3EE5A

Crystal structure of human m340h-beta1,4-galactosyltransferase-i (m340h-b4gal-t1) in complex with glcnac-beta1,3-gal-beta-naphthalenemethanol
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Deoxygenated Disaccharide Analogs as Specific Inhibitors of {beta}1-4-Galactosyltransferase 1 and Selectin-mediated Tumor Metastasis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3ee5A00
3OC9A 4EEGA 1FR9A 1H4CA 1Z90A 1FR8A 4D0ZA 1OMXA 5FV9A 5IDTA 3V90A 4D11A 4KNXA 1R7XA 1HM0A 4NALA 4EE4A 2Y4MA 3Q80A 1S4PA 1NHEB 1GX4A 3BCVA 1VGTA 2RIXA 1JYKA 5FYEA 2XWMA 1GQ9A 1S4NA 4HO0A 5C36A 2VS4A 3USRA 1ZDGA 2QGIA 3EE5A 1LZJA 4Y7FA 4Y63A 1I52A 1R81A 2VSHA 2YQHA 5CMHA 2PGVA 2AGDA 3I0HA 2AM5A 1IIMA 5C4DA 2Y4LA 3OH1A 1FWYA 2RJ5A 3JUJA 4Y64A 1FG5N 4M2BA 2I5KA 4NANA 1QGQA 1ZDFA 3OH4A 5HS2A 1O0RA 1R7UA 1LL0A 2BO4A 2O1GA 1H7LA 4FRDA 4KPZA 4DE7A 3V0OA 2PA4A 3SXAA 1YP4A 4CJCA 2WE9A 1H4EA 3CKJA 5IDSA 4D11C 2W0WA 1H7HA 3R3IA 2WAWA 5DDTA 3F1CA 1LL2A 1H7QA 4DDZA 5C8RA 2W0VA 4K6RA 3KIAA 2V0IA 4KQLA 1G93A 3OH2A 3HL3A 3OH0A 5FTSA 1OMZA 2OEGA 2RIYA 1XHBA 5CQNX 4JISA 2P6WA 1G9RA 2WEEA 1VGZA 2O1FA 5AJOA 2I5EA 4CJ8A 4NAKA 1VICA 1FGXA 1VGUA 4MNDA 1NF5B 1R7VA 1HJJA 1JVGA 1YP3A 2I7BA 4FRLA 1G3LA 3D98A 4P00A 4HO6A 5C3AA 5DDVA 2AH9A 3DJ4A 3K8EA 2Y4JA 1ZCVA 3T7MA 1GWVA 3CGXA 2JCJA 3F1YA 1G8OA 4EE5A 2OI7A 1WT1A 4KC4A 2MZBA 4B4BA 4HO3A 3V91A 3OAMA 3ZLKA 3T7OA 2BO8A 5EJZA 2Z87A 4FREA 4AAWA 2AM3A 1G1LA 5C4FA 4AYLA 5CMFX 2QH5A 1QG8A 4Y9XA 1LZ7A 1VPAA 2RJ8A 1LL3A 4M2AA 5CQPA 2X65A 3U2XA 4GBPA 4FQWA 2VS3A 1LZIA 1FZWA 1TW1A 2WVLA 4LW3A 1FRWA 3Q7UA 1H5RA 3I0FA 2AECA 4CVHA 3ZF8A 4Y7TA 4FROA 1V82A 1V84A 2FYBA 2PX7A 1W55A 5FTVA 3I0GA 1ZCUA 4EVWA 3RMVA 3V0MA 1W77A 3ST8A 5CQOA 1VGWA 5BXCA 5C4BA 1ZI4A 1H7GA 2FYCB 2RJ1A 1G97A 4D0TA 3PKPA 1YROB 5J49A 1H7FA 1ON8A 1ZJ3A 5JQQA 2AM4A 4G3SA 4FCUA 1MP3A 2ICXA 4DECA 4KT7A 1FO8A 2RJ7A 1GA8A 3U2WA 4BMAA 4L41C 2D7RA 1H5TA 4HO4A 4KC2A 3SXEA 1G2VA 2FY7A 1MP4A 2FYAA 1VZXA 1H5SA 3TQDA 2UX8A 5CMGX 4B2WA 5C3DA 1HJLA 3I0JA 2YC5A 5FU0A 1WT0A 4FRHA 4Y6NA 1H4DA 3NGWA 4ASYA 2CU2A 2YQCA 1EYRA 4ASJA 3V0PA 1YP2A 1FO9A 1ZCTA 1G0RA 4KNRA 4EE3A 2VXLA 2D7IA 1INJA 3SX5A 4KXOA 5C3BA 3JUKA 4B3UA 2FFUA 1VH1A 5EJ1A 2YCMA 3R2WA 4FRMA 2Y7AA 1GX0A 3E25A 5FUHA 3IOJA 1INIA 1E5KA 2V0JA 1MP5A 1O23B 5CQMX 3V8ZA 3PKQA 1FXOA 1LZ0A 1VZTA 1R80A 1H5RB 3V0NA 1G95A 1SS9A 3U2VA 2V0LA 4FRPA 2VS5A 3CKOA 1H5SC 4P02A 2YESA 5CMIA 2RJ6A 5EIYA 4M28A 2P73A 3I0CA 4J18A 1VM8A 1VH3A 2V0KA 5C47A 4JD0A 4HO2A 3ZGFA 3D5NA 3CU0A 1NKHB 2ZU9A 3ZLLA 2VSIA 3DK5A 2E8BA 4M4KA 2O1HA 1HV9A 3I0DA 2WVMA 1H5TB 4HCQA 2Z86A 5CMJA 1NMMB 2JCLA 3SXBA 4BQHA 1PZYB 3TZTA 1H7TA 4Y7VA 3QVBA 1R7TA 1H5SB 2JCOA 4R7PA 3U2UA 4IRPA 4XWIA 4B4GA 3ZGGA 3O3PA 1LVWA 4B5BA 5C4EA 1TW5A 3SX3A 1OQMB 2RJ9A 4C2SA 1NWGB 1ZI5A 3SXCA 1ZI3A 3U2TA 2WVKA 4HO5A 4LW6A 5C1LA 2AE7A 1FOAA 2PGYA 3K8DA 1K4VA 1O7OA 3I0KA 1V83A 3RMWA 3U0XA 2GGOA 1WVCA 2ZU7A 3V8YA 1O7QA 2VFZA 1PZTA 3IOIA 3U0YA 2OI6A 4KPXA 1JYLA 5C1HA 4FRAA 2ZU8A 3OGZA 3I0LA 2Y4KA 1NQIB 2Y6PA 1R7YA 2DPWA 1G23A 2FFVA 1KWSA 4IRQA 4UEGA 4G3QA 3POLA 3JTJA 4AYJA 4B42A 1ZJ1A 2YQJA 2VXMA 3V0LA 2A8UA 4B4MA 3RSBA 1QWJA 1FGGA 2X5SA 3V0QA 3SPTA 4HO9A 2NXVA 3T7NA 2VD4A 1W57A 3CKQA 2OI5A 2RITA 3N9WA 4HOCA 1QGSA 4ECMA 1GQCA 4Y7GA 4NAIA 5AJPA 1GWWA 1VZUA 1S4OA 2QKXA 2APCA 4HG6A 3SXGA 4FRQA 3SX8A 1ON6A 1WT3A 3D8VA 4FRBA 1WT2A 2XMHA 2XWLA 2JCKA 3OKRA 2OEFA 2AESA 1JV3A 1ZCYA 2YC3A 5C1GA 1FXJA 3OH3A 3I0EA 1ZJPA 4E1KA 3GUEA 3IOHA 3SX7A 2FYDB 1H7EA 1ZHJA 2BO7A 2RIZA 3CKNA 3CKVA 5CQLX 1ZJ2A 2V0HA 4KC1A 4KRVA 2A8WA 5L6VA 2D0JA 3E26A 4ZDQA 5C4CA 1JVDA 3BRKX 1EZIA 2YQSA 5C38A 4EEMA 5C48A 1TZFA 4HO8A 4Y7UA 1MC3A 2WGZA 1JV1A 4YS8A 2X60A 2BO6A 4Y62A 4FCEA 3USQA 3FOQA 1ZJOA 5I1FA 5C49A 2Q4JA 3FWWA 5L6SA 3I0IX 3LW6A 4ARWA 2RJ0A 2GGQA 2XWNA 3Q4SA 4EEOA 2E3DA 3PNNA 1ZI1A 5FU8A 1HM8A 4G3PA 1H5SD 1R82A 1HM9A 2XMEA 1ZJ0A 1H3MA 3DUVA 4Y6UA 4B2XA 4CJBA 2RJ4A 1WSZA 4AC3A 4MYBA 2P72A 1IINA 2X5ZA 2ICYA 1TVYA 4EEAA 1XZ6A 5IFYA 4G87A 1ZIZA 4D48A 5AJNA 3SXDA
