3DUVA

Crystal structure of 3-deoxy-manno-octulosonate cytidylyltransferase from haemophilus influenzae complexed with the substrate 3-deoxy-manno-octulosonate in the-configuration
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
254
structure length
238
Chain Sequence
MSFTVIIPARKPMIQHVFEKALQSGASRVIIATDNENVADVAKSFGAEVCMTSVNHNSGTERLAEVVEKLAIPDNEIIVNIQGDEPLIPPVIVRQVADNLAKFNVNMASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYDRDQFMNLQDVQKVQLSDAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNGERIHVELAKEVPAVGVDTAEDLEKVRAILAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-manno-octulosonate cytidylyltransferase
publication title Structure of 3-deoxy-manno-octulosonate cytidylyltransferase from Haemophilus influenzae complexed with the substrate 3-deoxy-manno-octulosonate in the beta-configuration.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 71
structure length 238
sequence length 254
chains with identical sequence B
ec nomenclature ec 2.7.7.38: 3-deoxy-manno-octulosonate cytidylyltransferase.
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02348 CTP_transf_3 Cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3duvA00
2AM4A 3CKOA 4D11C 3U2XA 1IINA 1GX0A 2A8UA 3CU0A 4ZDQA 1IIMA 2RJ9A 3TZTA 3U2VA 2WVMA 3T7NA 1H5TA 1W57A 2ZU7A 2VXMA 3SPTA 4DECA 5EJ1A 5L6VA 3V8YA 4AYLA 1YROB 3RMVA 2NXVA 2YCMA 2CU2A 3OKRA 1LZIA 3V0PA 3PNNA 4FREA 2VFZA 3K8DA 3I0IX 5C1GA 1EZIA 3LW6A 4E1KA 2RJ6A 4FRPA 4Y7GA 1YP3A 5FV9A 1ZDFA 4Y7FA 2FFUA 2XMHA 1S4PA 5CQOA 5C47A 4Y7TA 3FWWA 1V82A 4EE5A 3CKQA 5AJOA 4D11A 1SS9A 2YC5A 2GGQA 4FQWA 2GGOA 2ZU9A 1R7UA 1QGQA 3SXCA 4YS8A 1HM9A 1WT1A 1NHEB 3D5NA 5C8RA 1NKHB 5AJNA 4ASJA 5IFYA 2W0VA 2WGZA 2XWLA 2FYBA 5C49A 2PGYA 2RIYA 4FRDA 5BXCA 1H7EA 1O23B 1VH1A 1TVYA 1QG8A 1TW1A 3V8ZA 5J49A 1R81A 2V0HA 3PKQA 2FY7A 2FFVA 3DJ4A 1V83A 3NGWA 1LL3A 1H7QA 4EEAA 3SXGA 2UX8A 1NWGB 4CVHA 1MC3A 1FR8A 2OI7A 1FGGA 3SX3A 1O7QA 3QVBA 1LVWA 3I0DA 2RIZA 2Y7AA 2V0LA 2X5ZA 2V0IA 1H5SC 1ZJ1A 4G3PA 4HO8A 4G3QA 3I0LA 3SXAA 1S4OA 1K4VA 1ZI3A 1ZI4A 4NANA 1QWJA 1V84A 2I5EA 3DK5A 1LZ7A 4HO2A 3IOJA 3EE5A 1O7OA 2OEFA 2Z86A 5C4BA 2P6WA 4JISA 1H4EA 4MYBA 1S4NA 1WSZA 2JCKA 2BO4A 1MP4A 2E8BA 2Y4LA 3V90A 5C36A 1VZTA 1YP2A 1Z90A 3DUVA 3F1YA 4B2XA 3I0JA 2VSIA 1FWYA 1HJJA 4JD0A 4KRVA 2YQCA 4KC2A 3U2WA 2VS5A 1VGUA 2O1GA 2ICXA 1GWVA 2VXLA 1LZJA 1ON8A 1INJA 1XZ6A 2X65A 5C48A 3CKNA 2OI6A 1GQCA 2V0JA 5FYEA 4D0TA 5CMFX 2I5KA 4KNXA 2WVLA 2QKXA 4HO4A 1ZI5A 4AYJA 2RJ8A 1R7XA 1JYKA 1JV1A 2X5SA 4ARWA 2Y4JA 1G8OA 2YQSA 3ST8A 2FYAA 5CMIA 3ZGGA 4B2WA 1H3MA 1ZJOA 1VGTA 1NQIB 3OH4A 1NF5B 2BO6A 5CMGX 1MP3A 3ZLLA 1O0RA 3JUJA 2AESA 2AE7A 5HS2A 3GUEA 3OAMA 2AM3A 3IOHA 4Y64A 3TQDA 1ZCVA 2QGIA 1ZHJA 1VICA 2AECA 2WAWA 4KXOA 4HO6A 1W77A 4Y6NA 3D98A 1ZI1A 4HG6A 5C1LA 4AC3A 2XWMA 1FG5N 5C1HA 3V0MA 1H4DA 1JVGA 1OMZA 4EEGA 5I1FA 4ASYA 2DPWA 4B42A 1XHBA 3OGZA 4EEOA 1FR9A 5L6SA 3PKPA 1FRWA 4HO0A 2O1HA 2WVKA 2Q4JA 4AAWA 3K8EA 1R82A 1VM8A 1HM0A 1VZXA 3OH3A 3U2TA 4C2SA 1JV3A 2YESA 3I0EA 4EEMA 3HL3A 5EIYA 4M28A 1FXJA 1R7VA 4B4MA 3CKJA 4Y7UA 5FUHA 3USRA 4IRQA 4KT7A 5C4DA 4FRHA 4D48A 3CGXA 2BO7A 3SX7A 1ZCTA 5CMHA 4DE7A 4FRQA 2ZU8A 1H7TA 1R7YA 1ZCUA 5C38A 4KNRA 4KQLA 4KPZA 2OI5A 5CQMX 3F1CA 4FRMA 5C3DA 5C4EA 1WT3A 3FOQA 4LW3A 2Y6PA 2WEEA 3E26A 1H5RB 3SXEA 2FYCB 4G87A 5CQNX 1HV9A 1WT2A 1YP4A 1ZJ3A 1G2VA 4HO9A 1FZWA 3Q4SA 4P02A 5CQPA 2RJ1A 1FO9A 1GQ9A 3V0OA 4FRLA 2PGVA 1H5TB 3SXDA 2P73A 1TZFA 4CJBA 1LL2A 3T7MA 1G97A 3I0GA 1H7HA 2VSHA 3V91A 2RITA 2WE9A 3O3PA 3Q7UA 1JYLA 2QH5A 4GBPA 1G95A 1H5SA 1H5SD 1FOAA 3KIAA 4M2AA 5DDVA 5C3AA 2D7RA 