3DUVA

Crystal structure of 3-deoxy-manno-octulosonate cytidylyltransferase from haemophilus influenzae complexed with the substrate 3-deoxy-manno-octulosonate in the-configuration
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
254
structure length
238
Chain Sequence
MSFTVIIPARKPMIQHVFEKALQSGASRVIIATDNENVADVAKSFGAEVCMTSVNHNSGTERLAEVVEKLAIPDNEIIVNIQGDEPLIPPVIVRQVADNLAKFNVNMASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYDRDQFMNLQDVQKVQLSDAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNGERIHVELAKEVPAVGVDTAEDLEKVRAILAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-deoxy-manno-octulosonate cytidylyltransferase
publication title Structure of 3-deoxy-manno-octulosonate cytidylyltransferase from Haemophilus influenzae complexed with the substrate 3-deoxy-manno-octulosonate in the beta-configuration.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 71
structure length 238
sequence length 254
chains with identical sequence B
ec nomenclature ec 2.7.7.38: 3-deoxy-manno-octulosonate cytidylyltransferase.
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02348 CTP_transf_3 Cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3duvA00
2D0JA 3D98A 5BXCA 3JUKA 4EE3A 2ZU7A 3Q80A 1H5SC 1HM9A 1IINA 5C1GA 4NAKA 5EJ1A 4B4BA 2NXVA 4KC1A 2ICXA 2GGOA 3I0GA 2RJ9A 3E25A 1WT0A 1FWYA 1ZDGA 2Y7AA 1ZJ2A 4M28A 5AJPA 2V0HA 4M4KA 1R7XA 3U0YA 5EJZA 4JD0A 1VICA 2D7RA 2P72A 2V0KA 4Y62A 2X5SA 4CVHA 3V8ZA 3V0MA 1GWWA 2GGQA 2RJ5A 1JV1A 3E26A 4Y6NA 2I5EA 5CMJA 1JVDA 1FO8A 3V0PA 1GA8A 5FU8A 1ZCYA 2YESA 1H5SA 2OEGA 3JUJA 5C1LA 1FG5N 3I0LA 3F1CA 3OH0A 5HS2A 2X5ZA 4DECA 2O1HA 2VFZA 1H7HA 5DDTA 5IFYA 1XZ6A 1V84A 4NAIA 2WE9A 4KT7A 1ZJ3A 1S4PA 4C2SA 5AJOA 3ZLLA 5C48A 4Y6UA 1H7TA 4EE5A 4EVWA 1W57A 4FRBA 3USRA 1KWSA 1ZJOA 1QGSA 1G3LA 1G0RA 5CQOA 1VH1A 1EZIA 1VGWA 3CKJA 3O3PA 3N9WA 3OGZA 1H5SD 3OH4A 4B5BA 1OMXA 3RSBA 1H7EA 4ARWA 2WAWA 3SXGA 2V0JA 4D48A 4DDZA 1YP4A 3OC9A 1TVYA 1LL2A 3CKOA 5FU0A 3V0OA 3ZGFA 2AESA 3FOQA 4HCQA 1ZJ1A 3DUVA 4G3SA 1MP4A 2WVMA 5C36A 3Q7UA 3TQDA 4Y7FA 2OI7A 2O1FA 1H5TA 1HJJA 5CMFX 1MP5A 4EEGA 1FR9A 1FXJA 1H3MA 4AYLA 2I7BA 2ZU9A 2XMHA 2RIXA 4G87A 3U2UA 1ON6A 2D7IA 3PNNA 2Y4JA 1HM8A 4FRHA 3U2XA 2YQJA 4Y7GA 2A8WA 2CU2A 1ZI4A 4KXOA 1TW1A 4LW6A 5C4FA 2Y4KA 2OI6A 1NHEB 1NF5B 1JYLA 4DE7A 1SS9A 4FRAA 5C1HA 2JCKA 3I0EA 2X65A 4B4GA 4AAWA 3GUEA 1LL3A 4FREA 2QGIA 3V0NA 2I5KA 3V0LA 2VS3A 1R7YA 4K6RA 1G9RA 4Y7VA 5C4CA 1LVWA 1QG8A 2BO4A 2FY7A 4KPZA 2VSHA 3T7MA 4KQLA 4G3QA 3I0DA 5I1FA 1HM0A 1G8OA 5FV9A 4HO2A 3IOJA 2Y4MA 3I0FA 2E8BA 3F1YA 3I0KA 1ZI1A 5C4EA 2AM5A 4KPXA 2OI5A 1VGTA 4CJCA 3R3IA 1YP3A 2AECA 3SPTA 2Z86A 5FTSA 5C4DA 1WT1A 2DPWA 3R2WA 4CJ8A 2VXLA 3I0IX 2YQCA 3USQA 3DK5A 1LZ0A 2AM3A 3SX3A 3V91A 5C4BA 1HV9A 1W55A 5CQMX 1WVCA 3OKRA 3U0XA 4B2XA 5L6VA 1K4VA 