3EE5A

Crystal structure of human m340h-beta1,4-galactosyltransferase-i (m340h-b4gal-t1) in complex with glcnac-beta1,3-gal-beta-naphthalenemethanol
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Deoxygenated Disaccharide Analogs as Specific Inhibitors of {beta}1-4-Galactosyltransferase 1 and Selectin-mediated Tumor Metastasis
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3ee5A00
1H5SB 3IOJA 1G8OA 2OI6A 3OH4A 2A8UA 1GQCA 1ZJ1A 4FCUA 2Z87A 3U2VA 5FYEA 4ASJA 1O23B 1VGWA 1VPAA 3SX5A 1ZHJA 2XWNA 4UEGA 1JV3A 2AESA 3I0LA 1ZIZA 4CJBA 1GWVA 4FRLA 4HO0A 4Y7TA 2BO8A 1G23A 3TQDA 4EEGA 1TW5A 1LL2A 1OQMB 4KC1A 3IOIA 4G3PA 3V0NA 3PKQA 3OH2A 4B5BA 2VS5A 2RJ9A 1R80A 3SPTA 1FR9A 1V83A 5C4CA 2FYDB 3I0KA 3CU0A 2Y4KA 4DE7A 5BXCA 1MP4A 2P72A 3U2UA 2VSIA 2V0JA 2YC3A 3PNNA 3SX8A 4D11C 2RJ6A 2PA4A 3OAMA 4IRPA 1ON8A 1WSZA 3D8VA 4NANA 1GA8A 2JCLA 5FTSA 1ZCUA 1LL0A 3Q4SA 1HM9A 1PZYB 2BO6A 4AYJA 2YCMA 2AH9A 2YC5A 1H5SD 4Y7VA 2FYAA 3V90A 4D0TA 5L6VA 5FTVA 2VD4A 5CQOA 4EE5A 2FYBA 2GGQA 3I0GA 4FRDA 4NAIA 4G3SA 4HO6A 5FU8A 1IINA 4NAKA 3U0YA 5CQLX 1WT0A 4BQHA 1H4DA 1NQIB 5CQMX 1G2VA 4EE4A 4EEOA 3F1YA 2RJ0A 3RMWA 2E8BA 5C3DA 3I0HA 1YROB 1MP3A 3BRKX 1HV9A 5FV9A 1QGSA 1R7TA 5C4FA 4FRAA 3SXBA 3ZF8A 5C8RA 4FRHA 4CVHA 3V0OA 1H5TA 3JUJA 3D5NA 1FOAA 1ZJ2A 5C4EA 1YP2A 2ZU9A 4Y64A 2AM3A 2FYCB 1H5SC 2X60A 4HO3A 4IRQA 3I0DA 1NWGB 4KNRA 4FREA 3I0JA 2RIXA 4DDZA 5CMFX 1NKHB 1GX4A 2I5KA 4NALA 2X65A 4Y7UA 4LW3A 1ZI4A 2PGVA 3SX3A 2FY7A 1H7TA 4MYBA 1WT2A 4Y63A 1LL3A 3ZGFA 1I52A 3ZGGA 2XWLA 4FQWA 4G87A 3HL3A 2RIYA 1XZ6A 1FO8A 1VGUA 2Y4JA 4M4KA 2I7BA 5FU0A 3USQA 4FROA 2AM4A 1ON6A 2WVMA 3V8ZA 1FGXA 3PKPA 4P02A 5IDTA 1QG8A 1JV1A 5C47A 2ICXA 1VZTA 4Y9XA 2UX8A 3OH1A 5C1LA 2D7RA 2WVLA 2Z86A 3KIAA 5C49A 2I5EA 4KPXA 2V0KA 1G0RA 1NHEB 1JYKA 4HCQA 1LZ7A 1SS9A 1FWYA 3CKQA 2VFZA 3I0IX 4B4BA 3I0CA 4P00A 5C1GA 1TZFA 2WE9A 1JVGA 2BO7A 1H5TB 1VGZA 2XWMA 3BCVA 5AJOA 3POLA 3SXDA 3U0XA 3U2TA 3V0MA 5DDTA 1V82A 4ECMA 2O1HA 3O3PA 2X5SA 5C36A 5EJZA 3K8EA 3LW6A 2RIZA 1ZI5A 4Y7GA 1ZCVA 1XHBA 1S4NA 4FRPA 3V0PA 2JCJA 5C3AA 3Q80A 4E1KA 4J18A 2AECA 2YESA 1ZDFA 3OH3A 1FR8A 2RJ8A 4KNXA 1VZUA 3CKJA 2FFUA 3K8DA 1HM0A 2Y4MA 2X5ZA 2DPWA 3FWWA 3TZTA 2VXLA 3JUKA 4Y7FA 1GQ9A 2P6WA 2RJ7A 4G3QA 1VICA 1ZI1A 2ZU7A 3V0QA 5I1FA 2QH5A 3V91A 1INJA 1EYRA 1H4EA 1WVCA 5CQPA 5CMIA 5J49A 3E25A 2WEEA 1TW1A 3NGWA 1S4PA 4KRVA 3QVBA 3IOHA 1EZIA 3OKRA 5AJPA 2Y6PA 4YS8A 1H7GA 1GWWA 2PX7A 5CMGX 1YP4A 4XWIA 4JISA 4HO9A 4D0ZA 1O0RA 1H7HA 3Q7UA 4Y62A 3ZLLA 1JVDA 5CMJA 1WT3A 2RJ1A 2BO4A 2YQCA 5CQNX 2FFVA 2E3DA 1V84A 2ZU8A 5EIYA 2WGZA 1R82A 4EE3A 5C4BA 4M28A 4BMAA 5C38A 1HJLA 4LW6A 4FRMA 1R7VA 3RMVA 4C2SA 1G1LA 2APCA 1O7OA 1FRWA 3DK5A 1VH3A 2NXVA 4FCEA 3F1CA 2Y4LA 2Q4JA 4M2BA 3DUVA 4Y6UA 1G95A 1NF5B 3SXAA 1MC3A 4KC2A 1G97A 1ZJOA 4HOCA 4HG6A 4KPZA 4M2AA 1LVWA 1VGTA 4DECA 1H7FA 1E5KA 2WVKA 1R7UA 1LZ0A 2JCKA 4D11A 2VXMA 1ZJ0A 1VH1A 2P73A 3I0EA 3V8YA 4EEAA 3N9WA 4B2XA 2YQJA 4B2WA 1H4CA 1FGGA 1FZWA 2VS3A 2W0WA 5AJNA 1TVYA 4B3UA 1HM8A 1QGQA 1W55A 1YP3A 5L6SA 1R7YA 4B4GA 4KXOA 4ASYA 1G9RA 2A8WA 1H5RA 5JQQA 2WAWA 3R3IA 1WT1A 1HJJA 5HS2A 3E26A 2PGYA 1H7LA 3USRA 1QWJA 3U2XA 2AGDA 2V0IA 2OEFA 3GUEA 4MNDA 2GGOA 2JCOA 1IIMA 4CJ8A 2W0VA 2RITA 2OI5A 5IDSA 1H3MA 5C3BA 1FO9A 2VS4A 4CJCA 3U2WA 2ICYA 4R7PA 2V0HA 1ZCTA 4HO5A 1G3LA 4KC4A 2O1FA 2QGIA 3CKNA 1S4OA 1ZI3A 3FOQA 3T7MA 1OMZA 2QKXA 1R81A 1H5SA 1Z90A 2V0LA 3OGZA 2XMHA 5CMHA 1LZJA 3RSBA 3T7OA 3SXCA 2MZBA 1ZJPA 3V0LA 4KT7A 4AAWA 1K4VA 1MP5A 2D7IA 4K6RA 2XMEA 5C1HA 4HO4A 4Y6NA 4B42A 1NMMB 4HO2A 2O1GA 2RJ5A 4JD0A 3SXEA 1W77A 4D48A 4KQLA 3D98A 2AM5A 1O7QA 4ARWA 1INIA 2OEGA 1H7QA 4AYLA 4L41C 1G93A 3JTJA 1FG5N 1PZTA 1ZDGA 3SX7A 2Y7AA 3R2WA 2OI7A 3CKOA 1H5RB 1ZJ3A 4FRBA 4FRQA 4GBPA 3EE5A 4B4MA 1FXJA 3T7NA 1JYLA 2AE7A 4ZDQA 3CKVA 5IFYA 2CU2A 5EJ1A 4EVWA 1ZCYA 5DDVA 3SXGA 3ZLKA 5C48A 3OH0A 1R7XA 2D0JA 2RJ4A 1H7EA 5FUHA 1LZIA 1FXOA 4HO8A 1VM8A 2YQSA 2VSHA 1VZXA 1OMXA 3DJ4A 3ST8A 1GX0A 4AC3A 2YQHA 1W57A 1KWSA 5C4DA 3CGXA 3I0FA 4EEMA 3OC9A