4NALA 5AJPA 2RIXA 4FROA 4K6RA 4M4KA 5FTVA 4M2BA 3JTJA 4KC1A 2VD4A 1H7GA 4CJ8A 4IRPA 4B4GA 1H7FA 1ZJ2A 2FYDB 4HO3A 3OH1A 1R80A 3U0YA 1WT0A 1VGWA 3I0FA 4HCQA 3USQA 1G0RA 1ZJPA 3ZLKA 2I7BA 3T7OA 5JQQA 4HO5A 1G93A 1GWWA 2Y4MA 2AGDA 1WVCA 4EE4A 1INIA 2BO8A 5C3BA 2XWNA 4LW6A 3ZF8A 3Q80A 4FRBA 1G9RA 1HM8A 4BQHA 1MP5A 1KWSA 1VZUA 4EE3A 4DDZA 2AH9A 3SX5A 2OEGA 2O1FA 3R3IA 4FCUA 1G3LA 2JCOA 5C4CA 4KPXA 2VS4A 4B3UA 1JVDA 3D8VA 2YC3A 2MZBA 3I0HA 4XWIA 2PA4A 5DDTA 1GX4A 2XMEA 1FO8A 3SX8A 3BRKX 4P00A 1HJLA 3E25A 2YQHA 1FXOA 4Y6UA 4HOCA 2JCJA 2X60A 1W55A 1R7TA 3JUKA 4Y7VA 2P72A 1EYRA 1QGSA 4BMAA 1ZDGA 3BCVA 3OH2A 4Y62A 2V0KA 4Y9XA 1OMXA 1PZTA 3U0XA 4B4BA 2VS3A 3I0CA 1H4CA 2A8WA 3RSBA 1LL0A 1LZ0A 3SXBA 1GA8A 3RMWA 1NMMB 1ZIZA 3V0NA 2D7IA 5FU8A 2APCA 1G23A 2D0JA 4D0ZA 2YQJA 3IOIA 5CMJA 1ZCYA 4G3SA 3POLA 1I52A 3V0QA 1FGXA 2RJ0A 5FTSA 4UEGA 3OH0A 1H5SB 1ZJ0A 4CJCA 4KC4A 3N9WA 4ECMA 1G1LA 1VPAA 2RJ7A 4NAKA 2E3DA 2RJ4A 5EJZA 2Z87A 5CQLX 1ON6A 4MNDA 3OC9A 4B5BA 4NAIA 2Y4KA 1VGZA 2PX7A 3ZGFA 1TW5A 2RJ5A 2AM5A 2ICYA 3V0LA 2JCLA 4Y63A 1VH3A 3CKVA 4FCEA 4J18A 4FRAA 1E5KA 1PZYB 4L41C 4R7PA 4EVWA 5FU0A 2W0WA 1OQMB 1H5RA 5C4FA 1H7LA 3U2UA 3I0KA 5IDSA 3R2WA 5IDTA
chains in the Genus database with same CATH superfamily
2AM4A 3CKOA 4D11C 3U2XA 1IINA 1GX0A 2A8UA 3CU0A 4ZDQA 1IIMA 2RJ9A 3TZTA 3U2VA 2WVMA 3T7NA 1H5TA 1W57A 2ZU7A 2VXMA 3SPTA 5D91A 4DECA 5EJ1A 5L6VA 3V8YA 4AYLA 1YROB 3RMVA 2NXVA 2YCMA 2CU2A 3OKRA 4Q7CA 1LZIA 3V0PA 3PNNA 4FREA 2VFZA 3K8DA 3I0IX 5C1GA 1EZIA 3LW6A 4E1KA 2RJ6A 4FRPA 4Y7GA 1YP3A 5FV9A 1ZDFA 4Y7FA 2FFUA 2XMHA 1S4PA 5CQOA 5C47A 4Y7TA 3FWWA 1V82A 4EE5A 3CKQA 5AJOA 4D11A 1SS9A 2YC5A 2GGQA 4FQWA 2GGOA 2ZU9A 1R7UA 1QGQA 3SXCA 4YS8A 1HM9A 1WT1A 1NHEB 3D5NA 5C8RA 1NKHB 4FIYA 5AJNA 4ASJA 5IFYA 2W0VA 2WGZA 2XWLA 2FYBA 5C49A 2PGYA 2RIYA 4FRDA 5BXCA 1H7EA 1O23B 1VH1A 1TVYA 1QG8A 1TW1A 3V8ZA 5J49A 1R81A 2V0HA 3PKQA 2FY7A 2FFVA 3DJ4A 1V83A 3NGWA 1LL3A 1H7QA 4EEAA 3SXGA 2UX8A 1NWGB 4CVHA 1MC3A 1FR8A 2OI7A 1FGGA 3SX3A 1O7QA 3QVBA 1LVWA 3I0DA 2RIZA 2Y7AA 2V0LA 2X5ZA 2V0IA 1H5SC 4FIXA 1ZJ1A 4G3PA 4HO8A 4G3QA 3I0LA 3SXAA 1S4OA 1K4VA 1ZI3A 1ZI4A 4NANA 1QWJA 1V84A 2I5EA 3DK5A 1LZ7A 4HO2A 3IOJA 3EE5A 1O7OA 2OEFA 2Z86A 5C4BA 2P6WA 4JISA 1H4EA 4MYBA 1S4NA 1WSZA 2JCKA 2BO4A 1MP4A 2E8BA 2Y4LA 3V90A 5C36A 1VZTA 1YP2A 1Z90A 3DUVA 3F1YA 4B2XA 3I0JA 2VSIA 1FWYA 1HJJA 4JD0A 4KRVA 2YQCA 4KC2A 3U2WA 2VS5A 1VGUA 2O1GA 2ICXA 1GWVA 2VXLA 1LZJA 1ON8A 1INJA 1XZ6A 2X65A 5C48A 3CKNA 2OI6A 1GQCA 2V0JA 5FYEA 4D0TA 5CMFX 2I5KA 4KNXA 2WVLA 2QKXA 4HO4A 1ZI5A 4AYJA 2RJ8A 1R7XA 1JYKA 1JV1A 2X5SA 4ARWA 2Y4JA 1G8OA 2VK9A 2YQSA 3ST8A 2FYAA 5CMIA 3ZGGA 4B2WA 1H3MA 1ZJOA 1VGTA 1NQIB 3OH4A 1NF5B 2BO6A 5CMGX 1MP3A 3ZLLA 1O0RA 3JUJA 2AESA 2AE7A 5HS2A 3GUEA 3OAMA 2AM3A 3IOHA 4Y64A 3TQDA 1ZCVA 2QGIA 1ZHJA 1VICA 2AECA 2WAWA 4KXOA 4HO6A 1W77A 4Y6NA 3D98A 1ZI1A 4HG6A 5C1LA 4O6NA 4AC3A 2XWMA 1FG5N 5C1HA 3V0MA 1H4DA 1JVGA 1OMZA 4EEGA 5I1FA 4ASYA 2DPWA 4B42A 1XHBA 3OGZA 4EEOA 2C0NA 1FR9A 5L6SA 3PKPA 1FRWA 4HO0A 2O1HA 2WVKA 2Q4JA 4AAWA 3K8EA 1R82A 1VM8A 1HM0A 1VZXA 3OH3A 3U2TA 4C2SA 1JV3A 2YESA 3I0EA 4EEMA 3HL3A 5EIYA 4M28A 1FXJA 1R7VA 4B4MA 3CKJA 4Y7UA 5FUHA 3USRA 4IRQA 4KT7A 5C4DA 4FRHA 4D48A 3CGXA 2BO7A 3SX7A 1ZCTA 5D92A 5CMHA 4DE7A 4FRQA 2ZU8A 1H7TA 1R7YA 1ZCUA 5C38A 4KNRA 4KQLA 4KPZA 2OI5A 5CQMX 3F1CA 4FRMA 5C3DA 5C4EA 1WT3A 3FOQA 4LW3A 2J0AA 2Y6PA 2WEEA 3E26A 1H5RB 3SXEA 2FYCB 4G87A 5CQNX 1HV9A 1WT2A 1YP4A 1ZJ3A 1G2VA 2J0BA 4HO9A 1FZWA 3Q4SA 4P02A 5CQPA 2RJ1A 1FO9A 1GQ9A 3V0OA 4FRLA 2PGVA 1H5TB 3SXDA 2P73A 1TZFA 4CJBA 1LL2A 3T7MA 1G97A 3I0GA 1H7HA 2VSHA 