2AM4A 1FGXA 4EEAA 2FFVA 4MNDA 1FZWA 2BO8A 3SX5A 4Y64A 1R7TA 3EE5A 4IRQA 1FXOA 1OQMB 3BRKX 2VS4A 2YC3A 3DJ4A 3HL3A 3OH1A 4FRQA 5C47A 1H5RA 2PGVA 2X60A 2XWMA 5FUHA 2FFUA 5C3AA 3V8YA 1R82A 1G95A 1FRWA 2FYDB 1LZIA 1VGUA 4FRMA 3QVBA 1PZYB 5JQQA 1ZCVA 5CMGX 3D8VA 3I0CA 1NKHB 3JTJA 4ZDQA 2UX8A 2JCOA 2XWNA 1IIMA 1H7QA 1VH3A 4FQWA 1H5SB 1S4NA 4EEMA 2RJ6A 1V82A 1GX0A 4M2BA 2PX7A 2VSIA 1VPAA 2WEEA 2ZU8A 1JVGA 2Y4LA 1G2VA 4B4MA 5CQLX 5CMIA 2JCLA 1G97A 3CKQA 5C8RA 3SX8A 2PGYA 4MYBA 3TZTA 2WVKA 1FOAA 1FGGA 1R80A 3D5NA 2QH5A 2MZBA 4FROA 4JISA 3OH2A 4KC2A 1G93A 2RIZA 3T7OA 1YP2A 3SXEA 1LL0A 1PZTA 5IDTA 2BO6A 4P02A 4KC4A 4FCUA 3SXCA 3U2VA 5C49A 2RJ0A 4LW3A 1ZDFA 2A8UA 2Z87A 1ZIZA 1H7LA 1XHBA 5CMHA 2V0LA 4BQHA 4Y63A 4B42A 4Y9XA 3ZGGA 3OH3A 4AC3A 1R7UA 1WT2A 3RMVA 1MC3A 4E1KA 1EYRA 4HG6A 1GQ9A 1VM8A 4EEOA 3I0HA 1H7GA 4XWIA 1HJLA 1VZTA 3FWWA 2QKXA 2FYBA 1JV3A 2VXMA 3K8EA 1W77A 2PA4A 1H5TB 4GBPA 1LZ7A 1FR8A 5FTVA 2O1GA 5CQPA 2Y6PA 2OEFA 4BMAA 4HO6A 1INIA 4FRDA 1GX4A 1GQCA 1R7VA 4HO5A 4KRVA 4NALA 4G3PA 1ZCTA 1V83A 2RJ4A 4R7PA 1O0RA 3U2WA 5C3DA 4M2AA 2RIYA 1R81A 5EIYA 1WSZA 2FYAA 4CJBA 1H4CA 5C38A 1G1LA 1TW5A 5AJNA 3SXBA 4EE4A 3CU0A 2APCA 3RMWA 1ZJ0A 4YS8A 1QWJA 1ZI3A 3BCVA 4HO8A 3PKQA 1JYKA 3T7NA 1TZFA 1OMZA 3CKNA 1NWGB 2AH9A 2W0VA 1VZUA 3CKVA 4UEGA 4HO9A 2AE7A 4ASJA 3SXAA 2WGZA 5L6SA 3NGWA 2AGDA 1H4DA 4AYJA 1ON8A 2YC5A 2WVLA 3IOIA 2YQSA 3ST8A 3ZF8A 1VGZA 3PKPA 3V0QA 2JCJA 2XMEA 1O23B 4D11C 1H7FA 1WT3A 4B2WA 2RITA 2V0IA 5CQNX 1GWVA 1S4OA 4FCEA 1ZHJA 4KNRA 4D0TA 1LZJA 3U2TA 3V90A 4HO4A 4IRPA 4B3UA 1QGQA 1ZI5A 4KNXA 4ASYA 3K8DA 2FYCB 1NQIB 3ZLKA 4J18A 2YCMA 3Q4SA 5DDVA 2P6WA 4HOCA 3LW6A 1O7QA 2VS5A 4L41C 3I0JA 4D0ZA 2XWLA 1VZXA 1ZCUA 5IDSA 3SXDA 1H5RB 1MP3A 1I52A 1H4EA 3IOHA 3SX7A 2RJ7A 4D11A 2BO7A 2VD4A 4NANA 2P73A 3OAMA 2RJ1A 1FO9A 4HO0A 3CGXA 4HO3A 1O7OA 4ECMA 1ZJPA 3KIAA 4FRLA 2Q4JA 2W0WA 4Y7TA 5J49A 1G23A 2RJ8A 3POLA 2E3DA 4P00A 5C3BA 1NMMB 4Y7UA 1E5KA 4FRPA 1INJA 2ICYA 2YQHA 1YROB 5FYEA 1Z90A
chains in the Genus database with same CATH superfamily
2D0JA 3D98A 5BXCA 3JUKA 4EE3A 2ZU7A 3Q80A 4O6MA 1H5SC 1HM9A 1IINA 5C1GA 4NAKA 5EJ1A 4B4BA 2NXVA 4KC1A 2ICXA 2GGOA 3I0GA 2RJ9A 3E25A 1WT0A 1FWYA 1ZDGA 2Y7AA 1ZJ2A 4M28A 5AJPA 2V0HA 4M4KA 1R7XA 3U0YA 5EJZA 4JD0A 1VICA 2D7RA 2P72A 2V0KA 4Y62A 2X5SA 4CVHA 3V8ZA 3V0MA 1GWWA 2GGQA 2RJ5A 1JV1A 3E26A 4Y6NA 2I5EA 5CMJA 2J0BA 1JVDA 1FO8A 3V0PA 1GA8A 5FU8A 1ZCYA 2YESA 1H5SA 2OEGA 3JUJA 5D92A 5C1LA 1FG5N 3I0LA 3F1CA 3OH0A 5HS2A 2X5ZA 4DECA 2O1HA 2VFZA 1H7HA 5DDTA 5IFYA 1XZ6A 1V84A 4NAIA 2WE9A 4KT7A 1ZJ3A 1S4PA 4C2SA 5AJOA 3ZLLA 5C48A 4Y6UA 1H7TA 4EE5A 4EVWA 4FIXA 1W57A 4FRBA 3USRA 1KWSA 1ZJOA 1QGSA 4FIYA 1G3LA 1G0RA 5CQOA 1VH1A 1EZIA 1VGWA 3CKJA 3O3PA 3N9WA 3OGZA 1H5SD 3OH4A 4B5BA 1OMXA 3RSBA 1H7EA 4ARWA 2WAWA 3SXGA 2V0JA 4D48A 4DDZA 1YP4A 