chains in the Genus database with same CATH superfamily
1H5SB 3IOJA 1G8OA 2OI6A 3OH4A 2A8UA 1GQCA 1ZJ1A 4FCUA 2Z87A 3U2VA 4O6NA 5FYEA 4ASJA 1O23B 1VGWA 1VPAA 3SX5A 1ZHJA 2XWNA 4UEGA 1JV3A 2AESA 3I0LA 1ZIZA 4CJBA 1GWVA 4FRLA 4HO0A 4Y7TA 2BO8A 1G23A 3TQDA 4EEGA 1TW5A 1LL2A 1OQMB 4KC1A 3IOIA 4G3PA 3V0NA 3PKQA 3OH2A 4B5BA 2VS5A 2J0BA 2RJ9A 1R80A 3SPTA 1FR9A 1V83A 5C4CA 2FYDB 3I0KA 3CU0A 2Y4KA 4DE7A 5BXCA 1MP4A 2P72A 3U2UA 2VSIA 2V0JA 2YC3A 3PNNA 3SX8A 4D11C 2RJ6A 2PA4A 3OAMA 4IRPA 1ON8A 1WSZA 3D8VA 4NANA 1GA8A 2JCLA 5FTSA 1ZCUA 1LL0A 3Q4SA 1HM9A 1PZYB 2BO6A 4AYJA 2YCMA 2AH9A 2YC5A 1H5SD 4Y7VA 2FYAA 3V90A 4D0TA 5L6VA 5FTVA 2VD4A 5CQOA 4EE5A 2FYBA 2GGQA 3I0GA 4FRDA 4NAIA 4G3SA 4HO6A 5FU8A 1IINA 4NAKA 3U0YA 5CQLX 1WT0A 4BQHA 1H4DA 1NQIB 5CQMX 1G2VA 4EE4A 4EEOA 3F1YA 2RJ0A 3RMWA 2E8BA 5C3DA 3I0HA 1YROB 1MP3A 3BRKX 1HV9A 5FV9A 1QGSA 1R7TA 5C4FA 4FRAA 3SXBA 3ZF8A 5C8RA 4FRHA 4CVHA 3V0OA 1H5TA 3JUJA 3D5NA 1FOAA 1ZJ2A 5C4EA 1YP2A 2ZU9A 4Y64A 2C0NA 2AM3A 2FYCB 1H5SC 2X60A 4HO3A 4IRQA 3I0DA 1NWGB 4KNRA 4FREA 3I0JA 2RIXA 4DDZA 5CMFX 1NKHB 1GX4A 2I5KA 4NALA 2X65A 4Y7UA 5D92A 4LW3A 1ZI4A 2PGVA 3SX3A 2FY7A 1H7TA 4MYBA 4FIYA 1WT2A 4Y63A 1LL3A 3ZGFA 1I52A 3ZGGA 2XWLA 4FQWA 5D91A 4G87A 3HL3A 2RIYA 1XZ6A 1FO8A 1VGUA 2Y4JA 4M4KA 2I7BA 5FU0A 3USQA 4FROA 2AM4A 1ON6A 2WVMA 3V8ZA 1FGXA 3PKPA 4P02A 5IDTA 1QG8A 1JV1A 5C47A 2ICXA 1VZTA 4Y9XA 2UX8A 3OH1A 5C1LA 2D7RA 2WVLA 2Z86A 3KIAA 5C49A 2I5EA 4KPXA 2V0KA 4Q7CA 1G0RA 2VK9A 1NHEB 1JYKA 4HCQA 1LZ7A 1SS9A 1FWYA 3CKQA 2VFZA 3I0IX 4B4BA 3I0CA 4P00A 5C1GA 1TZFA 2WE9A 1JVGA 4MIXA 2BO7A 1H5TB 1VGZA 2XWMA 3BCVA 5AJOA 3POLA 3SXDA 3U0XA 3U2TA 3V0MA 5DDTA 1V82A 4ECMA 2O1HA 3O3PA 2X5SA 5C36A 5EJZA 3K8EA 3LW6A 2RIZA 1ZI5A 4Y7GA 1ZCVA 1XHBA 1S4NA 4FRPA 3V0PA 2JCJA 5C3AA 3Q80A 4E1KA 4J18A 2AECA 2YESA 1ZDFA 3OH3A 1FR8A 2RJ8A 4KNXA 1VZUA 3CKJA 2FFUA 3K8DA 1HM0A 2Y4MA 2X5ZA 2DPWA 3FWWA 3TZTA 2VXLA 3JUKA 4Y7FA 1GQ9A 2P6WA 2RJ7A 4G3QA 1VICA 1ZI1A 2ZU7A 3V0QA 5I1FA 2QH5A 3V91A 1INJA 1EYRA 1H4EA 1WVCA 5CQPA 5CMIA 5J49A 3E25A 2WEEA 2J0AA 1TW1A 3NGWA 1S4PA 4KRVA 3QVBA 3IOHA 1EZIA 3OKRA 5AJPA 2Y6PA 4YS8A 1H7GA 1GWWA 2PX7A 4O6MA 1YP4A 5CMGX 4XWIA 4JISA 4HO9A 4D0ZA 1O0RA 1H7HA 3Q7UA 4Y62A 3ZLLA 1JVDA 5CMJA 1WT3A 2RJ1A 2BO4A 2YQCA 5CQNX 2FFVA 2E3DA 1V84A 2ZU8A 5EIYA 2WGZA 1R82A 4EE3A 5C4BA 4M28A 4BMAA 5C38A 1HJLA 4LW6A 4FRMA 1R7VA 3RMVA 4C2SA 1G1LA 2APCA 1O7OA 1FRWA 3DK5A 1VH3A 2NXVA 4FCEA 3F1CA 2Y4LA 2Q4JA 4M2BA 3DUVA 4Y6UA 1G95A 1NF5B 3SXAA 1MC3A 4KC2A 1G97A 1ZJOA 4HOCA 4HG6A 4KPZA 4M2AA 1LVWA 1VGTA 4DECA 1H7FA 1E5KA 2WVKA 1R7UA 1LZ0A 2JCKA 4D11A 2VXMA 1ZJ0A 1VH1A 2P73A 3I0EA 3V8YA 4EEAA 3N9WA 4B2XA 2YQJA 4B2WA 1H4CA 1FGGA 1FZWA 2VS3A 2W0WA 5AJNA 1TVYA 4B3UA 1HM8A 1QGQA 1W55A 1YP3A 5L6SA 1R7YA 4B4GA 4KXOA 4ASYA 1G9RA 2A8WA 1H5RA 5JQQA 2WAWA 3R3IA 1WT1A 1HJJA 5HS2A 3E26A 2PGYA 1H7LA 3USRA 1QWJA 3U2XA 2AGDA 2V0IA 2OEFA 3GUEA 4MNDA 2GGOA 2JCOA 1IIMA 4CJ8A 2W0VA 2RITA 2OI5A 5IDSA 1H3MA 5C3BA 1FO9A 2VS4A 4CJCA 3U2WA 2ICYA 4R7PA 2V0HA 1ZCTA 