chains in the Genus database with same CATH superfamily
3OC9A 4EEGA 1FR9A 1H4CA 1Z90A 1FR8A 4D0ZA 1OMXA 5FV9A 5IDTA 3V90A 4D11A 4KNXA 1R7XA 1HM0A 4NALA 4EE4A 2Y4MA 3Q80A 1S4PA 1NHEB 1GX4A 3BCVA 1VGTA 2RIXA 1JYKA 5FYEA 2XWMA 1GQ9A 1S4NA 4HO0A 5C36A 2VS4A 3USRA 1ZDGA 2QGIA 3EE5A 1LZJA 4Y7FA 4Y63A 1I52A 1R81A 2VSHA 2YQHA 5CMHA 2PGVA 2AGDA 3I0HA 2AM5A 1IIMA 5C4DA 2Y4LA 3OH1A 1FWYA 2RJ5A 3JUJA 4Y64A 1FG5N 4M2BA 2I5KA 4NANA 1QGQA 1ZDFA 3OH4A 5HS2A 1O0RA 1R7UA 1LL0A 2BO4A 2O1GA 1H7LA 4FRDA 4KPZA 4DE7A 3V0OA 2PA4A 3SXAA 5D92A 1YP4A 4CJCA 2WE9A 1H4EA 3CKJA 5IDSA 4D11C 2W0WA 1H7HA 3R3IA 2WAWA 5DDTA 3F1CA 1LL2A 1H7QA 4DDZA 5C8RA 2W0VA 4K6RA 3KIAA 2V0IA 4KQLA 1G93A 3OH2A 3HL3A 3OH0A 5FTSA 1OMZA 2OEGA 2RIYA 1XHBA 5CQNX 4JISA 2P6WA 1G9RA 2WEEA 1VGZA 2O1FA 5AJOA 2I5EA 4CJ8A 4NAKA 1VICA 1FGXA 1VGUA 4MNDA 1NF5B 1R7VA 1HJJA 1JVGA 1YP3A 2I7BA 4FRLA 1G3LA 3D98A 4P00A 4HO6A 5C3AA 5DDVA 2AH9A 3DJ4A 3K8EA 2Y4JA 1ZCVA 3T7MA 1GWVA 3CGXA 2JCJA 3F1YA 1G8OA 4EE5A 2OI7A 1WT1A 4KC4A 2MZBA 4B4BA 4HO3A 3V91A 3OAMA 3ZLKA 3T7OA 2BO8A 5EJZA 2Z87A 4FREA 4AAWA 2AM3A 1G1LA 5C4FA 4AYLA 5CMFX 2J0AA 2QH5A 1QG8A 4Y9XA 1LZ7A 1VPAA 2RJ8A 1LL3A 4M2AA 5CQPA 2X65A 3U2XA 4GBPA 4FQWA 2VS3A 1LZIA 1FZWA 1TW1A 2WVLA 4LW3A 1FRWA 3Q7UA 1H5RA 3I0FA 2AECA 4MIXA 4CVHA 3ZF8A 4Y7TA 4FROA 1V82A 1V84A 2FYBA 2PX7A 1W55A 5FTVA 3I0GA 1ZCUA 4EVWA 3RMVA 3V0MA 1W77A 3ST8A 5CQOA 1VGWA 5BXCA 5C4BA 1ZI4A 1H7GA 2FYCB 2RJ1A 1G97A 4D0TA 2J0BA 1YROB 3PKPA 5J49A 1H7FA 1ON8A 1ZJ3A 5JQQA 2AM4A 4G3SA 4FCUA 1MP3A 2ICXA 4DECA 4KT7A 1FO8A 2RJ7A 1GA8A 3U2WA 4BMAA 4L41C 2D7RA 1H5TA 4HO4A 4KC2A 3SXEA 1G2VA 2FY7A 1MP4A 2FYAA 1VZXA 1H5SA 3TQDA 2UX8A 5CMGX 4B2WA 5C3DA 1HJLA 3I0JA 2YC5A 5FU0A 1WT0A 4FRHA 4Y6NA 1H4DA 3NGWA 4ASYA 2CU2A 2YQCA 1EYRA 4ASJA 3V0PA 1YP2A 1FO9A 1ZCTA 1G0RA 4KNRA 4EE3A 2VXLA 2D7IA 1INJA 3SX5A 4KXOA 5C3BA 3JUKA 4B3UA 2FFUA 5D91A 1VH1A 5EJ1A 2YCMA 3R2WA 4FRMA 2Y7AA 1GX0A 3E25A 4FIYA 5FUHA 3IOJA 1INIA 4FIXA 1E5KA 2V0JA 1MP5A 1O23B 5CQMX 3V8ZA 3PKQA 1FXOA 1LZ0A 1VZTA 1R80A 1H5RB 3V0NA 1G95A 1SS9A 3U2VA 2V0LA 4FRPA 2VS5A 3CKOA 1H5SC 4P02A 2YESA 5CMIA 2RJ6A 5EIYA 4M28A 2C0NA 2P73A 3I0CA 1VM8A 4J18A 1VH3A 2V0KA 5C47A 4JD0A 4HO2A 3ZGFA 3D5NA 3CU0A 1NKHB 2ZU9A 3ZLLA 2VSIA 3DK5A 2E8BA 4M4KA 2O1HA 1HV9A 3I0DA 2WVMA 1H5TB 4HCQA 2Z86A 5CMJA 1NMMB 2JCLA 3SXBA 4BQHA 1PZYB 3TZTA 1H7TA 4Y7VA 3QVBA 1R7TA 1H5SB 2JCOA 4R7PA 3U2UA 4IRPA 4XWIA 4B4GA 3ZGGA 3O3PA 1LVWA 4B5BA 5C4EA 1TW5A 3SX3A 1OQMB 2RJ9A 4C2SA 1NWGB 1ZI5A 3SXCA 1ZI3A 3U2TA 2WVKA 4HO5A 4LW6A 5C1LA 2AE7A 1FOAA 2PGYA 3K8DA 1K4VA 1O7OA 3I0KA 1V83A 3RMWA 3U0XA 2GGOA 1WVCA 2ZU7A 3V8YA 1O7QA 2VFZA 1PZTA 3IOIA 3U0YA 2OI6A 4KPXA 1JYLA 5C1HA 2VK9A 4FRAA 2ZU8A 3OGZA 3I0LA 2Y4KA 1NQIB 4Q7CA 2Y6PA 1R7YA 2DPWA 1G23A 2FFVA 1KWSA 4IRQA 4UEGA 4G3QA 3POLA 3JTJA 4AYJA 4B42A 1ZJ1A 2YQJA 2VXMA 3V0LA 2A8UA 4B4MA 3RSBA 1QWJA 1FGGA 2X5SA 3V0QA 3SPTA 4HO9A 2NXVA 3T7NA 2VD4A 1W57A 3CKQA 2OI5A 2RITA 3N9WA 4HOCA 1QGSA 4ECMA 1GQCA 4Y7GA 4NAIA 5AJPA 1GWWA 1VZUA 1S4OA 2QKXA 2APCA 