3OC9A 1TVYA 1LL2A 3CKOA 5FU0A 3V0OA 3ZGFA 2AESA 3FOQA 4HCQA 1ZJ1A 3DUVA 4G3SA 1MP4A 2WVMA 5C36A 3Q7UA 3TQDA 4Y7FA 2OI7A 2O1FA 1H5TA 1HJJA 5CMFX 1MP5A 4EEGA 1FR9A 1FXJA 1H3MA 4AYLA 2I7BA 2ZU9A 2XMHA 2RIXA 4G87A 4Q7CA 3U2UA 1ON6A 2D7IA 3PNNA 2Y4JA 1HM8A 4FRHA 3U2XA 2YQJA 4Y7GA 2A8WA 2CU2A 1ZI4A 4KXOA 1TW1A 4LW6A 5C4FA 2Y4KA 2OI6A 1NHEB 1NF5B 1JYLA 4DE7A 1SS9A 4FRAA 5C1HA 2JCKA 3I0EA 2X65A 4B4GA 4AAWA 3GUEA 1LL3A 4FREA 2QGIA 3V0NA 2I5KA 3V0LA 2VS3A 1R7YA 4K6RA 1G9RA 4Y7VA 5C4CA 5D91A 1LVWA 1QG8A 2BO4A 2FY7A 4KPZA 2VSHA 3T7MA 4KQLA 4G3QA 3I0DA 5I1FA 1HM0A 1G8OA 5FV9A 4HO2A 3IOJA 2Y4MA 3I0FA 2E8BA 3F1YA 3I0KA 1ZI1A 5C4EA 2AM5A 4KPXA 2OI5A 1VGTA 4CJCA 3R3IA 1YP3A 2AECA 3SPTA 2Z86A 5FTSA 5C4DA 1WT1A 2DPWA 4O6NA 3R2WA 4CJ8A 2VXLA 3I0IX 2YQCA 3USQA 3DK5A 1LZ0A 2AM3A 2J0AA 3SX3A 3V91A 5C4BA 1HV9A 1W55A 5CQMX 1WVCA 3OKRA 3U0XA 4B2XA 5L6VA 1K4VA 2AM4A 1FGXA 4EEAA 2FFVA 4MNDA 1FZWA 2BO8A 2VK9A 3SX5A 4Y64A 1R7TA 3EE5A 4IRQA 1FXOA 1OQMB 3BRKX 2VS4A 2YC3A 3DJ4A 3HL3A 3OH1A 4FRQA 5C47A 1H5RA 2PGVA 2X60A 2XWMA 5FUHA 2FFUA 5C3AA 3V8YA 1R82A 1G95A 1FRWA 2FYDB 1LZIA 1VGUA 4FRMA 3QVBA 1PZYB 5JQQA 1ZCVA 5CMGX 3D8VA 3I0CA 1NKHB 3JTJA 4ZDQA 2UX8A 2JCOA 2XWNA 1IIMA 1H7QA 1VH3A 4FQWA 1H5SB 1S4NA 4EEMA 2RJ6A 1V82A 1GX0A 4M2BA 2PX7A 2VSIA 1VPAA 2WEEA 2ZU8A 1JVGA 2Y4LA 1G2VA 4B4MA 5CQLX 5CMIA 2JCLA 1G97A 3CKQA 5C8RA 3SX8A 2PGYA 4MYBA 3TZTA 2WVKA 1FOAA 1FGGA 1R80A 3D5NA 2QH5A 2MZBA 4FROA 4JISA 3OH2A 4KC2A 1G93A 2RIZA 3T7OA 1YP2A 3SXEA 1LL0A 1PZTA 5IDTA 2BO6A 4P02A 4KC4A 4FCUA 3SXCA 3U2VA 5C49A 2RJ0A 4LW3A 1ZDFA 2A8UA 2Z87A 1ZIZA 1H7LA 1XHBA 5CMHA 2V0LA 4BQHA 4Y63A 4B42A 4Y9XA 3ZGGA 3OH3A 4AC3A 1R7UA 1WT2A 3RMVA 1MC3A 4E1KA 1EYRA 4HG6A 1GQ9A 1VM8A 4EEOA 3I0HA 1H7GA 4XWIA 1HJLA 1VZTA 3FWWA 2QKXA 2FYBA 1JV3A 2VXMA 3K8EA 1W77A 2PA4A 1H5TB 4GBPA 1LZ7A 1FR8A 5FTVA 2O1GA 5CQPA 2Y6PA 2OEFA 4BMAA 4HO6A 1INIA 4FRDA 1GX4A 1GQCA 1R7VA 4HO5A 4KRVA 4NALA 4G3PA 1ZCTA 1V83A 2RJ4A 4R7PA 1O0RA 3U2WA 4MIXA 5C3DA 4M2AA 2RIYA 1R81A 5EIYA 1WSZA 2FYAA 4CJBA 1H4CA 5C38A 1G1LA 1TW5A 5AJNA 3SXBA 4EE4A 3CU0A 2APCA 3RMWA 1ZJ0A 4YS8A 1QWJA 1ZI3A 3BCVA 4HO8A 3PKQA 1JYKA 3T7NA 1TZFA 1OMZA 3CKNA 1NWGB 2AH9A 2W0VA 1VZUA 3CKVA 4UEGA 4HO9A 2AE7A 4ASJA 3SXAA 2WGZA 5L6SA 3NGWA 2AGDA 1H4DA 4AYJA 1ON8A 2YC5A 2WVLA 3IOIA 2YQSA 3ST8A 3ZF8A 1VGZA 3PKPA 3V0QA 2JCJA 2XMEA 1O23B 4D11C 1H7FA 1WT3A 4B2WA 2RITA 2V0IA 5CQNX 1GWVA 1S4OA 4FCEA 1ZHJA 4KNRA 4D0TA 1LZJA 3U2TA 3V90A 4HO4A 4IRPA 4B3UA 1QGQA 1ZI5A 4KNXA 4ASYA 3K8DA 2FYCB 1NQIB 3ZLKA 4J18A 2YCMA 3Q4SA 5DDVA 2P6WA 4HOCA 3LW6A 1O7QA 2VS5A 4L41C 3I0JA 4D0ZA 2XWLA 1VZXA 1ZCUA 5IDSA 3SXDA 1H5RB 1MP3A 1I52A 1H4EA 3IOHA 3SX7A 2RJ7A 4D11A 2BO7A 2VD4A 4NANA 2P73A 3OAMA 2RJ1A 1FO9A 4HO0A 3CGXA 4HO3A 2C0NA 1O7OA 4ECMA 1ZJPA 3KIAA 4FRLA 2Q4JA 2W0WA 4Y7TA 5J49A 1G23A 2RJ8A 3POLA 2E3DA 4P00A 5C3BA 1NMMB 4Y7UA 1E5KA 4FRPA 1INJA 2ICYA 2YQHA 1YROB 5FYEA 1Z90A