3V91A 2RITA 2WE9A 3O3PA 3Q7UA 1JYLA 2QH5A 4GBPA 1G95A 1H5SA 1H5SD 1FOAA 3KIAA 4M2AA 5DDVA 5C3AA 2D7RA 4NALA 5AJPA 2RIXA 4FROA 4K6RA 4M4KA 5FTVA 4M2BA 3JTJA 4KC1A 2VD4A 1H7GA 4CJ8A 4IRPA 4B4GA 1H7FA 1ZJ2A 2FYDB 4HO3A 3OH1A 1R80A 3U0YA 1WT0A 1VGWA 3I0FA 4HCQA 3USQA 1G0RA 1ZJPA 3ZLKA 2I7BA 3T7OA 5JQQA 4HO5A 1G93A 1GWWA 2Y4MA 2AGDA 1WVCA 4EE4A 1INIA 2BO8A 5C3BA 2XWNA 4LW6A 3ZF8A 3Q80A 4FRBA 1G9RA 1HM8A 4BQHA 1MP5A 1KWSA 1VZUA 4EE3A 4DDZA 2AH9A 3SX5A 2OEGA 2O1FA 3R3IA 4FCUA 1G3LA 2JCOA 5C4CA 4KPXA 2VS4A 4B3UA 1JVDA 3D8VA 2YC3A 2MZBA 3I0HA 4XWIA 2PA4A 5DDTA 1GX4A 2XMEA 1FO8A 3SX8A 3BRKX 4P00A 1HJLA 3E25A 2YQHA 1FXOA 4Y6UA 4HOCA 2JCJA 2X60A 1W55A 1R7TA 3JUKA 4Y7VA 2P72A 1EYRA 1QGSA 4BMAA 1ZDGA 3BCVA 3OH2A 4Y62A 2V0KA 4Y9XA 1OMXA 1PZTA 3U0XA 4B4BA 2VS3A 3I0CA 1H4CA 2A8WA 3RSBA 1LL0A 1LZ0A 3SXBA 1GA8A 3RMWA 1NMMB 1ZIZA 3V0NA 2D7IA 5FU8A 2APCA 1G23A 2D0JA 4D0ZA 2YQJA 3IOIA 5CMJA 1ZCYA 4G3SA 3POLA 1I52A 4MIXA 3V0QA 4O6MA 1FGXA 2RJ0A 5FTSA 4UEGA 3OH0A 1H5SB 1ZJ0A 4CJCA 4KC4A 3N9WA 4ECMA 1G1LA 1VPAA 2RJ7A 4NAKA 2E3DA 2RJ4A 5EJZA 2Z87A 5CQLX 1ON6A 4MNDA 3OC9A 4B5BA 4NAIA 2Y4KA 1VGZA 2PX7A 3ZGFA 1TW5A 2RJ5A 2AM5A 2ICYA 3V0LA 2JCLA 4Y63A 1VH3A 3CKVA 4FCEA 4J18A 4FRAA 1E5KA 1PZYB 4L41C 4R7PA 4EVWA 5FU0A 2W0WA 1OQMB 1H5RA 5C4FA 1H7LA 3U2UA 3I0KA 5IDSA 3R2WA 5IDTA
chains in the Genus database with same CATH topology
2AM4A 3CKOA 4D11C 3U2XA 1IINA 1GX0A 2A8UA 3CU0A 4ZDQA 1IIMA 2RJ9A 3TZTA 3U2VA 2WVMA 3T7NA 1H5TA 1W57A 2ZU7A 2VXMA 3SPTA 5D91A 4DECA 5EJ1A 5L6VA 3V8YA 4AYLA 1YROB 3RMVA 2NXVA 2YCMA 2CU2A 3OKRA 4Q7CA 1LZIA 3V0PA 3PNNA 4FREA 2VFZA 3K8DA 3I0IX 5C1GA 1EZIA 3LW6A 4E1KA 2RJ6A 4FRPA 4Y7GA 1YP3A 5FV9A 1ZDFA 4Y7FA 2FFUA 2XMHA 1S4PA 5CQOA 5C47A 4Y7TA 3FWWA 1V82A 4EE5A 3CKQA 5AJOA 4D11A 1SS9A 2YC5A 2GGQA 4FQWA 2GGOA 2ZU9A 1R7UA 1QGQA 3SXCA 4YS8A 1HM9A 1WT1A 1NHEB 3D5NA 5C8RA 1NKHB 4FIYA 5AJNA 4ASJA 5IFYA 2W0VA 2WGZA 2XWLA 2FYBA 5C49A 2PGYA 2RIYA 4FRDA 5BXCA 1H7EA 1O23B 1VH1A 1TVYA 1QG8A 1TW1A 3V8ZA 5J49A 1R81A 2V0HA 3PKQA 2FY7A 2FFVA 3DJ4A 1V83A 3NGWA 1LL3A 1H7QA 4EEAA 3SXGA 2UX8A 1NWGB 4CVHA 1MC3A 1FR8A 2OI7A 1FGGA 3SX3A 1O7QA 3QVBA 1LVWA 3I0DA 2RIZA 2Y7AA 2V0LA 2X5ZA 2V0IA 1H5SC 4FIXA 1ZJ1A 4G3PA 4HO8A 4G3QA 3I0LA 3SXAA 1S4OA 1K4VA 1ZI3A 1ZI4A 4NANA 1QWJA 1V84A 2I5EA 3DK5A 1LZ7A 4HO2A 3IOJA 3EE5A 1O7OA 2OEFA 2Z86A 5C4BA 2P6WA 4JISA 1H4EA 4MYBA 1S4NA 1WSZA 2JCKA 2BO4A 1MP4A 2E8BA 2Y4LA 3V90A 5C36A 1VZTA 1YP2A 1Z90A 3DUVA 3F1YA 4B2XA 3I0JA 2VSIA 1FWYA 1HJJA 4JD0A 4KRVA 2YQCA 4KC2A 3U2WA 2VS5A 1VGUA 2O1GA 2ICXA 1GWVA 2VXLA 1LZJA 1ON8A 1INJA 1XZ6A 2X65A 5C48A 3CKNA 2OI6A 1GQCA 2V0JA 5FYEA 4D0TA 5CMFX 2I5KA 4KNXA 2WVLA 2QKXA 4HO4A 1ZI5A 4AYJA 2RJ8A 1R7XA 1JYKA 1JV1A 2X5SA 4ARWA 2Y4JA 1G8OA 2VK9A 2YQSA 3ST8A 2FYAA 5CMIA 3ZGGA 4B2WA 1H3MA 1ZJOA 1VGTA 1NQIB 3OH4A 1NF5B 2BO6A 5CMGX 1MP3A 3ZLLA 1O0RA 3JUJA 2AESA 2AE7A 5HS2A 3GUEA 3OAMA 2AM3A 3IOHA 4Y64A 3TQDA 1ZCVA 2QGIA 1ZHJA 1VICA 2AECA 2WAWA 4KXOA 4HO6A 1W77A 4Y6NA 3D98A 1ZI1A 4HG6A 5C1LA 4O6NA 4AC3A 2XWMA 1FG5N 5C1HA 3V0MA 1H4DA 1JVGA 1OMZA 4EEGA 5I1FA 4ASYA 2DPWA 4B42A 1XHBA 3OGZA 4EEOA 2C0NA 1FR9A 5L6SA 3PKPA 1FRWA 4HO0A 2O1HA 2WVKA 2Q4JA 4AAWA 3K8EA 1R82A 1VM8A 1HM0A 1VZXA 3OH3A 3U2TA 4C2SA 1JV3A 2YESA 3I0EA 4EEMA 3HL3A 5EIYA 4M28A 1FXJA 1R7VA 4B4MA 3CKJA 4Y7UA 5FUHA 3USRA 4IRQA 4KT7A 5C4DA 4FRHA 4D48A 3CGXA 2BO7A 3SX7A 1ZCTA 5D92A 5CMHA 4DE7A 4FRQA 2ZU8A 1H7TA 1R7YA 1ZCUA 5C38A 4KNRA 4KQLA 4KPZA 2OI5A 5CQMX 3F1CA 4FRMA 5C3DA 5C4EA 1WT3A 3FOQA 4LW3A 2J0AA 2Y6PA 2WEEA 3E26A 1H5RB 3SXEA 2FYCB 4G87A 5CQNX 1HV9A 1WT2A 1YP4A 1ZJ3A 1G2VA 2J0BA 4HO9A 1FZWA 3Q4SA 4P02A 