4HG6A 3SXGA 4FRQA 3SX8A 1ON6A 1WT3A 3D8VA 4FRBA 4O6MA 1WT2A 2XMHA 2XWLA 2JCKA 3OKRA 2OEFA 2AESA 1JV3A 1ZCYA 2YC3A 5C1GA 1FXJA 4O6NA 3OH3A 3I0EA 1ZJPA 4E1KA 3GUEA 3IOHA 3SX7A 2FYDB 1H7EA 1ZHJA 2BO7A 2RIZA 3CKNA 3CKVA 5CQLX 1ZJ2A 2V0HA 4KC1A 4KRVA 2A8WA 5L6VA 2D0JA 3E26A 4ZDQA 5C4CA 1JVDA 3BRKX 1EZIA 2YQSA 5C38A 4EEMA 5C48A 1TZFA 4HO8A 4Y7UA 1MC3A 2WGZA 1JV1A 4YS8A 2X60A 2BO6A 4Y62A 4FCEA 3USQA 3FOQA 1ZJOA 5I1FA 5C49A 2Q4JA 3FWWA 5L6SA 3I0IX 3LW6A 4ARWA 2RJ0A 2GGQA 2XWNA 3Q4SA 4EEOA 2E3DA 3PNNA 1ZI1A 5FU8A 1HM8A 4G3PA 1H5SD 1R82A 1HM9A 2XMEA 1ZJ0A 1H3MA 3DUVA 4Y6UA 4B2XA 4CJBA 2RJ4A 1WSZA 4AC3A 4MYBA 2P72A 1IINA 2X5ZA 2ICYA 1TVYA 4EEAA 1XZ6A 5IFYA 4G87A 1ZIZA 4D48A 5AJNA 3SXDA
chains in the Genus database with same CATH topology
3OC9A 4EEGA 1FR9A 1H4CA 1Z90A 1FR8A 4D0ZA 1OMXA 5FV9A 5IDTA 3V90A 4D11A 4KNXA 1R7XA 1HM0A 4NALA 4EE4A 2Y4MA 3Q80A 1S4PA 1NHEB 1GX4A 3BCVA 1VGTA 2RIXA 1JYKA 5FYEA 2XWMA 1GQ9A 1S4NA 4HO0A 5C36A 2VS4A 3USRA 1ZDGA 2QGIA 3EE5A 1LZJA 4Y7FA 4Y63A 1I52A 1R81A 2VSHA 2YQHA 5CMHA 2PGVA 2AGDA 3I0HA 2AM5A 1IIMA 5C4DA 2Y4LA 3OH1A 1FWYA 2RJ5A 3JUJA 4Y64A 1FG5N 4M2BA 2I5KA 4NANA 1QGQA 1ZDFA 3OH4A 5HS2A 1O0RA 1R7UA 1LL0A 2BO4A 2O1GA 1H7LA 4FRDA 4KPZA 4DE7A 3V0OA 2PA4A 3SXAA 5D92A 1YP4A 4CJCA 2WE9A 1H4EA 3CKJA 5IDSA 4D11C 2W0WA 1H7HA 3R3IA 2WAWA 5DDTA 3F1CA 1LL2A 1H7QA 4DDZA 5C8RA 2W0VA 4K6RA 3KIAA 2V0IA 4KQLA 1G93A 3OH2A 3HL3A 3OH0A 5FTSA 1OMZA 2OEGA 2RIYA 1XHBA 5CQNX 4JISA 2P6WA 1G9RA 2WEEA 1VGZA 2O1FA 5AJOA 2I5EA 4CJ8A 4NAKA 1VICA 1FGXA 1VGUA 4MNDA 1NF5B 1R7VA 1HJJA 1JVGA 1YP3A 2I7BA 4FRLA 1G3LA 3D98A 4P00A 4HO6A 5C3AA 5DDVA 2AH9A 3DJ4A 3K8EA 2Y4JA 1ZCVA 3T7MA 1GWVA 3CGXA 2JCJA 3F1YA 1G8OA 4EE5A 2OI7A 1WT1A 4KC4A 2MZBA 4B4BA 4HO3A 3V91A 3OAMA 3ZLKA 3T7OA 2BO8A 5EJZA 2Z87A 4FREA 4AAWA 2AM3A 1G1LA 5C4FA 4AYLA 5CMFX 2J0AA 2QH5A 1QG8A 4Y9XA 1LZ7A 1VPAA 2RJ8A 1LL3A 4M2AA 5CQPA 2X65A 3U2XA 4GBPA 4FQWA 2VS3A 1LZIA 1FZWA 1TW1A 2WVLA 4LW3A 1FRWA 3Q7UA 1H5RA 3I0FA 2AECA 4MIXA 4CVHA 3ZF8A 4Y7TA 4FROA 1V82A 1V84A 2FYBA 2PX7A 1W55A 5FTVA 3I0GA 1ZCUA 4EVWA 3RMVA 3V0MA 1W77A 3ST8A 5CQOA 1VGWA 5BXCA 5C4BA 1ZI4A 1H7GA 2FYCB 2RJ1A 1G97A 4D0TA 2J0BA 1YROB 3PKPA 5J49A 1H7FA 1ON8A 1ZJ3A 5JQQA 2AM4A 4G3SA 4FCUA 1MP3A 2ICXA 4DECA 4KT7A 1FO8A 2RJ7A 1GA8A 3U2WA 4BMAA 4L41C 2D7RA 1H5TA 4HO4A 4KC2A 3SXEA 1G2VA 2FY7A 1MP4A 2FYAA 1VZXA 1H5SA 3TQDA 2UX8A 5CMGX 4B2WA 5C3DA 1HJLA 3I0JA 2YC5A 5FU0A 1WT0A 4FRHA 4Y6NA 1H4DA 3NGWA 4ASYA 2CU2A 2YQCA 1EYRA 4ASJA 3V0PA 1YP2A 1FO9A 1ZCTA 1G0RA 4KNRA 4EE3A 2VXLA 2D7IA 1INJA 3SX5A 4KXOA 5C3BA 3JUKA 4B3UA 2FFUA 5D91A 1VH1A 5EJ1A 2YCMA 3R2WA 4FRMA 2Y7AA 1GX0A 3E25A 4FIYA 5FUHA 3IOJA 1INIA 4FIXA 1E5KA 2V0JA 1MP5A 1O23B 5CQMX 3V8ZA 3PKQA 1FXOA 1LZ0A 1VZTA 1R80A 1H5RB 3V0NA 1G95A 1SS9A 3U2VA 2V0LA 4FRPA 2VS5A 3CKOA 1H5SC 4P02A 2YESA 5CMIA 2RJ6A 5EIYA 4M28A 2C0NA 2P73A 3I0CA 1VM8A 4J18A 1VH3A 2V0KA 5C47A 4JD0A 4HO2A 3ZGFA 3D5NA 3CU0A 1NKHB 2ZU9A 3ZLLA 2VSIA 3DK5A 2E8BA 4M4KA 2O1HA 1HV9A 3I0DA 2WVMA 1H5TB 4HCQA 2Z86A 5CMJA 1NMMB 2JCLA 3SXBA 4BQHA 1PZYB 3TZTA 1H7TA 4Y7VA 3QVBA 1R7TA 1H5SB 2JCOA 4R7PA 3U2UA 4IRPA 4XWIA 4B4GA 3ZGGA 3O3PA 1LVWA 4B5BA 5C4EA 1TW5A 3SX3A 1OQMB 2RJ9A 4C2SA 1NWGB 1ZI5A 3SXCA 1ZI3A 3U2TA 2WVKA 4HO5A 4LW6A 5C1LA 2AE7A 1FOAA 2PGYA 3K8DA 1K4VA 1O7OA 3I0KA 1V83A 3RMWA 3U0XA 2GGOA 1WVCA 2ZU7A 3V8YA 1O7QA 2VFZA 1PZTA 3IOIA 3U0YA 2OI6A 4KPXA 1JYLA 5C1HA 2VK9A 4FRAA 2ZU8A 3OGZA 3I0LA 2Y4KA 1NQIB 4Q7CA 2Y6PA 1R7YA 2DPWA 1G23A 2FFVA 1KWSA 4IRQA 4UEGA 4G3QA 3POLA 3JTJA 4AYJA 