chains in the Genus database with same CATH topology
2D0JA 3D98A 5BXCA 3JUKA 4EE3A 2ZU7A 3Q80A 4O6MA 1H5SC 1HM9A 1IINA 5C1GA 4NAKA 5EJ1A 4B4BA 2NXVA 4KC1A 2ICXA 2GGOA 3I0GA 2RJ9A 3E25A 1WT0A 1FWYA 1ZDGA 2Y7AA 1ZJ2A 4M28A 5AJPA 2V0HA 4M4KA 1R7XA 3U0YA 5EJZA 4JD0A 1VICA 2D7RA 2P72A 2V0KA 4Y62A 2X5SA 4CVHA 3V8ZA 3V0MA 1GWWA 2GGQA 2RJ5A 1JV1A 3E26A 4Y6NA 2I5EA 5CMJA 2J0BA 1JVDA 1FO8A 3V0PA 1GA8A 5FU8A 1ZCYA 2YESA 1H5SA 2OEGA 3JUJA 5D92A 5C1LA 1FG5N 3I0LA 3F1CA 3OH0A 5HS2A 2X5ZA 4DECA 2O1HA 2VFZA 1H7HA 5DDTA 5IFYA 1XZ6A 1V84A 4NAIA 2WE9A 4KT7A 1ZJ3A 1S4PA 4C2SA 5AJOA 3ZLLA 5C48A 4Y6UA 1H7TA 4EE5A 4EVWA 4FIXA 1W57A 4FRBA 3USRA 1KWSA 1ZJOA 1QGSA 4FIYA 1G3LA 1G0RA 5CQOA 1VH1A 1EZIA 1VGWA 3CKJA 3O3PA 3N9WA 3OGZA 1H5SD 3OH4A 4B5BA 1OMXA 3RSBA 1H7EA 4ARWA 2WAWA 3SXGA 2V0JA 4D48A 4DDZA 1YP4A 3OC9A 1TVYA 1LL2A 3CKOA 5FU0A 3V0OA 3ZGFA 2AESA 3FOQA 4HCQA 1ZJ1A 3DUVA 4G3SA 1MP4A 2WVMA 5C36A 3Q7UA 3TQDA 4Y7FA 2OI7A 2O1FA 1H5TA 1HJJA 5CMFX 1MP5A 4EEGA 1FR9A 1FXJA 1H3MA 4AYLA 2I7BA 2ZU9A 2XMHA 2RIXA 4G87A 4Q7CA 3U2UA 1ON6A 2D7IA 3PNNA 2Y4JA 1HM8A 4FRHA 3U2XA 2YQJA 4Y7GA 2A8WA 2CU2A 1ZI4A 4KXOA 1TW1A 4LW6A 5C4FA 2Y4KA 2OI6A 1NHEB 1NF5B 1JYLA 4DE7A 1SS9A 4FRAA 5C1HA 2JCKA 3I0EA 2X65A 4B4GA 4AAWA 3GUEA 1LL3A 4FREA 2QGIA 3V0NA 2I5KA 3V0LA 2VS3A 1R7YA 4K6RA 1G9RA 4Y7VA 5C4CA 5D91A 1LVWA 1QG8A 2BO4A 2FY7A 4KPZA 2VSHA 3T7MA 4KQLA 4G3QA 3I0DA 5I1FA 1HM0A 1G8OA 5FV9A 4HO2A 3IOJA 2Y4MA 3I0FA 2E8BA 3F1YA 3I0KA 1ZI1A 5C4EA 2AM5A 4KPXA 2OI5A 1VGTA 4CJCA 3R3IA 1YP3A 2AECA 3SPTA 2Z86A 5FTSA 5C4DA 1WT1A 2DPWA 4O6NA 3R2WA 4CJ8A 2VXLA 3I0IX 2YQCA 3USQA 3DK5A 1LZ0A 2AM3A 2J0AA 3SX3A 3V91A 5C4BA 1HV9A 1W55A 5CQMX 1WVCA 3OKRA 3U0XA 4B2XA 5L6VA 1K4VA 2AM4A 1FGXA 4EEAA 2FFVA 4MNDA 1FZWA 2BO8A 2VK9A 3SX5A 4Y64A 1R7TA 3EE5A 4IRQA 1FXOA 1OQMB 3BRKX 2VS4A 2YC3A 3DJ4A 3HL3A 3OH1A 4FRQA 5C47A 1H5RA 2PGVA 2X60A 2XWMA 5FUHA 2FFUA 5C3AA 3V8YA 1R82A 1G95A 1FRWA 2FYDB 1LZIA 1VGUA 4FRMA 3QVBA 1PZYB 5JQQA 1ZCVA 5CMGX 3D8VA 3I0CA 1NKHB 3JTJA 4ZDQA 2UX8A 2JCOA 2XWNA 1IIMA 1H7QA 1VH3A 4FQWA 1H5SB 1S4NA 4EEMA 2RJ6A 1V82A 1GX0A 4M2BA 2PX7A 2VSIA 1VPAA 2WEEA 2ZU8A 1JVGA 2Y4LA 1G2VA 4B4MA 5CQLX 5CMIA 2JCLA 1G97A 3CKQA 5C8RA 3SX8A 2PGYA 4MYBA 3TZTA 2WVKA 1FOAA 1FGGA 1R80A 3D5NA 2QH5A 2MZBA 4FROA 4JISA 3OH2A 4KC2A 1G93A 2RIZA 3T7OA 1YP2A 3SXEA 1LL0A 1PZTA 5IDTA 2BO6A 4P02A 4KC4A 4FCUA 3SXCA 3U2VA 5C49A 2RJ0A 4LW3A 1ZDFA 2A8UA 2Z87A 1ZIZA 1H7LA 1XHBA 5CMHA 2V0LA 4BQHA 4Y63A 4B42A 4Y9XA 3ZGGA 3OH3A 4AC3A 1R7UA 1WT2A 3RMVA 1MC3A 4E1KA 1EYRA 4HG6A 1GQ9A 1VM8A 4EEOA 3I0HA 1H7GA 4XWIA 1HJLA 1VZTA 3FWWA 2QKXA 2FYBA 1JV3A 2VXMA 3K8EA 1W77A 2PA4A 1H5TB 4GBPA 1LZ7A 1FR8A 5FTVA 2O1GA 5CQPA 2Y6PA 2OEFA 4BMAA 4HO6A 1INIA 4FRDA 1GX4A 1GQCA 1R7VA 4HO5A 4KRVA 4NALA 