5CQPA 2RJ1A 1FO9A 1GQ9A 3V0OA 4FRLA 2PGVA 1H5TB 3SXDA 2P73A 1TZFA 4CJBA 1LL2A 3T7MA 1G97A 3I0GA 1H7HA 2VSHA 3V91A 2RITA 2WE9A 3O3PA 3Q7UA 1JYLA 2QH5A 4GBPA 1G95A 1H5SA 1H5SD 1FOAA 3KIAA 4M2AA 5DDVA 5C3AA 2D7RA 4NALA 5AJPA 2RIXA 4FROA 4K6RA 4M4KA 5FTVA 4M2BA 3JTJA 4KC1A 2VD4A 1H7GA 4CJ8A 4IRPA 4B4GA 1H7FA 1ZJ2A 2FYDB 4HO3A 3OH1A 1R80A 3U0YA 1WT0A 1VGWA 3I0FA 4HCQA 3USQA 1G0RA 1ZJPA 3ZLKA 2I7BA 3T7OA 5JQQA 4HO5A 1G93A 1GWWA 2Y4MA 2AGDA 1WVCA 4EE4A 1INIA 2BO8A 5C3BA 2XWNA 4LW6A 3ZF8A 3Q80A 4FRBA 1G9RA 1HM8A 4BQHA 1MP5A 1KWSA 1VZUA 4EE3A 4DDZA 2AH9A 3SX5A 2OEGA 2O1FA 3R3IA 4FCUA 1G3LA 2JCOA 5C4CA 4KPXA 2VS4A 4B3UA 1JVDA 3D8VA 2YC3A 2MZBA 3I0HA 4XWIA 2PA4A 5DDTA 1GX4A 2XMEA 1FO8A 3SX8A 3BRKX 4P00A 1HJLA 3E25A 2YQHA 1FXOA 4Y6UA 4HOCA 2JCJA 2X60A 1W55A 1R7TA 3JUKA 4Y7VA 2P72A 1EYRA 1QGSA 4BMAA 1ZDGA 3BCVA 3OH2A 4Y62A 2V0KA 4Y9XA 1OMXA 1PZTA 3U0XA 4B4BA 2VS3A 3I0CA 1H4CA 2A8WA 3RSBA 1LL0A 1LZ0A 3SXBA 1GA8A 3RMWA 1NMMB 1ZIZA 3V0NA 2D7IA 5FU8A 2APCA 1G23A 2D0JA 4D0ZA 2YQJA 3IOIA 5CMJA 1ZCYA 4G3SA 3POLA 1I52A 4MIXA 3V0QA 4O6MA 1FGXA 2RJ0A 5FTSA 4UEGA 3OH0A 1H5SB 1ZJ0A 4CJCA 4KC4A 3N9WA 4ECMA 1G1LA 1VPAA 2RJ7A 4NAKA 2E3DA 2RJ4A 5EJZA 2Z87A 5CQLX 1ON6A 4MNDA 3OC9A 4B5BA 4NAIA 2Y4KA 1VGZA 2PX7A 3ZGFA 1TW5A 2RJ5A 2AM5A 2ICYA 3V0LA 2JCLA 4Y63A 1VH3A 3CKVA 4FCEA 4J18A 4FRAA 1E5KA 1PZYB 4L41C 4R7PA 4EVWA 5FU0A 2W0WA 1OQMB 1H5RA 5C4FA 1H7LA 3U2UA 3I0KA 5IDSA 3R2WA 5IDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AM4 A;  3CKO A;  4D11 C;  3U2X A;  1IIN A;  1GX0 A;  2A8U A;  3CU0 A;  4ZDQ A;  1IIM A;  2RJ9 A;  3TZT A;  3U2V A;  2WVM A;  3T7N A;  1H5T A;  1W57 A;  2ZU7 A;  2VXM A;  3SPT A;  4DEC A;  5EJ1 A;  5L6V A;  3V8Y A;  4AYL A;  1YRO B;  3RMV A;  2NXV A;  2YCM A;  2CU2 A;  3OKR A;  1LZI A;  3V0P A;  3PNN A;  4FRE A;  2VFZ A;  3K8D A;  3I0I X;  5C1G A;  1EZI A;  3LW6 A;  4E1K A;  2RJ6 A;  4FRP A;  4Y7G A;  1YP3 A;  5FV9 A;  1ZDF A;  4Y7F A;  2FFU A;  2XMH A;  1S4P A;  5CQO A;  5C47 A;  4Y7T A;  3FWW A;  1V82 A;  4EE5 A;  3CKQ A;  5AJO A;  4D11 A;  1SS9 A;  2YC5 A;  2GGQ A;  4FQW A;  2GGO A;  2ZU9 A;  1R7U A;  1QGQ A;  3SXC A;  4YS8 A;  1HM9 A;  1WT1 A;  1NHE B;  3D5N A;  5C8R A;  1NKH B;  5AJN A;  4ASJ A;  5IFY A;  2W0V A;  2WGZ A;  2XWL A;  2FYB A;  5C49 A;  2PGY A;  2RIY A;  4FRD A;  5BXC A;  1H7E A;  1O23 B;  1VH1 A;  1TVY A;  1QG8 A;  1TW1 A;  3V8Z A;  5J49 A;  1R81 A;  2V0H A;  3PKQ A;  2FY7 A;  2FFV A;  3DJ4 A;  1V83 A;  3NGW A;  1LL3 A;  1H7Q A;  4EEA A;  3SXG A;  2UX8 A;  1NWG B;  4CVH A;  1MC3 A;  1FR8 A;  2OI7 A;  1FGG A;  3SX3 A;  1O7Q A;  3QVB A;  1LVW A;  3I0D A;  2RIZ A;  2Y7A A;  2V0L A;  2X5Z A;  2V0I A;  1H5S C;  1ZJ1 A;  4G3P A;  4HO8 A;  4G3Q A;  3I0L A;  3SXA A;  1S4O A;  1K4V A;  1ZI3 A;  1ZI4 A;  4NAN A;  1QWJ A;  1V84 A;  2I5E A;  3DK5 A;  1LZ7 A;  4HO2 A;  3IOJ A;  3EE5 A;  1O7O A;  2OEF A;  2Z86 A;  5C4B A;  2P6W A;  4JIS A;  1H4E A;  4MYB A;  1S4N A;  1WSZ A;  2JCK A;  2BO4 A;  1MP4 A;  2E8B A;  2Y4L A;  3V90 A;  5C36 A;  1VZT A;  1YP2 A;  1Z90 A;  3DUV A;  3F1Y A;  4B2X A;  3I0J A;  2VSI A;  1FWY A;  1HJJ A;  4JD0 A;  4KRV A;  2YQC A;  4KC2 A;  3U2W A;  2VS5 A;  1VGU A;  2O1G A;  2ICX A;  1GWV A;  2VXL A;  1LZJ A;  1ON8 A;  1INJ A;  1XZ6 A;  2X65 A;  5C48 A;  3CKN A;  2OI6 A;  1GQC A;  2V0J A;  5FYE A;  4D0T A;  5CMF X;  2I5K A;  4KNX A;  2WVL A;  2QKX A;  4HO4 A;  1ZI5 A;  4AYJ A;  2RJ8 A;  1R7X A;  1JYK A;  1JV1 A;  2X5S A;  4ARW A;  2Y4J A;  1G8O A;  2YQS A;  3ST8 A;  2FYA A;  5CMI A;  3ZGG A;  4B2W A;  1H3M A;  1ZJO A;  1VGT A;  1NQI B;  3OH4 A;  1NF5 B;  2BO6 A;  5CMG