4HO5A 1G3LA 4KC4A 2O1FA 2QGIA 3CKNA 1S4OA 1ZI3A 3FOQA 3T7MA 1OMZA 2QKXA 1R81A 1H5SA 1Z90A 2V0LA 3OGZA 2XMHA 5CMHA 1LZJA 3RSBA 3T7OA 3SXCA 2MZBA 1ZJPA 3V0LA 4KT7A 4AAWA 1K4VA 1MP5A 2D7IA 4K6RA 2XMEA 5C1HA 4HO4A 4Y6NA 4B42A 1NMMB 4HO2A 2O1GA 2RJ5A 4JD0A 3SXEA 1W77A 4D48A 4KQLA 3D98A 2AM5A 1O7QA 4ARWA 1INIA 2OEGA 1H7QA 4AYLA 4FIXA 4L41C 1G93A 3JTJA 1FG5N 1PZTA 1ZDGA 3SX7A 2Y7AA 3R2WA 2OI7A 3CKOA 1H5RB 1ZJ3A 4FRBA 4FRQA 4GBPA 3EE5A 4B4MA 1FXJA 3T7NA 1JYLA 2AE7A 4ZDQA 3CKVA 5IFYA 2CU2A 5EJ1A 4EVWA 1ZCYA 5DDVA 3SXGA 3ZLKA 5C48A 3OH0A 1R7XA 2D0JA 2RJ4A 1H7EA 5FUHA 1LZIA 1FXOA 4HO8A 1VM8A 2YQSA 2VSHA 1VZXA 1OMXA 3DJ4A 3ST8A 1GX0A 4AC3A 2YQHA 1W57A 1KWSA 5C4DA 3CGXA 3I0FA 4EEMA 3OC9A
chains in the Genus database with same CATH topology
1H5SB 3IOJA 1G8OA 2OI6A 3OH4A 2A8UA 1GQCA 1ZJ1A 4FCUA 2Z87A 3U2VA 4O6NA 5FYEA 4ASJA 1O23B 1VGWA 1VPAA 3SX5A 1ZHJA 2XWNA 4UEGA 1JV3A 2AESA 3I0LA 1ZIZA 4CJBA 1GWVA 4FRLA 4HO0A 4Y7TA 2BO8A 1G23A 3TQDA 4EEGA 1TW5A 1LL2A 1OQMB 4KC1A 3IOIA 4G3PA 3V0NA 3PKQA 3OH2A 4B5BA 2VS5A 2J0BA 2RJ9A 1R80A 3SPTA 1FR9A 1V83A 5C4CA 2FYDB 3I0KA 3CU0A 2Y4KA 4DE7A 5BXCA 1MP4A 2P72A 3U2UA 2VSIA 2V0JA 2YC3A 3PNNA 3SX8A 4D11C 2RJ6A 2PA4A 3OAMA 4IRPA 1ON8A 1WSZA 3D8VA 4NANA 1GA8A 2JCLA 5FTSA 1ZCUA 1LL0A 3Q4SA 1HM9A 1PZYB 2BO6A 4AYJA 2YCMA 2AH9A 2YC5A 1H5SD 4Y7VA 2FYAA 3V90A 4D0TA 5L6VA 5FTVA 2VD4A 5CQOA 4EE5A 2FYBA 2GGQA 3I0GA 4FRDA 4NAIA 4G3SA 4HO6A 5FU8A 1IINA 4NAKA 3U0YA 5CQLX 1WT0A 4BQHA 1H4DA 1NQIB 5CQMX 1G2VA 4EE4A 4EEOA 3F1YA 2RJ0A 3RMWA 2E8BA 5C3DA 3I0HA 1YROB 1MP3A 3BRKX 1HV9A 5FV9A 1QGSA 1R7TA 5C4FA 4FRAA 3SXBA 3ZF8A 5C8RA 4FRHA 4CVHA 3V0OA 1H5TA 3JUJA 3D5NA 1FOAA 1ZJ2A 5C4EA 1YP2A 2ZU9A 4Y64A 2C0NA 2AM3A 2FYCB 1H5SC 2X60A 4HO3A 4IRQA 3I0DA 1NWGB 4KNRA 4FREA 3I0JA 2RIXA 4DDZA 5CMFX 1NKHB 1GX4A 2I5KA 4NALA 2X65A 4Y7UA 5D92A 4LW3A 1ZI4A 2PGVA 3SX3A 2FY7A 1H7TA 4MYBA 4FIYA 1WT2A 4Y63A 1LL3A 3ZGFA 1I52A 3ZGGA 2XWLA 4FQWA 5D91A 4G87A 3HL3A 2RIYA 1XZ6A 1FO8A 1VGUA 2Y4JA 4M4KA 2I7BA 5FU0A 3USQA 4FROA 2AM4A 1ON6A 2WVMA 3V8ZA 1FGXA 3PKPA 4P02A 5IDTA 1QG8A 1JV1A 5C47A 2ICXA 1VZTA 4Y9XA 2UX8A 3OH1A 5C1LA 2D7RA 2WVLA 2Z86A 3KIAA 5C49A 2I5EA 4KPXA 2V0KA 4Q7CA 1G0RA 2VK9A 1NHEB 1JYKA 4HCQA 1LZ7A 1SS9A 1FWYA 3CKQA 2VFZA 3I0IX 4B4BA 3I0CA 4P00A 5C1GA 1TZFA 2WE9A 1JVGA 4MIXA 2BO7A 1H5TB 1VGZA 2XWMA 3BCVA 5AJOA 3POLA 3SXDA 3U0XA 3U2TA 3V0MA 5DDTA 1V82A 4ECMA 2O1HA 3O3PA 2X5SA 5C36A 5EJZA 3K8EA 3LW6A 2RIZA 1ZI5A 4Y7GA 1ZCVA 1XHBA 1S4NA 4FRPA 3V0PA 2JCJA 5C3AA 3Q80A 4E1KA 4J18A 2AECA 2YESA 1ZDFA 3OH3A 1FR8A 2RJ8A 4KNXA 1VZUA 3CKJA 2FFUA 3K8DA 1HM0A 2Y4MA 2X5ZA 2DPWA 3FWWA 3TZTA 2VXLA 3JUKA 4Y7FA 1GQ9A 2P6WA 2RJ7A 4G3QA 1VICA 1ZI1A 2ZU7A 3V0QA 5I1FA 2QH5A 3V91A 1INJA 1EYRA 1H4EA 1WVCA 5CQPA 5CMIA 5J49A 3E25A 2WEEA 2J0AA 1TW1A 3NGWA 1S4PA 4KRVA 3QVBA 3IOHA 1EZIA 3OKRA 5AJPA 2Y6PA 4YS8A 1H7GA 1GWWA 2PX7A 4O6MA 1YP4A 5CMGX 4XWIA 4JISA 4HO9A 4D0ZA 1O0RA 1H7HA 3Q7UA 4Y62A 3ZLLA 1JVDA 5CMJA 1WT3A 2RJ1A 2BO4A 2YQCA 5CQNX 2FFVA 2E3DA 1V84A 2ZU8A 5EIYA 2WGZA 1R82A 4EE3A 5C4BA 4M28A 4BMAA 5C38A 1HJLA 4LW6A 4FRMA 1R7VA 3RMVA 4C2SA 1G1LA 2APCA 1O7OA 1FRWA 3DK5A 1VH3A 2NXVA 4FCEA 3F1CA 2Y4LA 2Q4JA 4M2BA 3DUVA 4Y6UA 1G95A 1NF5B 3SXAA 1MC3A 4KC2A 1G97A 1ZJOA 4HOCA 4HG6A 4KPZA 4M2AA 1LVWA 1VGTA 4DECA 1H7FA 1E5KA 2WVKA 1R7UA 1LZ0A 2JCKA 4D11A 2VXMA 1ZJ0A 1VH1A 2P73A 3I0EA 3V8YA 4EEAA 3N9WA 4B2XA 2YQJA 4B2WA 1H4CA 1FGGA 1FZWA 2VS3A 2W0WA 5AJNA 1TVYA 4B3UA 1HM8A 1QGQA 1W55A 1YP3A 5L6SA 1R7YA 4B4GA 4KXOA 4ASYA 1G9RA 2A8WA 1H5RA 