4G3PA 1ZCTA 1V83A 2RJ4A 4R7PA 1O0RA 3U2WA 4MIXA 5C3DA 4M2AA 2RIYA 1R81A 5EIYA 1WSZA 2FYAA 4CJBA 1H4CA 5C38A 1G1LA 1TW5A 5AJNA 3SXBA 4EE4A 3CU0A 2APCA 3RMWA 1ZJ0A 4YS8A 1QWJA 1ZI3A 3BCVA 4HO8A 3PKQA 1JYKA 3T7NA 1TZFA 1OMZA 3CKNA 1NWGB 2AH9A 2W0VA 1VZUA 3CKVA 4UEGA 4HO9A 2AE7A 4ASJA 3SXAA 2WGZA 5L6SA 3NGWA 2AGDA 1H4DA 4AYJA 1ON8A 2YC5A 2WVLA 3IOIA 2YQSA 3ST8A 3ZF8A 1VGZA 3PKPA 3V0QA 2JCJA 2XMEA 1O23B 4D11C 1H7FA 1WT3A 4B2WA 2RITA 2V0IA 5CQNX 1GWVA 1S4OA 4FCEA 1ZHJA 4KNRA 4D0TA 1LZJA 3U2TA 3V90A 4HO4A 4IRPA 4B3UA 1QGQA 1ZI5A 4KNXA 4ASYA 3K8DA 2FYCB 1NQIB 3ZLKA 4J18A 2YCMA 3Q4SA 5DDVA 2P6WA 4HOCA 3LW6A 1O7QA 2VS5A 4L41C 3I0JA 4D0ZA 2XWLA 1VZXA 1ZCUA 5IDSA 3SXDA 1H5RB 1MP3A 1I52A 1H4EA 3IOHA 3SX7A 2RJ7A 4D11A 2BO7A 2VD4A 4NANA 2P73A 3OAMA 2RJ1A 1FO9A 4HO0A 3CGXA 4HO3A 2C0NA 1O7OA 4ECMA 1ZJPA 3KIAA 4FRLA 2Q4JA 2W0WA 4Y7TA 5J49A 1G23A 2RJ8A 3POLA 2E3DA 4P00A 5C3BA 1NMMB 4Y7UA 1E5KA 4FRPA 1INJA 2ICYA 2YQHA 1YROB 5FYEA 1Z90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0J A;  3D98 A;  5BXC A;  3JUK A;  4EE3 A;  2ZU7 A;  3Q80 A;  1H5S C;  1HM9 A;  1IIN A;  5C1G A;  4NAK A;  5EJ1 A;  4B4B A;  2NXV A;  4KC1 A;  2ICX A;  2GGO A;  3I0G A;  2RJ9 A;  3E25 A;  1WT0 A;  1FWY A;  1ZDG A;  2Y7A A;  1ZJ2 A;  4M28 A;  5AJP A;  2V0H A;  4M4K A;  1R7X A;  3U0Y A;  5EJZ A;  4JD0 A;  1VIC A;  2D7R A;  2P72 A;  2V0K A;  4Y62 A;  2X5S A;  4CVH A;  3V8Z A;  3V0M A;  1GWW A;  2GGQ A;  2RJ5 A;  1JV1 A;  3E26 A;  4Y6N A;  2I5E A;  5CMJ A;  1JVD A;  1FO8 A;  3V0P A;  1GA8 A;  5FU8 A;  1ZCY A;  2YES A;  1H5S A;  2OEG A;  3JUJ A;  5C1L A;  1FG5 N;  3I0L A;  3F1C A;  3OH0 A;  5HS2 A;  2X5Z A;  4DEC A;  2O1H A;  2VFZ A;  1H7H A;  5DDT A;  5IFY A;  1XZ6 A;  1V84 A;  4NAI A;  2WE9 A;  4KT7 A;  1ZJ3 A;  1S4P A;  4C2S A;  5AJO A;  3ZLL A;  5C48 A;  4Y6U A;  1H7T A;  4EE5 A;  4EVW A;  1W57 A;  4FRB A;  3USR A;  1KWS A;  1ZJO A;  1QGS A;  1G3L A;  1G0R A;  5CQO A;  1VH1 A;  1EZI A;  1VGW A;  3CKJ A;  3O3P A;  3N9W A;  3OGZ A;  1H5S D;  3OH4 A;  4B5B A;  1OMX A;  3RSB A;  1H7E A;  4ARW A;  2WAW A;  3SXG A;  2V0J A;  4D48 A;  4DDZ A;  1YP4 A;  3OC9 A;  1TVY A;  1LL2 A;  3CKO A;  5FU0 A;  3V0O A;  3ZGF A;  2AES A;  3FOQ A;  4HCQ A;  1ZJ1 A;  3DUV A;  4G3S A;  1MP4 A;  2WVM A;  5C36 A;  3Q7U A;  3TQD A;  4Y7F A;  2OI7 A;  2O1F A;  1H5T A;  1HJJ A;  5CMF X;  1MP5 A;  4EEG A;  1FR9 A;  1FXJ A;  1H3M A;  4AYL A;  2I7B A;  2ZU9 A;  2XMH A;  2RIX A;  4G87 A;  3U2U A;  1ON6 A;  2D7I A;  3PNN A;  2Y4J A;  1HM8 A;  4FRH A;  3U2X A;  2YQJ A;  4Y7G A;  2A8W A;  2CU2 A;  1ZI4 A;  4KXO A;  1TW1 A;  4LW6 A;  5C4F A;  2Y4K A;  2OI6 A;  1NHE B;  1NF5 B;  1JYL A;  4DE7 A;  1SS9 A;  4FRA A;  5C1H A;  2JCK A;  3I0E A;  2X65 A;  4B4G A;  4AAW A;  3GUE A;  1LL3 A;  4FRE A;  2QGI A;  3V0N A;  2I5K A;  3V0L A;  2VS3 A;  1R7Y A;  4K6R A;  1G9R A;  4Y7V A;  5C4C A;  1LVW A;  1QG8 A;  2BO4 A;  2FY7 A;  4KPZ A;  2VSH A;  3T7M A;  4KQL A;  4G3Q A;  3I0D A;  5I1F A;  1HM0 A;  1G8O A;  5FV9 A;  4HO2 A;  3IOJ A;  2Y4M A;  3I0F A;  2E8B A;  3F1Y A;  3I0K A;  1ZI1 A;  5C4E A;  2AM5 A;  4KPX A;  2OI5 A;  1VGT A;  4CJC A;  3R3I A;  1YP3 A;  2AEC A;  3SPT A;  2Z86 A;  5FTS A;  5C4D A;  1WT1 A;  2DPW A;  3R2W A;  4CJ8 A;  2VXL A;  3I0I X;  2YQC A;  3USQ A;  3DK5 A;  1LZ0 A;  2AM3 A;  3SX3 A;  3V91 A;  5C4B A;  1HV9 A;  1W55 A;  5CQM X;  1WVC A;  3OKR A;  3U0X A;  4B2X A;  5L6V A;  1K4V A;  2AM4 A;  1FGX A;  4EEA A;  2FFV A;  4MND A;  1FZW A;  2BO8 A;  3SX5 A;  4Y64 A;  1R7T A;  3EE5 A;  4IRQ A;  1FXO A;  1OQM B;  3BRK X;  2VS4 A;  2YC3 A;  3DJ4 A;  3HL3 A;  3OH1 A;  4FRQ A;  5C47 A;  1H5R A;  2PGV A;  2X60 A;  2XWM A;  5FUH A;  2FFU A;  5C3A A;  3V8Y A;  1R82 A;  1G95 A;  1FRW A;  2FYD B;  1LZI A;  1VGU A;  4FRM A;  3QVB A;  1PZY B;  5JQQ A;  1ZCV A;  5CMG X;  3D8V A;  3I0C A;  1NKH B;  3JTJ A;  4ZDQ A;  2UX8 A;  2JCO A;  2XWN A;  1IIM A;  1H7Q A;  1VH3 A;  4FQW A;  1H5S B;  1S4N A;  4EEM A;  2RJ6 A;  1V82 A;  1GX0 A;  4M2B A;  2PX7 A;  2VSI A;  1VPA A;  2WEE A;  2ZU8 A;  1JVG A;  2Y4L A;  1G2V A;  4B4M A;  5CQL X;  5CMI A;  2JCL A;  1G97 A;  3CKQ A;  5C8R A;  3SX8 A;  2PGY A;  4MYB A;  3TZT A;  2WVK A;  1FOA A;  1FGG A;  1R80 A;  3D5N A;  2QH5 A;  2MZB A;  4FRO A;  4JIS A;  3OH2 A;  4KC2 A;  1G93 A;  2RIZ A;  3T7O A;  1YP2 A;  3SXE A;  1LL0 A;  1PZT A;  5IDT A;  2BO6 A;  4P02 A;  4KC4 A;  4FCU A;  3SXC A;  3U2V A;  5C49 A;  2RJ0 A;  4LW3 A;  1ZDF A;  2A8U A;  2Z87 A;  1ZIZ A;  1H7L A;  1XHB A;  5CMH A;  2V0L A;  4BQH A;  4Y63 A;  4B42 A;  4Y9X A;  3ZGG A;  3OH3 A;  4AC3 A;  1R7U A;  1WT2 A;  3RMV A;  1MC3 A;  4E1K A;  1EYR A;  4HG6 A;  1GQ9 A;  1VM8 A;  4EEO A;  3I0H A;  1H7G A;  4XWI A;  1HJL A;  1VZT A;  3FWW A;  2QKX A;  2FYB A;  1JV3 A;  2VXM A;  3K8E A;  1W77 A;  2PA4 A;  1H5T B;  4GBP A;  1LZ7 A;  1FR8 A;  5FTV A;  2O1G A;  5CQP A;  2Y6P A;  2OEF A;  4BMA A;  4HO6 A;  1INI A;  4FRD A;  1GX4 A;  1GQC A;  1R7V A;  4HO5 A;  4KRV A;  4NAL A;  4G3P A;  1ZCT A;  1V83 A;  2RJ4 A;  4R7P A;  1O0R A;  3U2W A;  5C3D A;  4M2A A;  2RIY A;  1R81 A;  5EIY A;  1WSZ A;  2FYA A;  4CJB A;  1H4C A;  5C38 A;  1G1L A;  1TW5 A;  5AJN A;  3SXB A;  4EE4 A;  3CU0 A;  2APC A;  3RMW A;  1ZJ0 A;  4YS8 A;  1QWJ A;  1ZI3 A;  3BCV A;  4HO8 A;  3PKQ A;  1JYK A;  3T7N A;  1TZF A;  1OMZ A;  3CKN A;  1NWG B;  2AH9 A;  2W0V A;  1VZU A;  3CKV A;  4UEG A;  4HO9 A;  2AE7 A;  4ASJ A;  3SXA A;  2WGZ A;  5L6S A;  3NGW A;  2AGD A;  1H4D A;  4AYJ A;  1ON8 A;  2YC5 A;  2WVL A;  3IOI A;  2YQS A;  3ST8 A;  3ZF8 A;  1VGZ A;  3PKP A;  3V0Q A;  2JCJ A;  2XME A;  1O23 B;  4D11 C;  1H7F A;  1WT3 A;  4B2W A;  2RIT A;  2V0I