X;  1MP3 A;  3ZLL A;  1O0R A;  3JUJ A;  2AES A;  2AE7 A;  5HS2 A;  3GUE A;  3OAM A;  2AM3 A;  3IOH A;  4Y64 A;  3TQD A;  1ZCV A;  2QGI A;  1ZHJ A;  1VIC A;  2AEC A;  2WAW A;  4KXO A;  4HO6 A;  1W77 A;  4Y6N A;  3D98 A;  1ZI1 A;  4HG6 A;  5C1L A;  4AC3 A;  2XWM A;  1FG5 N;  5C1H A;  3V0M A;  1H4D A;  1JVG A;  1OMZ A;  4EEG A;  5I1F A;  4ASY A;  2DPW A;  4B42 A;  1XHB A;  3OGZ A;  4EEO A;  1FR9 A;  5L6S A;  3PKP A;  1FRW A;  4HO0 A;  2O1H A;  2WVK A;  2Q4J A;  4AAW A;  3K8E A;  1R82 A;  1VM8 A;  1HM0 A;  1VZX A;  3OH3 A;  3U2T A;  4C2S A;  1JV3 A;  2YES A;  3I0E A;  4EEM A;  3HL3 A;  5EIY A;  4M28 A;  1FXJ A;  1R7V A;  4B4M A;  3CKJ A;  4Y7U A;  5FUH A;  3USR A;  4IRQ A;  4KT7 A;  5C4D A;  4FRH A;  4D48 A;  3CGX A;  2BO7 A;  3SX7 A;  1ZCT A;  5CMH A;  4DE7 A;  4FRQ A;  2ZU8 A;  1H7T A;  1R7Y A;  1ZCU A;  5C38 A;  4KNR A;  4KQL A;  4KPZ A;  2OI5 A;  5CQM X;  3F1C A;  4FRM A;  5C3D A;  5C4E A;  1WT3 A;  3FOQ A;  4LW3 A;  2Y6P A;  2WEE A;  3E26 A;  1H5R B;  3SXE A;  2FYC B;  4G87 A;  5CQN X;  1HV9 A;  1WT2 A;  1YP4 A;  1ZJ3 A;  1G2V A;  4HO9 A;  1FZW A;  3Q4S A;  4P02 A;  5CQP A;  2RJ1 A;  1FO9 A;  1GQ9 A;  3V0O A;  4FRL A;  2PGV A;  1H5T B;  3SXD A;  2P73 A;  1TZF A;  4CJB A;  1LL2 A;  3T7M A;  1G97 A;  3I0G A;  1H7H A;  2VSH A;  3V91 A;  2RIT A;  2WE9 A;  3O3P A;  3Q7U A;  1JYL A;  2QH5 A;  4GBP A;  1G95 A;  1H5S A;  1H5S D;  1FOA A;  3KIA A;  4M2A A;  5DDV A;  5C3A A;  2D7R A;  4NAL A;  5AJP A;  2RIX A;  4FRO A;  4K6R A;  4M4K A;  5FTV A;  4M2B A;  3JTJ A;  4KC1 A;  2VD4 A;  1H7G A;  4CJ8 A;  4IRP A;  4B4G A;  1H7F A;  1ZJ2 A;  2FYD B;  4HO3 A;  3OH1 A;  1R80 A;  3U0Y A;  1WT0 A;  1VGW A;  3I0F A;  4HCQ A;  3USQ A;  1G0R A;  1ZJP A;  3ZLK A;  2I7B A;  3T7O A;  5JQQ A;  4HO5 A;  1G93 A;  1GWW A;  2Y4M A;  2AGD A;  1WVC A;  4EE4 A;  1INI A;  2BO8 A;  5C3B A;  2XWN A;  4LW6 A;  3ZF8 A;  3Q80 A;  4FRB A;  1G9R A;  1HM8 A;  4BQH A;  1MP5 A;  1KWS A;  1VZU A;  4EE3 A;  4DDZ A;  2AH9 A;  3SX5 A;  2OEG A;  2O1F A;  3R3I A;  4FCU A;  1G3L A;  2JCO A;  5C4C A;  4KPX A;  2VS4 A;  4B3U A;  1JVD A;  3D8V A;  2YC3 A;  2MZB A;  3I0H A;  4XWI A;  2PA4 A;  5DDT A;  1GX4 A;  2XME A;  1FO8 A;  3SX8 A;  3BRK X;  4P00 A;  1HJL A;  3E25 A;  2YQH A;  1FXO A;  4Y6U A;  4HOC A;  2JCJ A;  2X60 A;  1W55 A;  1R7T A;  3JUK A;  4Y7V A;  2P72 A;  1EYR A;  1QGS A;  4BMA A;  1ZDG A;  3BCV A;  3OH2 A;  4Y62 A;  2V0K A;  4Y9X A;  1OMX A;  1PZT A;  3U0X A;  4B4B A;  2VS3 A;  3I0C A;  1H4C A;  2A8W A;  3RSB A;  1LL0 A;  1LZ0 A;  3SXB A;  1GA8 A;  3RMW A;  1NMM B;  1ZIZ A;  3V0N A;  2D7I A;  5FU8 A;  2APC A;  1G23 A;  2D0J A;  4D0Z A;  2YQJ A;  3IOI A;  5CMJ A;  1ZCY A;  4G3S A;  3POL A;  1I52 A;  3V0Q A;  1FGX A;  2RJ0 A;  5FTS A;  4UEG A;  3OH0 A;  1H5S B;  1ZJ0 A;  4CJC A;  4KC4 A;  3N9W A;  4ECM A;  1G1L A;  1VPA A;  2RJ7 A;  4NAK A;  2E3D A;  2RJ4 A;  5EJZ A;  2Z87 A;  5CQL X;  1ON6 A;  4MND A;  3OC9 A;  4B5B A;  4NAI A;  2Y4K A;  1VGZ A;  2PX7 A;  3ZGF A;  1TW5 A;  2RJ5 A;  2AM5 A;  2ICY A;  3V0L A;  2JCL A;  4Y63 A;  1VH3 A;  3CKV A;  4FCE A;  4J18 A;  4FRA A;  1E5K A;  1PZY B;  4L41 C;  4R7P A;  4EVW A;  5FU0 A;  2W0W A;  1OQM B;  1H5R A;  5C4F A;  1H7L A;  3U2U A;  3I0K A;  5IDS A;  3R2W A;  5IDT A; 
#chains in the Genus database with same CATH topology