5JQQA 2WAWA 3R3IA 1WT1A 1HJJA 5HS2A 3E26A 2PGYA 1H7LA 3USRA 1QWJA 3U2XA 2AGDA 2V0IA 2OEFA 3GUEA 4MNDA 2GGOA 2JCOA 1IIMA 4CJ8A 2W0VA 2RITA 2OI5A 5IDSA 1H3MA 5C3BA 1FO9A 2VS4A 4CJCA 3U2WA 2ICYA 4R7PA 2V0HA 1ZCTA 4HO5A 1G3LA 4KC4A 2O1FA 2QGIA 3CKNA 1S4OA 1ZI3A 3FOQA 3T7MA 1OMZA 2QKXA 1R81A 1H5SA 1Z90A 2V0LA 3OGZA 2XMHA 5CMHA 1LZJA 3RSBA 3T7OA 3SXCA 2MZBA 1ZJPA 3V0LA 4KT7A 4AAWA 1K4VA 1MP5A 2D7IA 4K6RA 2XMEA 5C1HA 4HO4A 4Y6NA 4B42A 1NMMB 4HO2A 2O1GA 2RJ5A 4JD0A 3SXEA 1W77A 4D48A 4KQLA 3D98A 2AM5A 1O7QA 4ARWA 1INIA 2OEGA 1H7QA 4AYLA 4FIXA 4L41C 1G93A 3JTJA 1FG5N 1PZTA 1ZDGA 3SX7A 2Y7AA 3R2WA 2OI7A 3CKOA 1H5RB 1ZJ3A 4FRBA 4FRQA 4GBPA 3EE5A 4B4MA 1FXJA 3T7NA 1JYLA 2AE7A 4ZDQA 3CKVA 5IFYA 2CU2A 5EJ1A 4EVWA 1ZCYA 5DDVA 3SXGA 3ZLKA 5C48A 3OH0A 1R7XA 2D0JA 2RJ4A 1H7EA 5FUHA 1LZIA 1FXOA 4HO8A 1VM8A 2YQSA 2VSHA 1VZXA 1OMXA 3DJ4A 3ST8A 1GX0A 4AC3A 2YQHA 1W57A 1KWSA 5C4DA 3CGXA 3I0FA 4EEMA 3OC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5S B;  3IOJ A;  1G8O A;  2OI6 A;  3OH4 A;  2A8U A;  1GQC A;  1ZJ1 A;  4FCU A;  2Z87 A;  3U2V A;  5FYE A;  4ASJ A;  1O23 B;  1VGW A;  1VPA A;  3SX5 A;  1ZHJ A;  2XWN A;  4UEG A;  1JV3 A;  2AES A;  3I0L A;  1ZIZ A;  4CJB A;  1GWV A;  4FRL A;  4HO0 A;  4Y7T A;  2BO8 A;  1G23 A;  3TQD A;  4EEG A;  1TW5 A;  1LL2 A;  1OQM B;  4KC1 A;  3IOI A;  4G3P A;  3V0N A;  3PKQ A;  3OH2 A;  4B5B A;  2VS5 A;  2RJ9 A;  1R80 A;  3SPT A;  1FR9 A;  1V83 A;  5C4C A;  2FYD B;  3I0K A;  3CU0 A;  2Y4K A;  4DE7 A;  5BXC A;  1MP4 A;  2P72 A;  3U2U A;  2VSI A;  2V0J A;  2YC3 A;  3PNN A;  3SX8 A;  4D11 C;  2RJ6 A;  2PA4 A;  3OAM A;  4IRP A;  1ON8 A;  1WSZ A;  3D8V A;  4NAN A;  1GA8 A;  2JCL A;  5FTS A;  1ZCU A;  1LL0 A;  3Q4S A;  1HM9 A;  1PZY B;  2BO6 A;  4AYJ A;  2YCM A;  2AH9 A;  2YC5 A;  1H5S D;  4Y7V A;  2FYA A;  3V90 A;  4D0T A;  5L6V A;  5FTV A;  2VD4 A;  5CQO A;  4EE5 A;  2FYB A;  2GGQ A;  3I0G A;  4FRD A;  4NAI A;  4G3S A;  4HO6 A;  5FU8 A;  1IIN A;  4NAK A;  3U0Y A;  5CQL X;  1WT0 A;  4BQH A;  1H4D A;  1NQI B;  5CQM X;  1G2V A;  4EE4 A;  4EEO A;  3F1Y A;  2RJ0 A;  3RMW A;  2E8B A;  5C3D A;  3I0H A;  1YRO B;  1MP3 A;  3BRK X;  1HV9 A;  5FV9 A;  1QGS A;  1R7T A;  5C4F A;  4FRA A;  3SXB A;  3ZF8 A;  5C8R A;  4FRH A;  4CVH A;  3V0O A;  1H5T A;  3JUJ A;  3D5N A;  1FOA A;  1ZJ2 A;  5C4E A;  1YP2 A;  2ZU9 A;  4Y64 A;  2AM3 A;  2FYC B;  1H5S C;  2X60 A;  4HO3 A;  4IRQ A;  3I0D A;  1NWG B;  4KNR A;  4FRE A;  3I0J A;  2RIX A;  4DDZ A;  5CMF X;  1NKH B;  1GX4 A;  2I5K A;  4NAL A;  2X65 A;  4Y7U A;  4LW3 A;  1ZI4 A;  2PGV A;  3SX3 A;  2FY7 A;  1H7T A;  4MYB A;  1WT2 A;  4Y63 A;  1LL3 A;  3ZGF A;  1I52 A;  3ZGG A;  2XWL A;  4FQW A;  4G87 A;  3HL3 A;  2RIY A;  1XZ6 A;  1FO8 A;  1VGU A;  2Y4J A;  4M4K A;  2I7B A;  5FU0 A;  3USQ A;  4FRO A;  2AM4 A;  1ON6 A;  2WVM A;  3V8Z A;  1FGX A;  3PKP A;  4P02 A;  5IDT A;  1QG8 A;  1JV1 A;  5C47 A;  2ICX A;  1VZT A;  4Y9X A;  2UX8 A;  3OH1 A;  5C1L A;  2D7R A;  2WVL A;  2Z86 A;  3KIA A;  5C49 A;  2I5E A;  4KPX A;  2V0K A;  1G0R A;  1NHE B;  1JYK A;  4HCQ A;  1LZ7 A;  1SS9 A;  1FWY A;  3CKQ A;  2VFZ A;  3I0I X;  4B4B A;  3I0C A;  4P00 A;  5C1G A;  1TZF A;  2WE9 A;  1JVG A;  2BO7 A;  1H5T B;  1VGZ A;  2XWM A;  3BCV A;  5AJO A;  3POL A;  3SXD A;  3U0X A;  3U2T A;  3V0M A;  5DDT A;  1V82 A;  4ECM A;  2O1H A;  3O3P A;  2X5S A;  5C36 A;  5EJZ A;  3K8E A;  3LW6 A;  2RIZ A;  1ZI5 A;  4Y7G A;  1ZCV A;  1XHB A;  1S4N A;  4FRP A;  3V0P A;  2JCJ A;  5C3A A;  3Q80 A;  4E1K A;  4J18 