A;  5CQN X;  1GWV A;  1S4O A;  4FCE A;  1ZHJ A;  4KNR A;  4D0T A;  1LZJ A;  3U2T A;  3V90 A;  4HO4 A;  4IRP A;  4B3U A;  1QGQ A;  1ZI5 A;  4KNX A;  4ASY A;  3K8D A;  2FYC B;  1NQI B;  3ZLK A;  4J18 A;  2YCM A;  3Q4S A;  5DDV A;  2P6W A;  4HOC A;  3LW6 A;  1O7Q A;  2VS5 A;  4L41 C;  3I0J A;  4D0Z A;  2XWL A;  1VZX A;  1ZCU A;  5IDS A;  3SXD A;  1H5R B;  1MP3 A;  1I52 A;  1H4E A;  3IOH A;  3SX7 A;  2RJ7 A;  4D11 A;  2BO7 A;  2VD4 A;  4NAN A;  2P73 A;  3OAM A;  2RJ1 A;  1FO9 A;  4HO0 A;  3CGX A;  4HO3 A;  1O7O A;  4ECM A;  1ZJP A;  3KIA A;  4FRL A;  2Q4J A;  2W0W A;  4Y7T A;  5J49 A;  1G23 A;  2RJ8 A;  3POL A;  2E3D A;  4P00 A;  5C3B A;  1NMM B;  4Y7U A;  1E5K A;  4FRP A;  1INJ A;  2ICY A;  2YQH A;  1YRO B;  5FYE A;  1Z90 A; 
#chains in the Genus database with same CATH topology
 2D0J A;  3D98 A;  5BXC A;  3JUK A;  4EE3 A;  2ZU7 A;  3Q80 A;  4O6M A;  1H5S C;  1HM9 A;  1IIN A;  5C1G A;  4NAK A;  5EJ1 A;  4B4B A;  2NXV A;  4KC1 A;  2ICX A;  2GGO A;  3I0G A;  2RJ9 A;  3E25 A;  1WT0 A;  1FWY A;  1ZDG A;  2Y7A A;  1ZJ2 A;  4M28 A;  5AJP A;  2V0H A;  4M4K A;  1R7X A;  3U0Y A;  5EJZ A;  4JD0 A;  1VIC A;  2D7R A;  2P72 A;  2V0K A;  4Y62 A;  2X5S A;  4CVH A;  3V8Z A;  3V0M A;  1GWW A;  2GGQ A;  2RJ5 A;  1JV1 A;  3E26 A;  4Y6N A;  2I5E A;  5CMJ A;  2J0B A;  1JVD A;  1FO8 A;  3V0P A;  1GA8 A;  5FU8 A;  1ZCY A;  2YES A;  1H5S A;  2OEG A;  3JUJ A;  5D92 A;  5C1L A;  1FG5 N;  3I0L A;  3F1C A;  3OH0 A;  5HS2 A;  2X5Z A;  4DEC A;  2O1H A;  2VFZ A;  1H7H A;  5DDT A;  5IFY A;  1XZ6 A;  1V84 A;  4NAI A;  2WE9 A;  4KT7 A;  1ZJ3 A;  1S4P A;  4C2S A;  5AJO A;  3ZLL A;  5C48 A;  4Y6U A;  1H7T A;  4EE5 A;  4EVW A;  4FIX A;  1W57 A;  4FRB A;  3USR A;  1KWS A;  1ZJO A;  1QGS A;  4FIY A;  1G3L A;  1G0R A;  5CQO A;  1VH1 A;  1EZI A;  1VGW A;  3CKJ A;  3O3P A;  3N9W A;  3OGZ A;  1H5S D;  3OH4 A;  4B5B A;  1OMX A;  3RSB A;  1H7E A;  4ARW A;  2WAW A;  3SXG A;  2V0J A;  4D48 A;  4DDZ A;  1YP4 A;  3OC9 A;  1TVY A;  1LL2 A;  3CKO A;  5FU0 A;  3V0O A;  3ZGF A;  2AES A;  3FOQ A;  4HCQ A;  1ZJ1 A;  3DUV A;  4G3S A;  1MP4 A;  2WVM A;  5C36 A;  3Q7U A;  3TQD A;  4Y7F A;  2OI7 A;  2O1F A;  1H5T A;  1HJJ A;  5CMF X;  1MP5 A;  4EEG A;  1FR9 A;  1FXJ A;  1H3M A;  4AYL A;  2I7B A;  2ZU9 A;  2XMH A;  2RIX A;  4G87 A;  4Q7C A;  3U2U A;  1ON6 A;  2D7I A;  3PNN A;  2Y4J A;  1HM8 A;  4FRH A;  3U2X A;  2YQJ A;  4Y7G A;  2A8W A;  2CU2 A;  1ZI4 A;  4KXO A;  1TW1 A;  4LW6 A;  5C4F A;  2Y4K A;  2OI6 A;  1NHE B;  1NF5 B;  1JYL A;  4DE7 A;  1SS9 A;  4FRA A;  5C1H A;  2JCK A;  3I0E A;  2X65 A;  4B4G A;  4AAW A;  3GUE A;  1LL3 A;  4FRE A;  2QGI A;  3V0N A;  2I5K A;  3V0L A;  2VS3 A;  1R7Y A;  4K6R A;  1G9R A;  4Y7V A;  5C4C A;  5D91 A;  1LVW A;  1QG8 A;  2BO4 A;  2FY7 A;  4KPZ A;  2VSH A;  3T7M A;  4KQL A;  4G3Q A;  