 2AM4 A;  3CKO A;  4D11 C;  3U2X A;  1IIN A;  1GX0 A;  2A8U A;  3CU0 A;  4ZDQ A;  1IIM A;  2RJ9 A;  3TZT A;  3U2V A;  2WVM A;  3T7N A;  1H5T A;  1W57 A;  2ZU7 A;  2VXM A;  3SPT A;  5D91 A;  4DEC A;  5EJ1 A;  5L6V A;  3V8Y A;  4AYL A;  1YRO B;  3RMV A;  2NXV A;  2YCM A;  2CU2 A;  3OKR A;  4Q7C A;  1LZI A;  3V0P A;  3PNN A;  4FRE A;  2VFZ A;  3K8D A;  3I0I X;  5C1G A;  1EZI A;  3LW6 A;  4E1K A;  2RJ6 A;  4FRP A;  4Y7G A;  1YP3 A;  5FV9 A;  1ZDF A;  4Y7F A;  2FFU A;  2XMH A;  1S4P A;  5CQO A;  5C47 A;  4Y7T A;  3FWW A;  1V82 A;  4EE5 A;  3CKQ A;  5AJO A;  4D11 A;  1SS9 A;  2YC5 A;  2GGQ A;  4FQW A;  2GGO A;  2ZU9 A;  1R7U A;  1QGQ A;  3SXC A;  4YS8 A;  1HM9 A;  1WT1 A;  1NHE B;  3D5N A;  5C8R A;  1NKH B;  4FIY A;  5AJN A;  4ASJ A;  5IFY A;  2W0V A;  2WGZ A;  2XWL A;  2FYB A;  5C49 A;  2PGY A;  2RIY A;  4FRD A;  5BXC A;  1H7E A;  1O23 B;  1VH1 A;  1TVY A;  1QG8 A;  1TW1 A;  3V8Z A;  5J49 A;  1R81 A;  2V0H A;  3PKQ A;  2FY7 A;  2FFV A;  3DJ4 A;  1V83 A;  3NGW A;  1LL3 A;  1H7Q A;  4EEA A;  3SXG A;  2UX8 A;  1NWG B;  4CVH A;  1MC3 A;  1FR8 A;  2OI7 A;  1FGG A;  3SX3 A;  1O7Q A;  3QVB A;  1LVW A;  3I0D A;  2RIZ A;  2Y7A A;  2V0L A;  2X5Z A;  2V0I A;  1H5S C;  4FIX A;  1ZJ1 A;  4G3P A;  4HO8 A;  4G3Q A;  3I0L A;  3SXA A;  1S4O A;  1K4V A;  1ZI3 A;  1ZI4 A;  4NAN A;  1QWJ A;  1V84 A;  2I5E A;  3DK5 A;  1LZ7 A;  4HO2 A;  3IOJ A;  3EE5 A;  1O7O A;  2OEF A;  2Z86 A;  5C4B A;  2P6W A;  4JIS A;  1H4E A;  4MYB A;  1S4N A;  1WSZ A;  2JCK A;  2BO4 A;  1MP4 A;  2E8B A;  2Y4L A;  3V90 A;  5C36 A;  1VZT A;  1YP2 A;  1Z90 A;  3DUV A;  3F1Y A;  4B2X A;  3I0J A;  2VSI A;  1FWY A;  1HJJ A;  4JD0 A;  4KRV A;  2YQC A;  4KC2 A;  3U2W A;  2VS5 A;  1VGU A;  2O1G A;  2ICX A;  1GWV A;  2VXL A;  1LZJ A;  1ON8 A;  1INJ A;  1XZ6 A;  2X65 A;  5C48 A;  3CKN A;  2OI6 A;  1GQC A;  2V0J A;  5FYE A;  4D0T A;  5CMF X;  2I5K A;  4KNX A;  2WVL A;  2QKX A;  4HO4 A;  1ZI5 A;  4AYJ A;  2RJ8 A;  1R7X A;  1JYK A;  1JV1 A;  2X5S A;  4ARW A;  2Y4J A;  1G8O A;  2VK9 A;  2YQS A;  3ST8 A;  2FYA A;  5CMI A;  3ZGG A;  4B2W A;  1H3M A;  1ZJO A;  1VGT A;  1NQI B;  3OH4 A;  1NF5 B;  2BO6 A;  5CMG X;  1MP3 A;  3ZLL A;  1O0R A;  3JUJ A;  2AES A;  2AE7 A;  5HS2 A;  3GUE A;  3OAM A;  2AM3 A;  3IOH A;  4Y64 A;  3TQD A;  1ZCV A;  2QGI A;  1ZHJ A;  1VIC A;  2AEC A;  2WAW A;  4KXO A;  4HO6 A;  1W77 A;  4Y6N A;  3D98 A;  1ZI1 A;  4HG6 A;  5C1L A;  4O6N A;  4AC3 A;  2XWM A;  1FG5 N;  5C1H A;  3V0M A;  1H4D A;  1JVG A;  1OMZ A;  4EEG A;  5I1F A;  4ASY A;  2DPW A;  4B42 A;  1XHB A;  3OGZ A;  4EEO A;  2C0N A;  1FR9 A;  5L6S A;  3PKP A;  1FRW A;  4HO0 A;  2O1H A;  2WVK A;  2Q4J A;  4AAW A;  3K8E A;  1R82 A;  1VM8 A;  1HM0 A;  1VZX A;  3OH3 A;  3U2T A;  4C2S A;  1JV3 A;  2YES A;  3I0E A;  4EEM A;  3HL3 A;  5EIY A;  4M28 A;  1FXJ A;  1R7V A;  4B4M A;  3CKJ A;  4Y7U A;  5FUH A;  3USR A;  4IRQ A;  4KT7 A;  5C4D A;  4FRH A;  4D48 A;  3CGX A;  2BO7 A;  3SX7 A;  1ZCT A;  5D92 A;  5CMH A;  4DE7 A;  4FRQ A;  2ZU8 A;  1H7T A;  1R7Y A;  1ZCU A;  5C38 A;  4KNR A;  4KQL A;  4KPZ A;  2OI5 A;  5CQM X;  3F1C A;  4FRM A;  5C3D A;  5C4E A;  1WT3 A;  3FOQ A;  4LW3 A;  2J0A A;  2Y6P A;  2WEE A;  3E26 A;  1H5R B;  3SXE A;  2FYC B;  4G87 A;  5CQN X;  1HV9 A;  1WT2 A;  1YP4 A;  1ZJ3 A;  1G2V A;  2J0B A;  4HO9 A;  1FZW A;  3Q4S A;  4P02 A;  5CQP A;  2RJ1 A;  1FO9 A;  1GQ9 A;  3V0O A;  4FRL A;  2PGV A;  1H5T B;  3SXD A;  2P73 A;  1TZF A;  4CJB A;  1LL2 A;  3T7M A;  1G97 A;  3I0G A;  1H7H A;  2VSH A;  3V91 A;  2RIT A;  2WE9 A;  3O3P A;  3Q7U A;  1JYL A;  2QH5 A;  4GBP A;  1G95 A;  1H5S A;  1H5S D;  1FOA A;  3KIA A;  4M2A A;  5DDV A;  5C3A A;  2D7R A;  4NAL A;  5AJP A;  2RIX A;  4FRO A;  4K6R A;  4M4K A;  5FTV A;  4M2B A;  3JTJ A;  4KC1 A;  2VD4 A;  1H7G A;  4CJ8 A;  4IRP A;  4B4G A;  1H7F A;  1ZJ2 A;  2FYD B;  4HO3 A;  3OH1 A;  1R80 A;  3U0Y A;  1WT0 A;  