4B42A 1ZJ1A 2YQJA 2VXMA 3V0LA 2A8UA 4B4MA 3RSBA 1QWJA 1FGGA 2X5SA 3V0QA 3SPTA 4HO9A 2NXVA 3T7NA 2VD4A 1W57A 3CKQA 2OI5A 2RITA 3N9WA 4HOCA 1QGSA 4ECMA 1GQCA 4Y7GA 4NAIA 5AJPA 1GWWA 1VZUA 1S4OA 2QKXA 2APCA 4HG6A 3SXGA 4FRQA 3SX8A 1ON6A 1WT3A 3D8VA 4FRBA 4O6MA 1WT2A 2XMHA 2XWLA 2JCKA 3OKRA 2OEFA 2AESA 1JV3A 1ZCYA 2YC3A 5C1GA 1FXJA 4O6NA 3OH3A 3I0EA 1ZJPA 4E1KA 3GUEA 3IOHA 3SX7A 2FYDB 1H7EA 1ZHJA 2BO7A 2RIZA 3CKNA 3CKVA 5CQLX 1ZJ2A 2V0HA 4KC1A 4KRVA 2A8WA 5L6VA 2D0JA 3E26A 4ZDQA 5C4CA 1JVDA 3BRKX 1EZIA 2YQSA 5C38A 4EEMA 5C48A 1TZFA 4HO8A 4Y7UA 1MC3A 2WGZA 1JV1A 4YS8A 2X60A 2BO6A 4Y62A 4FCEA 3USQA 3FOQA 1ZJOA 5I1FA 5C49A 2Q4JA 3FWWA 5L6SA 3I0IX 3LW6A 4ARWA 2RJ0A 2GGQA 2XWNA 3Q4SA 4EEOA 2E3DA 3PNNA 1ZI1A 5FU8A 1HM8A 4G3PA 1H5SD 1R82A 1HM9A 2XMEA 1ZJ0A 1H3MA 3DUVA 4Y6UA 4B2XA 4CJBA 2RJ4A 1WSZA 4AC3A 4MYBA 2P72A 1IINA 2X5ZA 2ICYA 1TVYA 4EEAA 1XZ6A 5IFYA 4G87A 1ZIZA 4D48A 5AJNA 3SXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OC9 A;  4EEG A;  1FR9 A;  1H4C A;  1Z90 A;  1FR8 A;  4D0Z A;  1OMX A;  5FV9 A;  5IDT A;  3V90 A;  4D11 A;  4KNX A;  1R7X A;  1HM0 A;  4NAL A;  4EE4 A;  2Y4M A;  3Q80 A;  1S4P A;  1NHE B;  1GX4 A;  3BCV A;  1VGT A;  2RIX A;  1JYK A;  5FYE A;  2XWM A;  1GQ9 A;  1S4N A;  4HO0 A;  5C36 A;  2VS4 A;  3USR A;  1ZDG A;  2QGI A;  3EE5 A;  1LZJ A;  4Y7F A;  4Y63 A;  1I52 A;  1R81 A;  2VSH A;  2YQH A;  5CMH A;  2PGV A;  2AGD A;  3I0H A;  2AM5 A;  1IIM A;  5C4D A;  2Y4L A;  3OH1 A;  1FWY A;  2RJ5 A;  3JUJ A;  4Y64 A;  1FG5 N;  4M2B A;  2I5K A;  4NAN A;  1QGQ A;  1ZDF A;  3OH4 A;  5HS2 A;  1O0R A;  1R7U A;  1LL0 A;  2BO4 A;  2O1G A;  1H7L A;  4FRD A;  4KPZ A;  4DE7 A;  3V0O A;  2PA4 A;  3SXA A;  1YP4 A;  4CJC A;  2WE9 A;  1H4E A;  3CKJ A;  5IDS A;  4D11 C;  2W0W A;  1H7H A;  3R3I A;  2WAW A;  5DDT A;  3F1C A;  1LL2 A;  1H7Q A;  4DDZ A;  5C8R A;  2W0V A;  4K6R A;  3KIA A;  2V0I A;  4KQL A;  1G93 A;  3OH2 A;  3HL3 A;  3OH0 A;  5FTS A;  1OMZ A;  2OEG A;  2RIY A;  1XHB A;  5CQN X;  4JIS A;  2P6W A;  1G9R A;  2WEE A;  1VGZ A;  2O1F A;  5AJO A;  2I5E A;  4CJ8 A;  4NAK A;  1VIC A;  1FGX A;  1VGU A;  4MND A;  1NF5 B;  1R7V A;  1HJJ A;  1JVG A;  1YP3 A;  2I7B A;  4FRL A;  1G3L A;  3D98 A;  4P00 A;  4HO6 A;  5C3A A;  5DDV A;  2AH9 A;  3DJ4 A;  3K8E A;  2Y4J A;  1ZCV A;  3T7M A;  1GWV A;  3CGX A;  2JCJ A;  3F1Y A;  1G8O A;  4EE5 A;  2OI7 A;  1WT1 A;  4KC4 A;  2MZB A;  4B4B A;  4HO3 A;  3V91 A;  3OAM A;  3ZLK A;  3T7O A;  2BO8 A;  5EJZ A;  2Z87 A;  4FRE A;  4AAW A;  2AM3 A;  1G1L A;  5C4F A;  4AYL A;  5CMF X;  2QH5 A;  1QG8 A;  4Y9X A;  1LZ7 A;  1VPA A;  2RJ8 A;  1LL3 A;  4M2A A;  5CQP A;  2X65 A;  3U2X A;  4GBP A;  4FQW A;  2VS3 A;  1LZI A;  1FZW A;  1TW1 A;  2WVL A;  4LW3 A;  1FRW A;  3Q7U A;  1H5R A;  3I0F A;  2AEC A;  4CVH A;  3ZF8 A;  4Y7T A;  4FRO A;  1V82 A;  1V84 A;  2FYB A;  2PX7 A;  1W55 A;  5FTV A;  3I0G A;  1ZCU A;  4EVW A;  3RMV A;  3V0M A;  1W77 A;  3ST8 A;  5CQO A;  1VGW A;  5BXC A;  5C4B A;  1ZI4 A;  1H7G A;  2FYC B;  2RJ1 A;  1G97 A;  4D0T A;  3PKP A;  1YRO B;  5J49 A;  1H7F A;  1ON8 A;  1ZJ3 A;  5JQQ A;  2AM4 A;  4G3S A;  4FCU A;  1MP3 A;  2ICX A;  4DEC A;  4KT7 A;  1FO8 A;  2RJ7 A;  1GA8 A;  3U2W A;  4BMA A;  4L41 C;  2D7R A;  1H5T A;  4HO4 A;  4KC2 A;  3SXE A;  1G2V A;  2FY7 A;  1MP4 A;  2FYA A;  1VZX A;  1H5S A;  3TQD A;  2UX8 A;  5CMG X;  4B2W A;  5C3D A;  1HJL A;  3I0J A;  2YC5 A;  5FU0 A;  1WT0 A;  4FRH A;  4Y6N A;  1H4D A;  3NGW A;  4ASY A;  2CU2 A;  2YQC A;  1EYR A;  4ASJ A;  3V0P A;  1YP2 A;  1FO9 A;  1ZCT A;  1G0R A;  4KNR A;  4EE3 A;  2VXL A;  2D7I A;  1INJ A;  3SX5 A;  4KXO A;  5C3B A;  3JUK A;  4B3U A;  2FFU A;  1VH1 A;  5EJ1 A;  2YCM A;  3R2W A;  4FRM A;  2Y7A A;  1GX0 A;  3E25 A;  5FUH A;  3IOJ A;  1INI A;  1E5K A;  2V0J A;  1MP5 A;  1O23 B;  5CQM X;  3V8Z A;  3PKQ A;  1FXO A;  1LZ0 A;  1VZT A;  1R80 A;  1H5R B;  3V0N A;  1G95 A;  1SS9 A;  3U2V A;  2V0L A;  4FRP A;  2VS5 A;  3CKO A;  1H5S C;  4P02 A;  2YES A;  5CMI A;  2RJ6 A;  5EIY A;  4M28 A;  2P73 A;  3I0C A;  4J18 A;  1VM8 A;  1VH3 A;  2V0K A;  5C47 A;  4JD0 A;  4HO2 A;  3ZGF A;  3D5N A;  3CU0 A;  1NKH B;  2ZU9 A;  3ZLL A;  2VSI A;  3DK5 A;  2E8B A;  4M4K A;  2O1H A;  1HV9 A;  3I0D A;  2WVM A;  1H5T B;  4HCQ A;  2Z86 A;  5CMJ A;  1NMM B;  2JCL A;  3SXB A;  4BQH A;  1PZY B;  3TZT A;  1H7T A;  4Y7V A;  3QVB A;  1R7T A;  1H5S B;  2JCO A;  4R7P A;  3U2U A;  4IRP A;  4XWI A;  4B4G A;  3ZGG A;  3O3P A;  1LVW A;  4B5B A;  5C4E A;  1TW5 A;  3SX3 A;  1OQM B;  2RJ9 A;  4C2S A;  1NWG B;  1ZI5 A;  3SXC A;  1ZI3 A;  3U2T A;  2WVK A;  4HO5 A;  4LW6 A;  5C1L A;  2AE7 A;  1FOA A;  2PGY A;  3K8D A;  1K4V A;  1O7O A;  3I0K A;  1V83 A;  3RMW A;  3U0X A;  2GGO A;  1WVC A;  2ZU7 A;  3V8Y A;  1O7Q A;  2VFZ A;  1PZT A;  3IOI A;  3U0Y A;  2OI6 A;  4KPX A;  1JYL A;  5C1H A;  4FRA A;  2ZU8 A;  3OGZ A;  3I0L A;  2Y4K A;  1NQI B;  2Y6P A;  1R7Y A;  2DPW A;  1G23 A;  2FFV A;  1KWS A;  4IRQ A;  4UEG A;  4G3Q A;  3POL A;  3JTJ A;  4AYJ A;  4B42 A;  1ZJ1 A;  2YQJ A;  2VXM A;  3V0L A;  2A8U A;  4B4M A;  3RSB A;  1QWJ A;  1FGG A;  2X5S A;  3V0Q A;  3SPT A;  4HO9 A;  2NXV A;  3T7N A;  2VD4 A;  1W57 A;  3CKQ A;  2OI5 A;  2RIT A;  3N9W A;  4HOC A;  1QGS A;  4ECM A;  1GQC A;  4Y7G A;  4NAI A;  5AJP A;  1GWW A;  1VZU A;  1S4O A;  2QKX A;  2APC A;  4HG6 A;  3SXG A;  4FRQ A;  3SX8 A;  1ON6 A;  1WT3 A;  3D8V A;  4FRB A;  1WT2 A;  2XMH A;  2XWL A;  2JCK A;  3OKR A;  2OEF A;  2AES A;  1JV3 A;  1ZCY A;  2YC3 A;  5C1G A;  1FXJ A;  3OH3 A;  3I0E A;  1ZJP A;  4E1K A;  3GUE A;  3IOH A;  3SX7 A;  2FYD B;  1H7E A;  1ZHJ A;  2BO7 A;  2RIZ A;  3CKN A;  3CKV A;  5CQL X;  1ZJ2 A;  2V0H A;  4KC1 A;  4KRV A;  2A8W A;  5L6V A;  2D0J A;  3E26 A;  4ZDQ A;  5C4C A;  1JVD A;  3BRK X;  1EZI A;  2YQS A;  5C38 A;  4EEM A;  5C48 A;  1TZF A;  4HO8 A;  4Y7U A;  1MC3 A;  2WGZ A;  1JV1 A;  4YS8 A;  2X60 A;  2BO6 A;  4Y62 A;  4FCE A;  3USQ A;  3FOQ A;  1ZJO A;  5I1F A;  5C49 A;  2Q4J A;  3FWW A;  5L6S A;  3I0I X;  3LW6 A;  4ARW A;  2RJ0 A;  2GGQ A;  2XWN A;  3Q4S A;  4EEO A;  2E3D A;  3PNN A;  1ZI1 A;  5FU8 A;  1HM8 A;  4G3P A;  1H5S D;  1R82 A;  1HM9 A;  2XME A;  1ZJ0 A;  1H3M A;  3DUV A;  4Y6U A;  4B2X A;  4CJB A;  2RJ4 A;  1WSZ A;  4AC3 A;  4MYB A;  2P72 A;  1IIN A;  2X5Z A;  2ICY A;  1TVY A;  4EEA A;  1XZ6 A;  5IFY A;  4G87 A;  1ZIZ A;  4D48 A;  5AJN A;  3SXD A; 
#chains in the Genus database with same CATH topology
 3OC9 A;  4EEG A;  1FR9 A;  1H4C A;  1Z90 A;  1FR8 A;  4D0Z A;  1OMX A;  5FV9 A;  5IDT A;  3V90 A;  4D11 A;  4KNX A;  1R7X A;  1HM0 A;  4NAL A;  4EE4 A;  2Y4M A;  3Q80 A;  1S4P A;  1NHE B;  1GX4 A;  3BCV A;  1VGT A;  2RIX A;  1JYK A;  5FYE A;  2XWM A;  1GQ9 A;  1S4N A;  4HO0 A;  5C36 A;  2VS4 A;  3USR A;  1ZDG A;  2QGI A;  3EE5 A;  1LZJ A;  4Y7F A;  4Y63 A;  1I52 A;  1R81 A;  2VSH A;  2YQH A;  5CMH A;  2PGV A;  2AGD A;  3I0H A;  2AM5 A;  1IIM A;  5C4D A;  2Y4L A;  3OH1 A;  1FWY A;  2RJ5 A;  3JUJ A;  4Y64 A;  1FG5 N;  4M2B A;  2I5K A;  4NAN A;  1QGQ A;  1ZDF