H5R A;  1WT1 A;  5C8R A;  3EE5 A;  1GWW A;  4HCQ A;  5IDS A;  2AM3 A;  4FRA A;  2V0L A;  2YC5 A;  4FQW A;  3I0C A;  3D5N A;  2D0J A;  3CKV A;  2RIX A;  1LZJ A;  2BO7 A;  3F1Y A;  1NHE B;  1ZCU A;  2V0J A;  2AH9 A;  2YQS A;  5FV9 A;  4FRB A;  5C36 A;  3T7N A;  3ZGF A;  1JVG A;  3OH2 A;  1R81 A;  1G0R A;  2RIT A;  4D11 C;  4FRP A;  4B4M A;  3I0F A;  3IOJ A;  3KIA A;  3USQ A;  2Y4K A;  5C47 A;  2XWM A;  3PKP A;  3E25 A;  1I52 A;  4UEG A;  2WE9 A;  4FIX A;  1H5S B;  4K6R A;  4NAL A;  3R3I A;  4LW3 A;  4E1K A;  2VSI A;  1H5S D;  2RJ1 A;  4DDZ A;  5BXC A;  2JCL A;  2A8W A;  4B3U A;  1LL2 A;  2O1F A;  4B5B A;  3I0G A;  4Y7F A;  4FCE A;  2RJ8 A;  1MP4 A;  3ZF8 A;  2P73 A;  1G23 A;  1ZJ2 A;  5FTS A;  5JQQ A;  1JYK A;  3SXB A;  1QGS A;  3SX7 A;  1H3M A;  4KNX A;  1R80 A;  3D8V A;  2O1G A;  2NXV A;  2YC3 A;  3SXE A;  1MP5 A;  2APC A;  2GGQ A;  5AJO A;  4D0Z A;  5DDV A;  2XMH A;  2W0W A;  4EEM A;  4Y6N A;  1FWY A;  2ZU9 A;  2XME A;  1R7V A;  3I0I X;  1PZY B;  4KC4 A;  1ZI1 A;  5I1F A;  2QH5 A;  1OMZ A;  1GQC A;  2C0N A;  3JUJ A;  4M4K A;  1HM9 A;  3OH3 A;  4EE5 A;  4Y7V A;  2VS4 A;  4HO6 A;  1G95 A;  1ZJO A;  1LL3 A;  1H7H A;  2XWN A;  1VZX A;  3IOI A;  5FUH A;  2RIY A;  1V82 A;  5C1L A;  2YQC A;  4AC3 A;  1ZCY A;  1H5T B;  3PKQ A;  2VK9 A;  5EJ1 A;  4D11 A;  5CQO A;  5C38 A;  2BO8 A;  3IOH A;  3Q7U A;  4B42 A;  2RJ5 A;  3CU0 A;  4ASY A;  1H7T A;  3SX5 A;  4FIY A;  2RIZ A;  3U0Y A;  3Q4S A;  4NAI A;  3OAM A;  1LZI A;  2BO4 A;  3OH1 A;  5CMF X;  4CVH A;  1INI A;  1ZIZ A;  3I0J A;  2V0I A;  2PGY A;  3CKJ A;  1WVC A;  3OH4 A;  1W77 A;  1E5K A;  1NMM B;  4XWI A;  2RJ4 A;  2QKX A;  1FO9 A;  5J49 A;  2ZU8 A;  2VS5 A;  2Y4L A;  4BMA A;  4M28 A;  3I0H A;  2WVL A;  1O7Q A;  5HS2 A;  4HO2 A;  4ECM A;  3BCV A;  3T7M A;  4FRO A;  2Y7A A;  2A8U A;  3QVB A;  1O23 B;  2FFU A;  3I0E A;  5CQL X;  2CU2 A;  1KWS A;  5C3B A;  1H5S C;  3OH0 A;  1TW1 A;  1EYR A;  3V0N A;  5C49 A;  3SPT A;  1TW5 A;  3V8Z A;  2J0B A;  4EE3 A;  1MC3 A;  3V91 A;  2V0H A;  4ARW A;  5C4F A;  4AAW A;  3PNN A;  2WVK A;  2FYC B;  4Q7C A;  4P02 A;  2JCO A;  3U0X A;  5CMI A;  1V84 A;  3SXG A;  2Q4J A;  2D7R A;  4C2S A;  5FYE A;  1ZHJ A;  4FRE A;  3I0L A;  5CMG X;  4FRD A;  2DPW A;  2E8B A;  4G87 A;  1G1L A;  2JCJ A;  1YP4 A;  3N9W A;  1VZU A;  3TZT A;  1V83 A;  1VGW A;  4HO9 A;  4AYL A;  1JYL A;  4B2X A;  4HO8 A;  5DDT A;  1WSZ A;  4BQH A;  1OMX A;  4YS8 A;  3GUE A;  3V90 A;  1G93 A;  1LL0 A;  3NGW A;  3V8Y A;  5C1H A;  2WEE A;  4DE7 A;  1GA8 A;  1GQ9 A;  2I5E A;  3CKO A;  4G3Q A;  1ZDG A;  2AES A;  2FYA A;  4B2W A;  2FY7 A;  5CQN X;  2QGI A;  2VXL A;  2O1H A;  1VGT A;  1NWG B;  2VS3 A;  4IRP A;  2RJ6 A;  3R2W A;  5D91 A;  2AM5 A;  1S4N A;  1NF5 B;  3ZLL A;  1H5S A;  2Y4M A;  1ZI4 A;  4HO4 A;  5C3D A;  3OKR A;  4EEG A;  1H7L A;  2MZB A;  1H7F A;  4Y6U A;  3I0D A;  1GX4 A;  4M2B A;  2J0A A;  1H4E A;  4KPX A;  1IIN A;  1S4P A;  3D98 A;  1FG5 N;  3SX3 A;  4EVW A;  4EE4 A;  2WAW A;  4G3P A;  1LVW A;  5CQP A;  3ZGG A;  1YRO B;  1H5R B;  1EZI A;  4KXO A;  5IDT A;  2OI6 A;  1ZJP A;  2FFV A;  2Y6P A;  5CQM X;  1ON8 A;  3SX8 A;  4CJ8 A;  1R7T A;  4Y7G A;  4JD0 A;  2VSH A;  2I5K A; 
#chains in the Genus database with same CATH homology
 5FTV A;  1QGQ A;  3LW6 A;  4GBP A;  1G2V A;  2V0K A;  5L6V A;  3SXD A;  1Z90 A;  1VGZ A;  1VGU A;  1JV1 A;  4Y62 A;  5EJZ A;  4ZDQ A;  3DK5 A;  3V0O A;  3DUV A;  4FRM A;  1GX0 A;  3I0K A;  1G97 A;  1H5T A;  1FXJ A;  5C4E A;  1VPA A;  5C4D A;  5IFY A;  2ICY A;  2YQH A;  3OC9 A;  5FU0 A;  3BRK X;  1XZ6 A;  2E3D A;  1WT0 A;  4NAK A;  4M2A A;  4Y9X A;  1MP3 A;  2AE7 A;  1NKH B;  2VXM A;  4MND A;  5C4C A;  4HOC A;  4CJB A;  3OGZ A;  3Q80 A;  4G3S A;  5FU8 A;  4J18 A;  1OQM B;  4O6N A;  4D0T A;  4B4G A;  5L6S A;  4MYB A;  1VH1 A;  2PX7 A;  3U2V A;  1TZF A;  4JIS A;  1IIM A;  5C1G A;  4Y63 A;  1ZDF A;  2Y4J A;  1VM8 A;  3V0M A;  4EEO A;  1FR9 A;  1HM0 A;  1W57 A;  1WT2 A;  2X65 A;  1O0R A;  3V0Q A;  4Y64 A;  3RSB A;  2OI5 A;  3SXA A;  5CMJ A;  2PA4 A;  1R7X A;  2FYB A;  2RJ7 A;  2GGO A;  1GWV A;  1LZ7 A;  1VIC A;  5C3A A;  4DEC A;  1FXO A;  1W55 A;  2BO6 A;  2OEG A;  5EIY A;  2X5S A;  4LW6 A;  2AGD A;  1PZT A;  3U2X A;  1FRW A;  5C4B A;  1R7Y A;  3CKQ A;  2X60 A;  1ZJ1 A;  4MIX A;  5D92 A;  1G3L A;  4FRQ A;  3ST8 A;  1HJJ A;  2WVM A;  1FOA A;  1VZT A;  2ZU7 A;  1XHB A;  4KRV A;  2X5Z