1VGW A;  3I0F A;  4HCQ A;  3USQ A;  1G0R A;  1ZJP A;  3ZLK A;  2I7B A;  3T7O A;  5JQQ A;  4HO5 A;  1G93 A;  1GWW A;  2Y4M A;  2AGD A;  1WVC A;  4EE4 A;  1INI A;  2BO8 A;  5C3B A;  2XWN A;  4LW6 A;  3ZF8 A;  3Q80 A;  4FRB A;  1G9R A;  1HM8 A;  4BQH A;  1MP5 A;  1KWS A;  1VZU A;  4EE3 A;  4DDZ A;  2AH9 A;  3SX5 A;  2OEG A;  2O1F A;  3R3I A;  4FCU A;  1G3L A;  2JCO A;  5C4C A;  4KPX A;  2VS4 A;  4B3U A;  1JVD A;  3D8V A;  2YC3 A;  2MZB A;  3I0H A;  4XWI A;  2PA4 A;  5DDT A;  1GX4 A;  2XME A;  1FO8 A;  3SX8 A;  3BRK X;  4P00 A;  1HJL A;  3E25 A;  2YQH A;  1FXO A;  4Y6U A;  4HOC A;  2JCJ A;  2X60 A;  1W55 A;  1R7T A;  3JUK A;  4Y7V A;  2P72 A;  1EYR A;  1QGS A;  4BMA A;  1ZDG A;  3BCV A;  3OH2 A;  4Y62 A;  2V0K A;  4Y9X A;  1OMX A;  1PZT A;  3U0X A;  4B4B A;  2VS3 A;  3I0C A;  1H4C A;  2A8W A;  3RSB A;  1LL0 A;  1LZ0 A;  3SXB A;  1GA8 A;  3RMW A;  1NMM B;  1ZIZ A;  3V0N A;  2D7I A;  5FU8 A;  2APC A;  1G23 A;  2D0J A;  4D0Z A;  2YQJ A;  3IOI A;  5CMJ A;  1ZCY A;  4G3S A;  3POL A;  1I52 A;  4MIX A;  3V0Q A;  4O6M A;  1FGX A;  2RJ0 A;  5FTS A;  4UEG A;  3OH0 A;  1H5S B;  1ZJ0 A;  4CJC A;  4KC4 A;  3N9W A;  4ECM A;  1G1L A;  1VPA A;  2RJ7 A;  4NAK A;  2E3D A;  2RJ4 A;  5EJZ A;  2Z87 A;  5CQL X;  1ON6 A;  4MND A;  3OC9 A;  4B5B A;  4NAI A;  2Y4K A;  1VGZ A;  2PX7 A;  3ZGF A;  1TW5 A;  2RJ5 A;  2AM5 A;  2ICY A;  3V0L A;  2JCL A;  4Y63 A;  1VH3 A;  3CKV A;  4FCE A;  4J18 A;  4FRA A;  1E5K A;  1PZY B;  4L41 C;  4R7P A;  4EVW A;  5FU0 A;  2W0W A;  1OQM B;  1H5R A;  5C4F A;  1H7L A;  3U2U A;  3I0K A;  5IDS A;  3R2W A;  5IDT A; 
#chains in the Genus database with same CATH homology
 2AM4 A;  3CKO A;  4D11 C;  3U2X A;  1IIN A;  1GX0 A;  2A8U A;  3CU0 A;  4ZDQ A;  1IIM A;  2RJ9 A;  3TZT A;  3U2V A;  2WVM A;  3T7N A;  1H5T A;  1W57 A;  2ZU7 A;  2VXM A;  3SPT A;  5D91 A;  4DEC A;  5EJ1 A;  5L6V A;  3V8Y A;  4AYL A;  1YRO B;  3RMV A;  2NXV A;  2YCM A;  2CU2 A;  3OKR A;  4Q7C A;  1LZI A;  3V0P A;  3PNN A;  4FRE A;  2VFZ A;  3K8D A;  3I0I X;  5C1G A;  1EZI A;  3LW6 A;  4E1K A;  2RJ6 A;  4FRP A;  4Y7G A;  1YP3 A;  5FV9 A;  1ZDF A;  4Y7F A;  2FFU A;  2XMH A;  1S4P A;  5CQO A;  5C47 A;  4Y7T A;  3FWW A;  1V82 A;  4EE5 A;  3CKQ A;  5AJO A;  4D11 A;  1SS9 A;  2YC5 A;  2GGQ A;  4FQW A;  2GGO A;  2ZU9 A;  1R7U A;  1QGQ A;  3SXC A;  4YS8 A;  1HM9 A;  1WT1 A;  1NHE B;  3D5N A;  5C8R A;  1NKH B;  4FIY A;  5AJN A;  4ASJ A;  5IFY A;  2W0V A;  2WGZ A;  2XWL A;  2FYB A;  5C49 A;  2PGY A;  2RIY A;  4FRD A;  5BXC A;  1H7E A;  1O23 B;  1VH1 A;  1TVY A;  1QG8 A;  1TW1 A;  3V8Z A;  5J49 A;  1R81 A;  2V0H A;  3PKQ A;  2FY7 A;  2FFV A;  3DJ4 A;  1V83 A;  3NGW A;  1LL3 A;  1H7Q A;  4EEA A;  3SXG A;  2UX8 A;  1NWG B;  4CVH A;  1MC3 A;  1FR8 A;  2OI7 A;  1FGG A;  3SX3 A;  1O7Q A;  3QVB A;  1LVW A;  3I0D A;  2RIZ A;  2Y7A A;  2V0L A;  2X5Z A;  2V0I A;  1H5S C;  4FIX A;  1ZJ1 A;  4G3P A;  4HO8 A;  4G3Q A;  3I0L A;  3SXA A;  1S4O A;  1K4V A;  1ZI3 A;  1ZI4 A;  4NAN A;  1QWJ A;  1V84 A;  2I5E A;  3DK5 A;  1LZ7 A;  4HO2 A;  3IOJ A;  3EE5 A;  1O7O A;  2OEF A;  2Z86 A;  5C4B A;  2P6W A;  4JIS A;  1H4E A;  4MYB A;  1S4N A;  1WSZ A;  2JCK A;  2BO4 A;  1MP4 A;  2E8B A;  2Y4L A;  3V90 A;  5C36 A;  1VZT A;  1YP2 A;  1Z90 A;  3DUV A;  3F1Y A;  4B2X A;  3I0J A;  2VSI A;  1FWY A;  1HJJ A;  4JD0 A;  4KRV A;  2YQC A;  4KC2 A;  3U2W A;  2VS5 A;  1VGU A;  2O1G A;  2ICX A;  1GWV A;  2VXL A;  1LZJ A;  1ON8 A;  1INJ A;  1XZ6 A;  2X65 A;  5C48 A;  3CKN A;  2OI6 A;  1GQC A;  2V0J A;  5FYE A;  4D0T A;  5CMF X;  2I5K A;  4KNX A;  2WVL A;  2QKX A;  4HO4 A;  1ZI5 A;  