A;  3OH4 A;  5HS2 A;  1O0R A;  1R7U A;  1LL0 A;  2BO4 A;  2O1G A;  1H7L A;  4FRD A;  4KPZ A;  4DE7 A;  3V0O A;  2PA4 A;  3SXA A;  5D92 A;  1YP4 A;  4CJC A;  2WE9 A;  1H4E A;  3CKJ A;  5IDS A;  4D11 C;  2W0W A;  1H7H A;  3R3I A;  2WAW A;  5DDT A;  3F1C A;  1LL2 A;  1H7Q A;  4DDZ A;  5C8R A;  2W0V A;  4K6R A;  3KIA A;  2V0I A;  4KQL A;  1G93 A;  3OH2 A;  3HL3 A;  3OH0 A;  5FTS A;  1OMZ A;  2OEG A;  2RIY A;  1XHB A;  5CQN X;  4JIS A;  2P6W A;  1G9R A;  2WEE A;  1VGZ A;  2O1F A;  5AJO A;  2I5E A;  4CJ8 A;  4NAK A;  1VIC A;  1FGX A;  1VGU A;  4MND A;  1NF5 B;  1R7V A;  1HJJ A;  1JVG A;  1YP3 A;  2I7B A;  4FRL A;  1G3L A;  3D98 A;  4P00 A;  4HO6 A;  5C3A A;  5DDV A;  2AH9 A;  3DJ4 A;  3K8E A;  2Y4J A;  1ZCV A;  3T7M A;  1GWV A;  3CGX A;  2JCJ A;  3F1Y A;  1G8O A;  4EE5 A;  2OI7 A;  1WT1 A;  4KC4 A;  2MZB A;  4B4B A;  4HO3 A;  3V91 A;  3OAM A;  3ZLK A;  3T7O A;  2BO8 A;  5EJZ A;  2Z87 A;  4FRE A;  4AAW A;  2AM3 A;  1G1L A;  5C4F A;  4AYL A;  5CMF X;  2J0A A;  2QH5 A;  1QG8 A;  4Y9X A;  1LZ7 A;  1VPA A;  2RJ8 A;  1LL3 A;  4M2A A;  5CQP A;  2X65 A;  3U2X A;  4GBP A;  4FQW A;  2VS3 A;  1LZI A;  1FZW A;  1TW1 A;  2WVL A;  4LW3 A;  1FRW A;  3Q7U A;  1H5R A;  3I0F A;  2AEC A;  4MIX A;  4CVH A;  3ZF8 A;  4Y7T A;  4FRO A;  1V82 A;  1V84 A;  2FYB A;  2PX7 A;  1W55 A;  5FTV A;  3I0G A;  1ZCU A;  4EVW A;  3RMV A;  3V0M A;  1W77 A;  3ST8 A;  5CQO A;  1VGW A;  5BXC A;  5C4B A;  1ZI4 A;  1H7G A;  2FYC B;  2RJ1 A;  1G97 A;  4D0T A;  2J0B A;  1YRO B;  3PKP A;  5J49 A;  1H7F A;  1ON8 A;  1ZJ3 A;  5JQQ A;  2AM4 A;  4G3S A;  4FCU A;  1MP3 A;  2ICX A;  4DEC A;  4KT7 A;  1FO8 A;  2RJ7 A;  1GA8 A;  3U2W A;  4BMA A;  4L41 C;  2D7R A;  1H5T A;  4HO4 A;  4KC2 A;  3SXE A;  1G2V A;  2FY7 A;  1MP4 A;  2FYA A;  1VZX A;  1H5S A;  3TQD A;  2UX8 A;  5CMG X;  4B2W A;  5C3D A;  1HJL A;  3I0J A;  2YC5 A;  5FU0 A;  1WT0 A;  4FRH A;  4Y6N A;  1H4D A;  3NGW A;  4ASY A;  2CU2 A;  2YQC A;  1EYR A;  4ASJ A;  3V0P A;  1YP2 A;  1FO9 A;  1ZCT A;  1G0R A;  4KNR A;  4EE3 A;  2VXL A;  2D7I A;  1INJ A;  3SX5 A;  4KXO A;  5C3B A;  3JUK A;  4B3U A;  2FFU A;  5D91 A;  1VH1 A;  5EJ1 A;  2YCM A;  3R2W A;  4FRM A;  2Y7A A;  1GX0 A;  3E25 A;  4FIY A;  5FUH A;  3IOJ A;  1INI A;  4FIX A;  1E5K A;  2V0J A;  1MP5 A;  1O23 B;  5CQM X;  3V8Z A;  3PKQ A;  1FXO A;  1LZ0 A;  1VZT A;  1R80 A;  1H5R B;  3V0N A;  1G95 A;  1SS9 A;  3U2V A;  2V0L A;  4FRP A;  2VS5 A;  3CKO A;  1H5S C;  4P02 A;  2YES A;  5CMI A;  2RJ6 A;  5EIY A;  4M28 A;  2C0N A;  2P73 A;  3I0C A;  1VM8 A;  4J18 A;  1VH3 A;  2V0K A;  5C47 A;  4JD0 A;  4HO2 A;  3ZGF A;  3D5N A;  3CU0 A;  1NKH B;  2ZU9 A;  3ZLL A;  2VSI A;  3DK5 A;  2E8B A;  4M4K A;  2O1H A;  1HV9 A;  3I0D A;  2WVM A;  1H5T B;  4HCQ A;  2Z86 A;  5CMJ A;  1NMM B;  2JCL A;  3SXB A;  4BQH A;  1PZY B;  3TZT A;  1H7T A;  4Y7V A;  3QVB A;  1R7T A;  1H5S B;  2JCO A;  4R7P A;  3U2U A;  4IRP A;  4XWI A;  4B4G A;  3ZGG A;  3O3P A;  1LVW A;  4B5B A;  5C4E A;  1TW5 A;  3SX3 A;  1OQM B;  2RJ9 A;  4C2S A;  1NWG B;  1ZI5 A;  3SXC A;  1ZI3 A;  3U2T A;  2WVK A;  4HO5 A;  4LW6 A;  5C1L A;  2AE7 A;  1FOA A;  2PGY A;  3K8D A;  1K4V A;  1O7O A;  3I0K A;  1V83 A;  3RMW A;  3U0X A;  2GGO A;  1WVC A;  2ZU7 A;  3V8Y A;  1O7Q A;  2VFZ A;  1PZT A;  3IOI A;  3U0Y A;  2OI6 A;  4KPX A;  1JYL A;  5C1H A;  2VK9 A;  4FRA A;  2ZU8 A;  3OGZ A;  3I0L A;  2Y4K A;  1NQI B;  4Q7C A;  2Y6P A;  1R7Y A;  2DPW A;  1G23 A;  2FFV A;  1KWS A;  4IRQ A;  4UEG A;  4G3Q A;  3POL A;  3JTJ A;  4AYJ A;  4B42 A;  1ZJ1 A;  2YQJ A;  2VXM A;  3V0L A;  2A8U A;  4B4M A;  3RSB A;  1QWJ A;  1FGG A;  2X5S A;  3V0Q A;  3SPT A;  4HO9 A;  2NXV A;  3T7N A;  2VD4 A;  1W57 A;  3CKQ A;  2OI5 A;  2RIT A;  3N9W A;  4HOC A;  1QGS A;  4ECM A;  1GQC A;  4Y7G A;  4NAI A;  5AJP A;  1GWW A;  1VZU A;  1S4O A;  2QKX A;  2APC A;  4HG6 A;  3SXG A;  4FRQ A;  3SX8 A;  1ON6 A;  1WT3 A;  3D8V A;  4FRB A;  4O6M A;  1WT2 A;  2XMH A;  2XWL A;  2JCK A;  3OKR A;  2OEF A;  2AES A;  1JV3 A;  1ZCY A;  2YC3 A;  5C1G A;  1FXJ A;  4O6N A;  3OH3 A;  3I0E A;  1ZJP A;  4E1K A;  3GUE A;  3IOH A;  3SX7 A;  2FYD B;  1H7E A;  1ZHJ A;  2BO7 A;  2RIZ A;  3CKN A;  3CKV A;  5CQL X;  1ZJ2 A;  2V0H A;  4KC1 A;  4KRV A;  2A8W A;  5L6V A;  2D0J A;  3E26 A;  4ZDQ A;  5C4C A;  1JVD A;  3BRK X;  1EZI A;  2YQS A;  5C38 A;  4EEM A;  5C48 A;  1TZF A;  4HO8 A;  4Y7U A;  1MC3 A;  2WGZ A;  1JV1 A;  4YS8 A;  2X60 A;  2BO6 A;  4Y62 A;  4FCE A;  3USQ A;  3FOQ A;  1ZJO A;  5I1F A;  5C49 A;  2Q4J A;  3FWW A;  5L6S A;  3I0I X;  3LW6 A;  4ARW A;  2RJ0 A;  2GGQ A;  2XWN A;  3Q4S A;  4EEO A;  2E3D A;  3PNN A;  1ZI1 A;  5FU8 A;  1HM8 A;  4G3P A;  1H5S D;  1R82 A;  1HM9 A;  2XME A;  1ZJ0 A;  1H3M A;  3DUV A;  4Y6U A;  4B2X A;  4CJB A;  2RJ4 A;  1WSZ A;  4AC3 A;  4MYB A;  2P72 A;  1IIN A;  2X5Z A;  2ICY A;  1TVY A;  4EEA A;  1XZ6 A;  5IFY A;  4G87 A;  1ZIZ A;  4D48 A;  5AJN A;  3SXD A; 
#chains in the Genus database with same CATH homology
 3OC9 A;  4EEG A;  1FR9 A;  1H4C A;  1Z90 A;  1FR8 A;  4D0Z A;  1OMX A;  5FV9 A;  5IDT A;  3V90 A;  4D11 A;  4KNX A;  1R7X A;  1HM0 A;  4NAL A;  4EE4 A;  2Y4M A;  3Q80 A;  1S4P A;  1NHE B;  1GX4 A;  3BCV A;  1VGT A;  2RIX A;  1JYK A;  5FYE A;  2XWM A;  1GQ9 A;  1S4N A;  4HO0 A;  5C36 A;  2VS4 A;  3USR A;  1ZDG A;  2QGI A;  3EE5 A;  1LZJ A;  4Y7F A;  4Y63 A;  1I52 A;  1R81 A;  2VSH A;  2YQH A;  5CMH A;  2PGV A;  2AGD A;  3I0H A;  2AM5 A;  1IIM A;  5C4D A;  2Y4L A;  3OH1 A;  1FWY A;  2RJ5 A;  3JUJ A;  4Y64 A;  1FG5 N;  4M2B A;  2I5K A;  4NAN A;  1QGQ A;  1ZDF A;  3OH4 A;  5HS2 A;  1O0R A;  1R7U A;  1LL0 A;  2BO4 A;  2O1G A;  1H7L A;  4FRD A;  4KPZ A;  4DE7 A;  3V0O A;  2PA4 A;  3SXA A;  5D92 A;  1YP4 A;  4CJC A;  2WE9 A;  1H4E A;  3CKJ A;  5IDS A;  4D11 C;  2W0W A;  1H7H A;  3R3I A;  2WAW A;  5DDT A;  3F1C A;  1LL2 A;  1H7Q A;  4DDZ A;  5C8R A;  2W0V A;  4K6R A;  3KIA A;  2V0I A;  4KQL A;  1G93 A;  3OH2 A;  3HL3 A;  3OH0 A;  5FTS A;  1OMZ A;  2OEG A;  2RIY A;  1XHB A;  5CQN X;  4JIS A;  2P6W A;  1G9R A;  2WEE A;  1VGZ A;  2O1F A;  5AJO A;  2I5E A;  4CJ8 A;  4NAK A;  1VIC A;  1FGX A;  1VGU A;  4MND A;  1NF5 B;  1R7V A;  1HJJ A;  1JVG A;  1YP3 A;  2I7B A;  4FRL A;  1G3L A;  3D98 A;  4P00 A;  4HO6 A;  5C3A A;  5DDV A;  2AH9 A;  3DJ4 A;  3K8E A;  2Y4J A;  1ZCV A;  3T7M A;  1GWV A;  3CGX A;  2JCJ A;  3F1Y A;  1G8O A;  4EE5 A;  2OI7 A;  1WT1 A;  4KC4 A;  2MZB A;  4B4B A;  4HO3 A;  3V91 A;  3OAM A;  3ZLK A;  3T7O A;  2BO8 A;  5EJZ A;  2Z87 A;  4FRE A;  4AAW A;  2AM3 A;  1G1L A;  5C4F A;  4AYL A;  5CMF X;  2J0A A;  2QH5 A;  1QG8 A;  4Y9X A;  1LZ7 A;  1VPA A;  2RJ8 A;  1LL3 A;  4M2A A;  5CQP A;  2X65 A;  3U2X A;  4GBP A;  4FQW A;  2VS3 A;  1LZI A;  1FZW A;  1TW1 A;  2WVL A;  4LW3 A;  1FRW A;  3Q7U A;  1H5R A;  3I0F A;  2AEC A;  4MIX A;  4CVH A;  3ZF8 A;  4Y7T A;  4FRO A;  1V82 A;  1V84 A;  2FYB A;  2PX7 A;  1W55 A;  5FTV A;  3I0G A;  1ZCU A;  4EVW A;  3RMV A;  3V0M A;  1W77 A;  3ST8 A;  5CQO A;  1VGW A;  5BXC A;  5C4B A;  1ZI4 A;  1H7G