A;  2AEC A;  2YES A;  1ZDF A;  3OH3 A;  1FR8 A;  2RJ8 A;  4KNX A;  1VZU A;  3CKJ A;  2FFU A;  3K8D A;  1HM0 A;  2Y4M A;  2X5Z A;  2DPW A;  3FWW A;  3TZT A;  2VXL A;  3JUK A;  4Y7F A;  1GQ9 A;  2P6W A;  2RJ7 A;  4G3Q A;  1VIC A;  1ZI1 A;  2ZU7 A;  3V0Q A;  5I1F A;  2QH5 A;  3V91 A;  1INJ A;  1EYR A;  1H4E A;  1WVC A;  5CQP A;  5CMI A;  5J49 A;  3E25 A;  2WEE A;  1TW1 A;  3NGW A;  1S4P A;  4KRV A;  3QVB A;  3IOH A;  1EZI A;  3OKR A;  5AJP A;  2Y6P A;  4YS8 A;  1H7G A;  1GWW A;  2PX7 A;  5CMG X;  1YP4 A;  4XWI A;  4JIS A;  4HO9 A;  4D0Z A;  1O0R A;  1H7H A;  3Q7U A;  4Y62 A;  3ZLL A;  1JVD A;  5CMJ A;  1WT3 A;  2RJ1 A;  2BO4 A;  2YQC A;  5CQN X;  2FFV A;  2E3D A;  1V84 A;  2ZU8 A;  5EIY A;  2WGZ A;  1R82 A;  4EE3 A;  5C4B A;  4M28 A;  4BMA A;  5C38 A;  1HJL A;  4LW6 A;  4FRM A;  1R7V A;  3RMV A;  4C2S A;  1G1L A;  2APC A;  1O7O A;  1FRW A;  3DK5 A;  1VH3 A;  2NXV A;  4FCE A;  3F1C A;  2Y4L A;  2Q4J A;  4M2B A;  3DUV A;  4Y6U A;  1G95 A;  1NF5 B;  3SXA A;  1MC3 A;  4KC2 A;  1G97 A;  1ZJO A;  4HOC A;  4HG6 A;  4KPZ A;  4M2A A;  1LVW A;  1VGT A;  4DEC A;  1H7F A;  1E5K A;  2WVK A;  1R7U A;  1LZ0 A;  2JCK A;  4D11 A;  2VXM A;  1ZJ0 A;  1VH1 A;  2P73 A;  3I0E A;  3V8Y A;  4EEA A;  3N9W A;  4B2X A;  2YQJ A;  4B2W A;  1H4C A;  1FGG A;  1FZW A;  2VS3 A;  2W0W A;  5AJN A;  1TVY A;  4B3U A;  1HM8 A;  1QGQ A;  1W55 A;  1YP3 A;  5L6S A;  1R7Y A;  4B4G A;  4KXO A;  4ASY A;  1G9R A;  2A8W A;  1H5R A;  5JQQ A;  2WAW A;  3R3I A;  1WT1 A;  1HJJ A;  5HS2 A;  3E26 A;  2PGY A;  1H7L A;  3USR A;  1QWJ A;  3U2X A;  2AGD A;  2V0I A;  2OEF A;  3GUE A;  4MND A;  2GGO A;  2JCO A;  1IIM A;  4CJ8 A;  2W0V A;  2RIT A;  2OI5 A;  5IDS A;  1H3M A;  5C3B A;  1FO9 A;  2VS4 A;  4CJC A;  3U2W A;  2ICY A;  4R7P A;  2V0H A;  1ZCT A;  4HO5 A;  1G3L A;  4KC4 A;  2O1F A;  2QGI A;  3CKN A;  1S4O A;  1ZI3 A;  3FOQ A;  3T7M A;  1OMZ A;  2QKX A;  1R81 A;  1H5S A;  1Z90 A;  2V0L A;  3OGZ A;  2XMH A;  5CMH A;  1LZJ A;  3RSB A;  3T7O A;  3SXC A;  2MZB A;  1ZJP A;  3V0L A;  4KT7 A;  4AAW A;  1K4V A;  1MP5 A;  2D7I A;  4K6R A;  2XME A;  5C1H A;  4HO4 A;  4Y6N A;  4B42 A;  1NMM B;  4HO2 A;  2O1G A;  2RJ5 A;  4JD0 A;  3SXE A;  1W77 A;  4D48 A;  4KQL A;  3D98 A;  2AM5 A;  1O7Q A;  4ARW A;  1INI A;  2OEG A;  1H7Q A;  4AYL A;  4L41 C;  1G93 A;  3JTJ A;  1FG5 N;  1PZT A;  1ZDG A;  3SX7 A;  2Y7A A;  3R2W A;  2OI7 A;  3CKO A;  1H5R B;  1ZJ3 A;  4FRB A;  4FRQ A;  4GBP A;  3EE5 A;  4B4M A;  1FXJ A;  3T7N A;  1JYL A;  2AE7 A;  4ZDQ A;  3CKV A;  5IFY A;  2CU2 A;  5EJ1 A;  4EVW A;  1ZCY A;  5DDV A;  3SXG A;  3ZLK A;  5C48 A;  3OH0 A;  1R7X A;  2D0J A;  2RJ4 A;  1H7E A;  5FUH A;  1LZI A;  1FXO A;  4HO8 A;  1VM8 A;  2YQS A;  2VSH A;  1VZX A;  1OMX A;  3DJ4 A;  3ST8 A;  1GX0 A;  4AC3 A;  2YQH A;  1W57 A;  1KWS A;  5C4D A;  3CGX A;  3I0F A;  4EEM A;  3OC9 A; 
#chains in the Genus database with same CATH topology
 1H5S B;  3IOJ A;  1G8O A;  2OI6 A;  3OH4 A;  2A8U A;  1GQC A;  1ZJ1 A;  4FCU A;  2Z87 A;  3U2V A;  4O6N A;  5FYE A;  4ASJ A;  1O23 B;  1VGW A;  1VPA A;  3SX5 A;  1ZHJ A;  2XWN A;  4UEG A;  1JV3 A;  2AES A;  3I0L A;  1ZIZ A;  4CJB A;  1GWV A;  4FRL A;  4HO0 A;  4Y7T A;  2BO8 A;  1G23 A;  3TQD A;  4EEG A;  1TW5 A;  1LL2 A;  1OQM B;  4KC1 A;  3IOI A;  4G3P A;  3V0N A;  3PKQ A;  3OH2 A;  4B5B A;  2VS5 A;  2J0B A;  2RJ9 A;  1R80 A;  3SPT A;  1FR9 A;  1V83 A;  5C4C A;  2FYD B;  3I0K A;  3CU0 A;  2Y4K A;  4DE7 A;  5BXC A;  1MP4 A;  2P72 A;  3U2U A;  2VSI A;  2V0J