A;  3F1C A;  4KT7 A;  2FYD B;  4P00 A;  2YES A;  5AJP A;  4Y7T A;  1R82 A;  1K4V A;  3K8E A;  1H7Q A;  3FOQ A;  1TVY A;  4CJC A;  1WT3 A;  1INJ A;  1O7O A;  4KPZ A;  2RJ0 A;  3DJ4 A;  1JVD A;  4KC1 A;  4KNR A;  2ICX A;  2PGV A;  1YP3 A;  2OI7 A;  3K8D A;  1HV9 A;  2RJ9 A;  3V0P A;  2Z86 A;  3CGX A;  3HL3 A;  2AEC A;  1YP2 A;  4HO5 A;  3SXC A;  1ZCT A;  4O6M A;  3E26 A;  3T7O A;  2JCK A;  2I7B A;  4EEA A;  3FWW A;  3JTJ A;  1SS9 A;  1H7E A;  1H4C A;  1HJL A;  3O3P A;  3USR A;  1HM8 A;  1FGX A;  4HG6 A;  4FRH A;  4D48 A;  3U2W A;  1H7G A;  2UX8 A;  1VH3 A;  1ON6 A;  4IRQ A;  3U2T A;  5C48 A;  1ZCV A;  2WGZ A;  1QWJ A;  4L41 C;  2VFZ A;  1S4O A;  3TQD A;  1G8O A;  1R7U A;  1NQI B;  4FRL A;  2AM4 A;  1G9R A;  1FO8 A;  5CMH A;  3RMW A;  1ZI3 A;  2YCM A;  4KQL A;  4ASJ A;  2OEF A;  2XWL A;  1FGG A;  1ZJ0 A;  1FZW A;  4FCU A;  4Y7U A;  4B4B A;  2W0V A;  2P72 A;  4AYJ A;  4NAN A;  2VD4 A;  4HO0 A;  1H4D A;  4HO3 A;  3POL A;  5AJN A;  1LZ0 A;  3V0L A;  3RMV A;  3JUK A;  1ZI5 A;  1ZJ3 A;  2YQJ A;  2D7I A;  1QG8 A;  3U2U A;  3CKN A;  2Z87 A;  1JV3 A;  4R7P A;  4KC2 A;  3ZLK A;  2P6W A;  1FR8 A;  1H5R A;  1WT1 A;  5C8R A;  3EE5 A;  1GWW A;  4HCQ A;  5IDS A;  2AM3 A;  4FRA A;  2V0L A;  2YC5 A;  4FQW A;  3I0C A;  3D5N A;  2D0J A;  3CKV A;  2RIX A;  1LZJ A;  2BO7 A;  3F1Y A;  1NHE B;  1ZCU A;  2V0J A;  2AH9 A;  2YQS A;  5FV9 A;  4FRB A;  5C36 A;  3T7N A;  3ZGF A;  1JVG A;  3OH2 A;  1R81 A;  1G0R A;  2RIT A;  4D11 C;  4FRP A;  4B4M A;  3I0F A;  3IOJ A;  3KIA A;  3USQ A;  2Y4K A;  5C47 A;  2XWM A;  3PKP A;  3E25 A;  1I52 A;  4UEG A;  2WE9 A;  4FIX A;  1H5S B;  4K6R A;  4NAL A;  3R3I A;  4LW3 A;  4E1K A;  2VSI A;  1H5S D;  2RJ1 A;  4DDZ A;  5BXC A;  2JCL A;  2A8W A;  4B3U A;  1LL2 A;  2O1F A;  4B5B A;  3I0G A;  4Y7F A;  4FCE A;  2RJ8 A;  1MP4 A;  3ZF8 A;  2P73 A;  1G23 A;  1ZJ2 A;  5FTS A;  5JQQ A;  1JYK A;  3SXB A;  1QGS A;  3SX7 A;  1H3M A;  4KNX A;  1R80 A;  3D8V A;  2O1G A;  2NXV A;  2YC3 A;  3SXE A;  1MP5 A;  2APC A;  2GGQ A;  5AJO A;  4D0Z A;  5DDV A;  2XMH A;  2W0W A;  4EEM A;  4Y6N A;  1FWY A;  2ZU9 A;  2XME A;  1R7V A;  3I0I X;  1PZY B;  4KC4 A;  1ZI1 A;  5I1F A;  2QH5 A;  1OMZ A;  