4AYJ A;  2RJ8 A;  1R7X A;  1JYK A;  1JV1 A;  2X5S A;  4ARW A;  2Y4J A;  1G8O A;  2VK9 A;  2YQS A;  3ST8 A;  2FYA A;  5CMI A;  3ZGG A;  4B2W A;  1H3M A;  1ZJO A;  1VGT A;  1NQI B;  3OH4 A;  1NF5 B;  2BO6 A;  5CMG X;  1MP3 A;  3ZLL A;  1O0R A;  3JUJ A;  2AES A;  2AE7 A;  5HS2 A;  3GUE A;  3OAM A;  2AM3 A;  3IOH A;  4Y64 A;  3TQD A;  1ZCV A;  2QGI A;  1ZHJ A;  1VIC A;  2AEC A;  2WAW A;  4KXO A;  4HO6 A;  1W77 A;  4Y6N A;  3D98 A;  1ZI1 A;  4HG6 A;  5C1L A;  4O6N A;  4AC3 A;  2XWM A;  1FG5 N;  5C1H A;  3V0M A;  1H4D A;  1JVG A;  1OMZ A;  4EEG A;  5I1F A;  4ASY A;  2DPW A;  4B42 A;  1XHB A;  3OGZ A;  4EEO A;  2C0N A;  1FR9 A;  5L6S A;  3PKP A;  1FRW A;  4HO0 A;  2O1H A;  2WVK A;  2Q4J A;  4AAW A;  3K8E A;  1R82 A;  1VM8 A;  1HM0 A;  1VZX A;  3OH3 A;  3U2T A;  4C2S A;  1JV3 A;  2YES A;  3I0E A;  4EEM A;  3HL3 A;  5EIY A;  4M28 A;  1FXJ A;  1R7V A;  4B4M A;  3CKJ A;  4Y7U A;  5FUH A;  3USR A;  4IRQ A;  4KT7 A;  5C4D A;  4FRH A;  4D48 A;  3CGX A;  2BO7 A;  3SX7 A;  1ZCT A;  5D92 A;  5CMH A;  4DE7 A;  4FRQ A;  2ZU8 A;  1H7T A;  1R7Y A;  1ZCU A;  5C38 A;  4KNR A;  4KQL A;  4KPZ A;  2OI5 A;  5CQM X;  3F1C A;  4FRM A;  5C3D A;  5C4E A;  1WT3 A;  3FOQ A;  4LW3 A;  2J0A A;  2Y6P A;  2WEE A;  3E26 A;  1H5R B;  3SXE A;  2FYC B;  4G87 A;  5CQN X;  1HV9 A;  1WT2 A;  1YP4 A;  1ZJ3 A;  1G2V A;  2J0B A;  4HO9 A;  1FZW A;  3Q4S A;  4P02 A;  5CQP A;  2RJ1 A;  1FO9 A;  1GQ9 A;  3V0O A;  4FRL A;  2PGV A;  1H5T B;  3SXD A;  2P73 A;  1TZF A;  4CJB A;  1LL2 A;  3T7M A;  1G97 A;  3I0G A;  1H7H A;  2VSH A;  3V91 A;  2RIT A;  2WE9 A;  3O3P A;  3Q7U A;  1JYL A;  2QH5 A;  4GBP A;  1G95 A;  1H5S A;  1H5S D;  1FOA A;  3KIA A;  4M2A A;  5DDV A;  5C3A A;  2D7R A;  4NAL A;  5AJP A;  2RIX A;  4FRO A;  4K6R A;  4M4K A;  5FTV A;  4M2B A;  3JTJ A;  4KC1 A;  2VD4 A;  1H7G A;  4CJ8 A;  4IRP A;  4B4G A;  1H7F A;  1ZJ2 A;  2FYD B;  4HO3 A;  3OH1 A;  1R80 A;  3U0Y A;  1WT0 A;  1VGW A;  3I0F A;  4HCQ A;  3USQ A;  1G0R A;  1ZJP A;  3ZLK A;  2I7B A;  3T7O A;  5JQQ A;  4HO5 A;  1G93 A;  1GWW A;  2Y4M A;  2AGD A;  1WVC A;  4EE4 A;  1INI A;  2BO8 A;  5C3B A;  2XWN A;  4LW6 A;  3ZF8 A;  3Q80 A;  4FRB A;  1G9R A;  1HM8 A;  4BQH A;  1MP5 A;  1KWS A;  1VZU A;  4EE3 A;  4DDZ A;  2AH9 A;  3SX5 A;  2OEG A;  2O1F A;  3R3I A;  4FCU A;  1G3L A;  2JCO A;  5C4C A;  4KPX A;  2VS4 A;  4B3U A;  1JVD A;  3D8V A;  2YC3 A;  2MZB A;  3I0H A;  4XWI A;  2PA4 A;  5DDT A;  1GX4 A;  2XME A;  1FO8 A;  3SX8 A;  3BRK X;  4P00 A;  1HJL A;  3E25 A;  2YQH A;  1FXO A;  4Y6U A;  4HOC A;  2JCJ A;  2X60 A;  1W55 A;  1R7T A;  3JUK A;  4Y7V A;  2P72 A;  1EYR A;  1QGS A;  4BMA A;  1ZDG A;  3BCV A;  3OH2 A;  4Y62 A;  2V0K A;  4Y9X A;  1OMX A;  1PZT A;  3U0X A;  4B4B A;  2VS3 A;  3I0C A;  1H4C A;  2A8W A;  3RSB A;  1LL0 A;  1LZ0 A;  3SXB A;  1GA8 A;  3RMW A;  1NMM B;  1ZIZ A;  3V0N A;  2D7I A;  5FU8 A;  2APC A;  1G23 A;  2D0J A;  4D0Z A;  2YQJ A;  3IOI A;  5CMJ A;  1ZCY A;  4G3S A;  3POL A;  1I52 A;  4MIX A;  3V0Q A;  4O6M A;  1FGX A;  2RJ0 A;  5FTS A;  4UEG A;  3OH0 A;  1H5S B;  1ZJ0 A;  4CJC A;  4KC4 A;  3N9W A;  4ECM A;  1G1L A;  1VPA A;  2RJ7 A;  4NAK A;  2E3D A;  2RJ4 A;  5EJZ A;  2Z87 A;  5CQL X;  1ON6 A;  4MND A;  3OC9 A;  4B5B A;  4NAI A;  2Y4K A;  1VGZ A;  2PX7 A;  3ZGF A;  1TW5 A;  2RJ5 A;  2AM5 A;  2ICY A;  3V0L A;  2JCL A;  4Y63 A;  1VH3 A;  3CKV A;  4FCE A;  4J18 A;  4FRA A;  1E5K A;  1PZY B;  4L41 C;  4R7P A;  4EVW A;  5FU0 A;  2W0W A;  1OQM B;  1H5R A;  5C4F A;  1H7L A;  3U2U A;  3I0K A;  5IDS A;  3R2W A;  5IDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...