A;  2YC3 A;  3PNN A;  3SX8 A;  4D11 C;  2RJ6 A;  2PA4 A;  3OAM A;  4IRP A;  1ON8 A;  1WSZ A;  3D8V A;  4NAN A;  1GA8 A;  2JCL A;  5FTS A;  1ZCU A;  1LL0 A;  3Q4S A;  1HM9 A;  1PZY B;  2BO6 A;  4AYJ A;  2YCM A;  2AH9 A;  2YC5 A;  1H5S D;  4Y7V A;  2FYA A;  3V90 A;  4D0T A;  5L6V A;  5FTV A;  2VD4 A;  5CQO A;  4EE5 A;  2FYB A;  2GGQ A;  3I0G A;  4FRD A;  4NAI A;  4G3S A;  4HO6 A;  5FU8 A;  1IIN A;  4NAK A;  3U0Y A;  5CQL X;  1WT0 A;  4BQH A;  1H4D A;  1NQI B;  5CQM X;  1G2V A;  4EE4 A;  4EEO A;  3F1Y A;  2RJ0 A;  3RMW A;  2E8B A;  5C3D A;  3I0H A;  1YRO B;  1MP3 A;  3BRK X;  1HV9 A;  5FV9 A;  1QGS A;  1R7T A;  5C4F A;  4FRA A;  3SXB A;  3ZF8 A;  5C8R A;  4FRH A;  4CVH A;  3V0O A;  1H5T A;  3JUJ A;  3D5N A;  1FOA A;  1ZJ2 A;  5C4E A;  1YP2 A;  2ZU9 A;  4Y64 A;  2C0N A;  2AM3 A;  2FYC B;  1H5S C;  2X60 A;  4HO3 A;  4IRQ A;  3I0D A;  1NWG B;  4KNR A;  4FRE A;  3I0J A;  2RIX A;  4DDZ A;  5CMF X;  1NKH B;  1GX4 A;  2I5K A;  4NAL A;  2X65 A;  4Y7U A;  5D92 A;  4LW3 A;  1ZI4 A;  2PGV A;  3SX3 A;  2FY7 A;  1H7T A;  4MYB A;  4FIY A;  1WT2 A;  4Y63 A;  1LL3 A;  3ZGF A;  1I52 A;  3ZGG A;  2XWL A;  4FQW A;  5D91 A;  4G87 A;  3HL3 A;  2RIY A;  1XZ6 A;  1FO8 A;  1VGU A;  2Y4J A;  4M4K A;  2I7B A;  5FU0 A;  3USQ A;  4FRO A;  2AM4 A;  1ON6 A;  2WVM A;  3V8Z A;  1FGX A;  3PKP A;  4P02 A;  5IDT A;  1QG8 A;  1JV1 A;  5C47 A;  2ICX A;  1VZT A;  4Y9X A;  2UX8 A;  3OH1 A;  5C1L A;  2D7R A;  2WVL A;  2Z86 A;  3KIA A;  5C49 A;  2I5E A;  4KPX A;  2V0K A;  4Q7C A;  1G0R A;  2VK9 A;  1NHE B;  1JYK A;  4HCQ A;  1LZ7 A;  1SS9 A;  1FWY A;  3CKQ A;  2VFZ A;  3I0I X;  4B4B A;  3I0C A;  4P00 A;  5C1G A;  1TZF A;  2WE9 A;  1JVG A;  4MIX A;  2BO7 A;  1H5T B;  1VGZ A;  2XWM A;  3BCV A;  5AJO A;  3POL A;  3SXD A;  3U0X A;  3U2T A;  3V0M A;  5DDT A;  1V82 A;  4ECM A;  2O1H A;  3O3P A;  2X5S A;  5C36 A;  5EJZ A;  3K8E A;  3LW6 A;  2RIZ A;  1ZI5 A;  4Y7G A;  1ZCV A;  1XHB A;  1S4N A;  4FRP A;  3V0P A;  2JCJ A;  5C3A A;  3Q80 A;  4E1K A;  4J18 A;  2AEC A;  2YES A;  1ZDF A;  3OH3 A;  1FR8 A;  2RJ8 A;  4KNX A;  1VZU A;  3CKJ A;  2FFU A;  3K8D A;  1HM0 A;  2Y4M A;  2X5Z A;  2DPW A;  3FWW A;  3TZT A;  2VXL A;  3JUK A;  4Y7F A;  1GQ9 A;  2P6W A;  2RJ7 A;  4G3Q A;  1VIC A;  1ZI1 A;  2ZU7 A;  3V0Q A;  5I1F A;  2QH5 A;  3V91 A;  1INJ A;  1EYR A;  1H4E A;  1WVC A;  5CQP A;  5CMI A;  5J49 A;  3E25 A;  2WEE A;  2J0A A;  1TW1 A;  3NGW A;  1S4P A;  4KRV A;  3QVB A;  3IOH A;  1EZI A;  3OKR A;  5AJP A;  2Y6P A;  4YS8 A;  1H7G A;  1GWW A;  2PX7 A;  4O6M A;  1YP4 A;  5CMG X;  4XWI A;  4JIS A;  4HO9 A;  4D0Z A;  1O0R A;  1H7H A;  3Q7U A;  4Y62 A;  3ZLL A;  1JVD A;  5CMJ A;  1WT3 A;  2RJ1 A;  2BO4 A;  2YQC A;  5CQN X;  2FFV A;  2E3D A;  1V84 A;  2ZU8 A;  5EIY A;  2WGZ A;  1R82 A;  4EE3 A;  5C4B A;  4M28 A;  4BMA A;  5C38 A;  1HJL A;  4LW6 A;  4FRM A;  1R7V A;  3RMV A;  4C2S A;  1G1L A;  2APC A;  1O7O A;  1FRW A;  3DK5 A;  1VH3 A;  2NXV A;  4FCE A;  3F1C A;  2Y4L A;  2Q4J A;  4M2B A;  3DUV A;  4Y6U A;  1G95 A;  1NF5 B;  3SXA A;  1MC3 A;  4KC2 A;  1G97 A;  1ZJO A;  4HOC A;  4HG6 A;  4KPZ A;  4M2A A;  1LVW A;  1VGT A;  4DEC A;  1H7F A;  1E5K A;  2WVK A;  1R7U A;  1LZ0 A;  2JCK A;  4D11 A;  2VXM A;  1ZJ0 A;  1VH1 A;  2P73 A;  3I0E A;  3V8Y A;  4EEA A;  3N9W A;  4B2X A;  2YQJ A;  4B2W A;  1H4C A;  1FGG A;  1FZW A;  2VS3 A;  2W0W A;  5AJN A;  1TVY A;  4B3U A;  1HM8 A;  1QGQ A;  1W55 A;  1YP3 A;  5L6S A;  1R7Y A;  4B4G A;  4KXO A;  4ASY A;  1G9R A;  2A8W A;  1H5R