1GQC A;  2C0N A;  3JUJ A;  4M4K A;  1HM9 A;  3OH3 A;  4EE5 A;  4Y7V A;  2VS4 A;  4HO6 A;  1G95 A;  1ZJO A;  1LL3 A;  1H7H A;  2XWN A;  1VZX A;  3IOI A;  5FUH A;  2RIY A;  1V82 A;  5C1L A;  2YQC A;  4AC3 A;  1ZCY A;  1H5T B;  3PKQ A;  2VK9 A;  5EJ1 A;  4D11 A;  5CQO A;  5C38 A;  2BO8 A;  3IOH A;  3Q7U A;  4B42 A;  2RJ5 A;  3CU0 A;  4ASY A;  1H7T A;  3SX5 A;  4FIY A;  2RIZ A;  3U0Y A;  3Q4S A;  4NAI A;  3OAM A;  1LZI A;  2BO4 A;  3OH1 A;  5CMF X;  4CVH A;  1INI A;  1ZIZ A;  3I0J A;  2V0I A;  2PGY A;  3CKJ A;  1WVC A;  3OH4 A;  1W77 A;  1E5K A;  1NMM B;  4XWI A;  2RJ4 A;  2QKX A;  1FO9 A;  5J49 A;  2ZU8 A;  2VS5 A;  2Y4L A;  4BMA A;  4M28 A;  3I0H A;  2WVL A;  1O7Q A;  5HS2 A;  4HO2 A;  4ECM A;  3BCV A;  3T7M A;  4FRO A;  2Y7A A;  2A8U A;  3QVB A;  1O23 B;  2FFU A;  3I0E A;  5CQL X;  2CU2 A;  1KWS A;  5C3B A;  1H5S C;  3OH0 A;  1TW1 A;  1EYR A;  3V0N A;  5C49 A;  3SPT A;  1TW5 A;  3V8Z A;  2J0B A;  4EE3 A;  1MC3 A;  3V91 A;  2V0H A;  4ARW A;  5C4F A;  4AAW A;  3PNN A;  2WVK A;  2FYC B;  4Q7C A;  4P02 A;  2JCO A;  3U0X A;  5CMI A;  1V84 A;  3SXG A;  2Q4J A;  2D7R A;  4C2S A;  5FYE A;  1ZHJ A;  4FRE A;  3I0L A;  5CMG X;  4FRD A;  2DPW A;  2E8B A;  4G87 A;  1G1L A;  2JCJ A;  1YP4 A;  3N9W A;  1VZU A;  3TZT A;  1V83 A;  1VGW A;  4HO9 A;  4AYL A;  1JYL A;  4B2X A;  4HO8 A;  5DDT A;  1WSZ A;  4BQH A;  1OMX A;  4YS8 A;  3GUE A;  3V90 A;  1G93 A;  1LL0 A;  3NGW A;  3V8Y A;  5C1H A;  2WEE A;  4DE7 A;  1GA8 A;  1GQ9 A;  2I5E A;  3CKO A;  4G3Q A;  1ZDG A;  2AES A;  2FYA A;  4B2W A;  2FY7 A;  5CQN X;  2QGI A;  2VXL A;  2O1H A;  1VGT A;  1NWG B;  2VS3 A;  4IRP A;  2RJ6 A;  3R2W A;  5D91 A;  2AM5 A;  1S4N A;  1NF5 B;  3ZLL A;  1H5S A;  2Y4M A;  1ZI4 A;  4HO4 A;  5C3D A;  3OKR A;  4EEG A;  1H7L A;  2MZB A;  1H7F A;  4Y6U A;  3I0D A;  1GX4 A;  4M2B A;  2J0A A;  1H4E A;  4KPX A;  1IIN A;  1S4P A;  3D98 A;  1FG5 N;  3SX3 A;  4EVW A;  4EE4 A;  2WAW A;  4G3P A;  1LVW A;  5CQP A;  3ZGG A;  1YRO B;  1H5R B;  1EZI A;  4KXO A;  5IDT A;  2OI6 A;  1ZJP A;  2FFV A;  2Y6P A;  5CQM X;  1ON8 A;  3SX8 A;  4CJ8 A;  1R7T A;  4Y7G A;  4JD0 A;  2VSH A;  2I5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...