A;  2FYC B;  2RJ1 A;  1G97 A;  4D0T A;  2J0B A;  1YRO B;  3PKP A;  5J49 A;  1H7F A;  1ON8 A;  1ZJ3 A;  5JQQ A;  2AM4 A;  4G3S A;  4FCU A;  1MP3 A;  2ICX A;  4DEC A;  4KT7 A;  1FO8 A;  2RJ7 A;  1GA8 A;  3U2W A;  4BMA A;  4L41 C;  2D7R A;  1H5T A;  4HO4 A;  4KC2 A;  3SXE A;  1G2V A;  2FY7 A;  1MP4 A;  2FYA A;  1VZX A;  1H5S A;  3TQD A;  2UX8 A;  5CMG X;  4B2W A;  5C3D A;  1HJL A;  3I0J A;  2YC5 A;  5FU0 A;  1WT0 A;  4FRH A;  4Y6N A;  1H4D A;  3NGW A;  4ASY A;  2CU2 A;  2YQC A;  1EYR A;  4ASJ A;  3V0P A;  1YP2 A;  1FO9 A;  1ZCT A;  1G0R A;  4KNR A;  4EE3 A;  2VXL A;  2D7I A;  1INJ A;  3SX5 A;  4KXO A;  5C3B A;  3JUK A;  4B3U A;  2FFU A;  5D91 A;  1VH1 A;  5EJ1 A;  2YCM A;  3R2W A;  4FRM A;  2Y7A A;  1GX0 A;  3E25 A;  4FIY A;  5FUH A;  3IOJ A;  1INI A;  4FIX A;  1E5K A;  2V0J A;  1MP5 A;  1O23 B;  5CQM X;  3V8Z A;  3PKQ A;  1FXO A;  1LZ0 A;  1VZT A;  1R80 A;  1H5R B;  3V0N A;  1G95 A;  1SS9 A;  3U2V A;  2V0L A;  4FRP A;  2VS5 A;  3CKO A;  1H5S C;  4P02 A;  2YES A;  5CMI A;  2RJ6 A;  5EIY A;  4M28 A;  2C0N A;  2P73 A;  3I0C A;  1VM8 A;  4J18 A;  1VH3 A;  2V0K A;  5C47 A;  4JD0 A;  4HO2 A;  3ZGF A;  3D5N A;  3CU0 A;  1NKH B;  2ZU9 A;  3ZLL A;  2VSI A;  3DK5 A;  2E8B A;  4M4K A;  2O1H A;  1HV9 A;  3I0D A;  2WVM A;  1H5T B;  4HCQ A;  2Z86 A;  5CMJ A;  1NMM B;  2JCL A;  3SXB A;  4BQH A;  1PZY B;  3TZT A;  1H7T A;  4Y7V A;  3QVB A;  1R7T A;  1H5S B;  2JCO A;  4R7P A;  3U2U A;  4IRP A;  4XWI A;  4B4G A;  3ZGG A;  3O3P A;  1LVW A;  4B5B A;  5C4E A;  1TW5 A;  3SX3 A;  1OQM B;  2RJ9 A;  4C2S A;  1NWG B;  1ZI5 A;  3SXC A;  1ZI3 A;  3U2T A;  2WVK A;  4HO5 A;  4LW6 A;  5C1L A;  2AE7 A;  1FOA A;  2PGY A;  3K8D A;  1K4V A;  1O7O A;  3I0K A;  1V83 A;  3RMW A;  3U0X A;  2GGO A;  1WVC A;  2ZU7 A;  3V8Y A;  1O7Q A;  2VFZ A;  1PZT A;  3IOI A;  3U0Y A;  2OI6 A;  4KPX A;  1JYL A;  5C1H A;  2VK9 A;  4FRA A;  2ZU8 A;  3OGZ A;  3I0L A;  2Y4K A;  1NQI B;  4Q7C A;  2Y6P A;  1R7Y A;  2DPW A;  1G23 A;  2FFV A;  1KWS A;  4IRQ A;  4UEG A;  4G3Q A;  3POL A;  3JTJ A;  4AYJ A;  4B42 A;  1ZJ1 A;  2YQJ A;  2VXM A;  3V0L A;  2A8U A;  4B4M A;  3RSB A;  1QWJ A;  1FGG A;  2X5S A;  3V0Q A;  3SPT A;  4HO9 A;  2NXV A;  3T7N A;  2VD4 A;  1W57 A;  3CKQ A;  2OI5 A;  2RIT A;  3N9W A;  4HOC A;  1QGS A;  4ECM A;  1GQC A;  4Y7G A;  4NAI A;  5AJP A;  1GWW A;  1VZU A;  1S4O A;  2QKX A;  2APC A;  4HG6 A;  3SXG A;  4FRQ A;  3SX8 A;  1ON6 A;  1WT3 A;  3D8V A;  4FRB A;  4O6M A;  1WT2 A;  2XMH A;  2XWL A;  2JCK A;  3OKR A;  2OEF A;  2AES A;  1JV3 A;  1ZCY A;  2YC3 A;  5C1G A;  1FXJ A;  4O6N A;  3OH3 A;  3I0E A;  1ZJP A;  4E1K A;  3GUE A;  3IOH A;  3SX7 A;  2FYD B;  1H7E A;  1ZHJ A;  2BO7 A;  2RIZ A;  3CKN A;  3CKV A;  5CQL X;  1ZJ2 A;  2V0H A;  4KC1 A;  4KRV A;  2A8W A;  5L6V A;  2D0J A;  3E26 A;  4ZDQ A;  5C4C A;  1JVD A;  3BRK X;  1EZI A;  2YQS A;  5C38 A;  4EEM A;  5C48 A;  1TZF A;  4HO8 A;  4Y7U A;  1MC3 A;  2WGZ A;  1JV1 A;  4YS8 A;  2X60 A;  2BO6 A;  4Y62 A;  4FCE A;  3USQ A;  3FOQ A;  1ZJO A;  5I1F A;  5C49 A;  2Q4J A;  3FWW A;  5L6S A;  3I0I X;  3LW6 A;  4ARW A;  2RJ0 A;  2GGQ A;  2XWN A;  3Q4S A;  4EEO A;  2E3D A;  3PNN A;  1ZI1 A;  5FU8 A;  1HM8 A;  4G3P A;  1H5S D;  1R82 A;  1HM9 A;  2XME A;  1ZJ0 A;  1H3M A;  3DUV A;  4Y6U A;  4B2X A;  4CJB A;  2RJ4 A;  1WSZ A;  4AC3 A;  4MYB A;  2P72 A;  1IIN A;  2X5Z A;  2ICY A;  1TVY A;  4EEA A;  1XZ6 A;  5IFY A;  4G87 A;  1ZIZ A;  4D48 A;  5AJN A;  3SXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...