A;  5JQQ A;  2WAW A;  3R3I A;  1WT1 A;  1HJJ A;  5HS2 A;  3E26 A;  2PGY A;  1H7L A;  3USR A;  1QWJ A;  3U2X A;  2AGD A;  2V0I A;  2OEF A;  3GUE A;  4MND A;  2GGO A;  2JCO A;  1IIM A;  4CJ8 A;  2W0V A;  2RIT A;  2OI5 A;  5IDS A;  1H3M A;  5C3B A;  1FO9 A;  2VS4 A;  4CJC A;  3U2W A;  2ICY A;  4R7P A;  2V0H A;  1ZCT A;  4HO5 A;  1G3L A;  4KC4 A;  2O1F A;  2QGI A;  3CKN A;  1S4O A;  1ZI3 A;  3FOQ A;  3T7M A;  1OMZ A;  2QKX A;  1R81 A;  1H5S A;  1Z90 A;  2V0L A;  3OGZ A;  2XMH A;  5CMH A;  1LZJ A;  3RSB A;  3T7O A;  3SXC A;  2MZB A;  1ZJP A;  3V0L A;  4KT7 A;  4AAW A;  1K4V A;  1MP5 A;  2D7I A;  4K6R A;  2XME A;  5C1H A;  4HO4 A;  4Y6N A;  4B42 A;  1NMM B;  4HO2 A;  2O1G A;  2RJ5 A;  4JD0 A;  3SXE A;  1W77 A;  4D48 A;  4KQL A;  3D98 A;  2AM5 A;  1O7Q A;  4ARW A;  1INI A;  2OEG A;  1H7Q A;  4AYL A;  4FIX A;  4L41 C;  1G93 A;  3JTJ A;  1FG5 N;  1PZT A;  1ZDG A;  3SX7 A;  2Y7A A;  3R2W A;  2OI7 A;  3CKO A;  1H5R B;  1ZJ3 A;  4FRB A;  4FRQ A;  4GBP A;  3EE5 A;  4B4M A;  1FXJ A;  3T7N A;  1JYL A;  2AE7 A;  4ZDQ A;  3CKV A;  5IFY A;  2CU2 A;  5EJ1 A;  4EVW A;  1ZCY A;  5DDV A;  3SXG A;  3ZLK A;  5C48 A;  3OH0 A;  1R7X A;  2D0J A;  2RJ4 A;  1H7E A;  5FUH A;  1LZI A;  1FXO A;  4HO8 A;  1VM8 A;  2YQS A;  2VSH A;  1VZX A;  1OMX A;  3DJ4 A;  3ST8 A;  1GX0 A;  4AC3 A;  2YQH A;  1W57 A;  1KWS A;  5C4D A;  3CGX A;  3I0F A;  4EEM A;  3OC9 A; 
#chains in the Genus database with same CATH homology
 1H5S B;  3IOJ A;  1G8O A;  2OI6 A;  3OH4 A;  2A8U A;  1GQC A;  1ZJ1 A;  4FCU A;  2Z87 A;  3U2V A;  4O6N A;  5FYE A;  4ASJ A;  1O23 B;  1VGW A;  1VPA A;  3SX5 A;  1ZHJ A;  2XWN A;  4UEG A;  1JV3 A;  2AES A;  3I0L A;  1ZIZ A;  4CJB A;  1GWV A;  4FRL A;  4HO0 A;  4Y7T A;  2BO8 A;  1G23 A;  3TQD A;  4EEG A;  1TW5 A;  1LL2 A;  1OQM B;  4KC1 A;  3IOI A;  4G3P A;  3V0N A;  3PKQ A;  3OH2 A;  4B5B A;  2VS5 A;  2J0B A;  2RJ9 A;  1R80 A;  3SPT A;  1FR9 A;  1V83 A;  5C4C A;  2FYD B;  3I0K A;  3CU0 A;  2Y4K A;  4DE7 A;  5BXC A;  1MP4 A;  2P72 A;  3U2U A;  2VSI A;  2V0J A;  2YC3 A;  3PNN A;  3SX8 A;  4D11 C;  2RJ6 A;  2PA4 A;  3OAM A;  4IRP A;  1ON8 A;  1WSZ A;  3D8V A;  4NAN A;  1GA8 A;  2JCL A;  5FTS A;  1ZCU A;  1LL0 A;  3Q4S A;  1HM9 A;  1PZY B;  2BO6 A;  4AYJ A;  2YCM A;  2AH9 A;  2YC5 A;  1H5S D;  4Y7V A;  2FYA A;  3V90 A;  4D0T A;  5L6V A;  5FTV A;  2VD4 A;  5CQO A;  4EE5 A;  2FYB A;  2GGQ A;  3I0G A;  4FRD A;  4NAI A;  4G3S A;  4HO6 A;  5FU8 A;  1IIN A;  4NAK A;  3U0Y A;  5CQL X;  1WT0 A;  4BQH A;  1H4D A;  1NQI B;  5CQM X;  1G2V A;  4EE4 A;  4EEO A;  3F1Y A;  2RJ0 A;  3RMW A;  2E8B A;  5C3D A;  3I0H A;  1YRO B;  1MP3 A;  3BRK X;  1HV9 A;  5FV9 A;  1QGS A;  1R7T A;  5C4F A;  4FRA A;  3SXB A;  3ZF8 A;  5C8R A;  4FRH A;  4CVH A;  3V0O A;  1H5T A;  3JUJ A;  3D5N A;  1FOA A;  1ZJ2 A;  5C4E A;  1YP2 A;  2ZU9 A;  4Y64 A;  2C0N A;  2AM3 A;  2FYC B;  1H5S C;  2X60 A;  4HO3 A;  4IRQ A;  3I0D A;  1NWG B;  4KNR A;  4FRE A;  3I0J A;  2RIX A;  4DDZ A;  5CMF X;  1NKH B;  1GX4 A;  2I5K A;  4NAL A;  2X65 A;  4Y7U A;  5D92 A;  4LW3 A;  1ZI4 A;  2PGV A;  3SX3 A;  2FY7 A;  1H7T A;  4MYB A;  4FIY A;  1WT2 A;  4Y63 A;  1LL3 A;  3ZGF A;  1I52 A;  3ZGG A;  2XWL A;  4FQW A;  5D91 A;  4G87 A;  3HL3 A;  2RIY A;  1XZ6 A;  1FO8 A;  1VGU A;  2Y4J A;  4M4K A;  2I7B A;  5FU0 A;  3USQ A;  4FRO A;  2AM4 A;  1ON6 A;  2WVM A;  3V8Z A;  1FGX A;  3PKP A;  4P02 A;  5IDT A;  1QG8 A;  1JV1 A;  5C47 A;  2ICX A;  1VZT A;  4Y9X A;  2UX8 A;  3OH1 A;  5C1L A;  2D7R A;  2WVL A;  2Z86 A;  3KIA A;  5C49 A;  2I5E A;  4KPX A;  2V0K A;  4Q7C A;  1G0R A;  2VK9 A;  1NHE B;  1JYK A;  4HCQ A;  1LZ7 A;  1SS9 A;  1FWY A;  3CKQ A;  2VFZ A;  3I0I X;  4B4B A;  3I0C A;  4P00 A;  5C1G A;  1TZF A;  2WE9 A;  1JVG A;  4MIX A;  2BO7 A;  1H5T B;  1VGZ A;  2XWM A;  3BCV A;  5AJO A;  3POL A;  3SXD A;  3U0X A;  3U2T A;  3V0M A;  5DDT A;  1V82 A;  4ECM A;  2O1H A;  3O3P A;  2X5S A;  5C36 A;  5EJZ A;  3K8E A;  3LW6 A;  2RIZ A;  1ZI5 A;  4Y7G A;  1ZCV A;  1XHB A;  1S4N A;  4FRP A;  3V0P A;  2JCJ A;  5C3A A;  3Q80 A;  4E1K A;  4J18 A;  2AEC A;  2YES A;  1ZDF A;  3OH3 A;  1FR8 A;  2RJ8 A;  4KNX A;  1VZU A;  3CKJ A;  2FFU A;  3K8D A;  1HM0 A;  2Y4M A;  2X5Z A;  2DPW A;  3FWW A;  3TZT A;  2VXL A;  3JUK A;  4Y7F A;  1GQ9 A;  2P6W A;  2RJ7 A;  4G3Q A;  1VIC A;  1ZI1 A;  2ZU7 A;  3V0Q A;  5I1F A;  2QH5 A;  3V91 A;  1INJ A;  1EYR A;  1H4E A;  1WVC A;  5CQP A;  5CMI A;  5J49 A;  3E25 A;  2WEE A;  2J0A A;  1TW1 A;  3NGW A;  1S4P A;  4KRV A;  3QVB A;  3IOH A;  1EZI A;  3OKR A;  5AJP A;  2Y6P A;  4YS8 A;  1H7G A;  1GWW A;  2PX7 A;  4O6M A;  1YP4 A;  5CMG X;  4XWI A;  4JIS A;  4HO9 A;  4D0Z A;  1O0R A;  1H7H A;  3Q7U A;  4Y62 A;  3ZLL A;  1JVD A;  5CMJ A;  1WT3 A;  2RJ1 A;  2BO4 A;  2YQC A;  5CQN X;  2FFV A;  2E3D A;  1V84 A;  2ZU8 A;  5EIY A;  2WGZ A;  1R82 A;  4EE3 A;  5C4B A;  4M28 A;  4BMA A;  5C38 A;  1HJL A;  4LW6 A;  4FRM A;  1R7V A;  3RMV A;  4C2S A;  1G1L A;  2APC A;  1O7O A;  1FRW A;  3DK5 A;  1VH3 A;  2NXV A;  4FCE A;  3F1C A;  2Y4L A;  2Q4J A;  4M2B A;  3DUV A;  4Y6U A;  1G95 A;  1NF5 B;  3SXA A;  1MC3 A;  4KC2 A;  1G97 A;  1ZJO A;  4HOC A;  4HG6 A;  4KPZ A;  4M2A A;  1LVW A;  1VGT A;  4DEC A;  1H7F A;  1E5K A;  2WVK A;  1R7U A;  1LZ0 A;  2JCK A;  4D11 A;  2VXM A;  1ZJ0 A;  1VH1 A;  2P73 A;  3I0E A;  3V8Y A;  4EEA A;  3N9W A;  4B2X A;  2YQJ A;  4B2W A;  1H4C A;  1FGG A;  1FZW A;  2VS3 A;  2W0W A;  5AJN A;  1TVY A;  4B3U A;  1HM8 A;  1QGQ A;  1W55 A;  1YP3 A;  5L6S A;  1R7Y A;  4B4G A;  4KXO A;  4ASY A;  1G9R A;  2A8W A;  1H5R A;  5JQQ A;  2WAW A;  3R3I A;  1WT1 A;  1HJJ A;  5HS2 A;  3E26 A;  2PGY A;  1H7L A;  3USR A;  1QWJ A;  3U2X A;  2AGD A;  2V0I A;  2OEF A;  3GUE A;  4MND A;  2GGO A;  2JCO A;  1IIM A;  4CJ8 A;  2W0V A;  2RIT A;  2OI5 A;  5IDS A;  1H3M A;  5C3B A;  1FO9 A;  2VS4 A;  4CJC A;  3U2W A;  2ICY A;  4R7P A;  2V0H A;  1ZCT A;  4HO5 A;  1G3L A;  4KC4 A;  2O1F A;  2QGI A;  3CKN A;  1S4O A;  1ZI3 A;  3FOQ A;  3T7M A;  1OMZ A;  2QKX A;  1R81 A;  1H5S A;  1Z90 A;  2V0L A;  3OGZ A;  2XMH A;  5CMH A;  1LZJ A;  3RSB A;  3T7O A;  3SXC A;  2MZB A;  1ZJP A;  3V0L A;  4KT7 A;  4AAW A;  1K4V A;  1MP5 A;  2D7I A;  4K6R A;  2XME A;  5C1H A;  4HO4 A;  4Y6N A;  4B42 A;  1NMM B;  4HO2 A;  2O1G A;  2RJ5 A;  4JD0 A;  3SXE A;  1W77 A;  4D48 A;  4KQL A;  3D98 A;  2AM5 A;  1O7Q A;  4ARW A;  1INI A;  2OEG A;  1H7Q A;  4AYL A;  4FIX A;  4L41 C;  1G93 A;  3JTJ A;  1FG5 N;  1PZT A;  1ZDG A;  3SX7 A;  2Y7A A;  3R2W A;  2OI7 A;  3CKO A;  1H5R B;  1ZJ3 A;  4FRB A;  4FRQ A;  4GBP A;  3EE5 A;  4B4M A;  1FXJ A;  3T7N A;  1JYL A;  2AE7 A;  4ZDQ A;  3CKV A;  5IFY A;  2CU2 A;  5EJ1 A;  4EVW A;  1ZCY A;  5DDV A;  3SXG A;  3ZLK A;  5C48 A;  3OH0 A;  1R7X A;  2D0J A;  2RJ4 A;  1H7E A;  5FUH A;  1LZI A;  1FXO A;  4HO8 A;  1VM8 A;  2YQS A;  2VSH A;  1VZX A;  1OMX A;  3DJ4 A;  3ST8 A;  1GX0 A;  4AC3 A;  2YQH A;  1W57 A;  1KWS A;  5C4D A;  3CGX A;  3I0F A;  4EEM A;  3OC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...