3I0D A;  5I1F A;  1HM0 A;  1G8O A;  5FV9 A;  4HO2 A;  3IOJ A;  2Y4M A;  3I0F A;  2E8B A;  3F1Y A;  3I0K A;  1ZI1 A;  5C4E A;  2AM5 A;  4KPX A;  2OI5 A;  1VGT A;  4CJC A;  3R3I A;  1YP3 A;  2AEC A;  3SPT A;  2Z86 A;  5FTS A;  5C4D A;  1WT1 A;  2DPW A;  4O6N A;  3R2W A;  4CJ8 A;  2VXL A;  3I0I X;  2YQC A;  3USQ A;  3DK5 A;  1LZ0 A;  2AM3 A;  2J0A A;  3SX3 A;  3V91 A;  5C4B A;  1HV9 A;  1W55 A;  5CQM X;  1WVC A;  3OKR A;  3U0X A;  4B2X A;  5L6V A;  1K4V A;  2AM4 A;  1FGX A;  4EEA A;  2FFV A;  4MND A;  1FZW A;  2BO8 A;  2VK9 A;  3SX5 A;  4Y64 A;  1R7T A;  3EE5 A;  4IRQ A;  1FXO A;  1OQM B;  3BRK X;  2VS4 A;  2YC3 A;  3DJ4 A;  3HL3 A;  3OH1 A;  4FRQ A;  5C47 A;  1H5R A;  2PGV A;  2X60 A;  2XWM A;  5FUH A;  2FFU A;  5C3A A;  3V8Y A;  1R82 A;  1G95 A;  1FRW A;  2FYD B;  1LZI A;  1VGU A;  4FRM A;  3QVB A;  1PZY B;  5JQQ A;  1ZCV A;  5CMG X;  3D8V A;  3I0C A;  1NKH B;  3JTJ A;  4ZDQ A;  2UX8 A;  2JCO A;  2XWN A;  1IIM A;  1H7Q A;  1VH3 A;  4FQW A;  1H5S B;  1S4N A;  4EEM A;  2RJ6 A;  1V82 A;  1GX0 A;  4M2B A;  2PX7 A;  2VSI A;  1VPA A;  2WEE A;  2ZU8 A;  1JVG A;  2Y4L A;  1G2V A;  4B4M A;  5CQL X;  5CMI A;  2JCL A;  1G97 A;  3CKQ A;  5C8R A;  3SX8 A;  2PGY A;  4MYB A;  3TZT A;  2WVK A;  1FOA A;  1FGG A;  1R80 A;  3D5N A;  2QH5 A;  2MZB A;  4FRO A;  4JIS A;  3OH2 A;  4KC2 A;  1G93 A;  2RIZ A;  3T7O A;  1YP2 A;  3SXE A;  1LL0 A;  1PZT A;  5IDT A;  2BO6 A;  4P02 A;  4KC4 A;  4FCU A;  3SXC A;  3U2V A;  5C49 A;  2RJ0 A;  4LW3 A;  1ZDF A;  2A8U A;  2Z87 A;  1ZIZ A;  1H7L A;  1XHB A;  5CMH A;  2V0L A;  4BQH A;  4Y63 A;  4B42 A;  4Y9X A;  3ZGG A;  3OH3 A;  4AC3 A;  1R7U A;  1WT2 A;  3RMV A;  1MC3 A;  4E1K A;  1EYR A;  4HG6 A;  1GQ9 A;  1VM8 A;  4EEO A;  3I0H A;  1H7G A;  4XWI A;  1HJL A;  1VZT A;  3FWW A;  2QKX A;  2FYB A;  1JV3 A;  2VXM A;  3K8E A;  1W77 A;  2PA4 A;  1H5T B;  4GBP A;  1LZ7 A;  1FR8 A;  5FTV A;  2O1G A;  5CQP A;  2Y6P A;  2OEF A;  4BMA A;  4HO6 A;  1INI A;  4FRD A;  1GX4 A;  1GQC A;  1R7V A;  4HO5 A;  4KRV A;  4NAL A;  4G3P A;  1ZCT A;  1V83 A;  2RJ4 A;  4R7P A;  1O0R A;  3U2W A;  4MIX A;  5C3D A;  4M2A A;  2RIY A;  1R81 A;  5EIY A;  1WSZ A;  2FYA A;  4CJB A;  1H4C A;  5C38 A;  1G1L A;  1TW5 A;  5AJN A;  3SXB A;  4EE4 A;  3CU0 A;  2APC A;  3RMW A;  1ZJ0 A;  4YS8 A;  1QWJ A;  1ZI3 A;  3BCV A;  4HO8 A;  3PKQ A;  1JYK A;  3T7N A;  1TZF A;  1OMZ A;  3CKN A;  1NWG B;  2AH9 A;  2W0V A;  1VZU A;  3CKV A;  4UEG A;  4HO9 A;  2AE7 A;  4ASJ A;  3SXA A;  2WGZ A;  5L6S A;  3NGW A;  2AGD A;  1H4D A;  4AYJ A;  1ON8 A;  2YC5 A;  2WVL A;  3IOI A;  2YQS A;  3ST8 A;  3ZF8 A;  1VGZ A;  3PKP A;  3V0Q A;  2JCJ A;  2XME A;  1O23 B;  4D11 C;  1H7F A;  1WT3 A;  4B2W A;  2RIT A;  2V0I A;  5CQN X;  1GWV A;  1S4O A;  4FCE A;  1ZHJ A;  4KNR A;  4D0T A;  1LZJ A;  3U2T A;  3V90 A;  4HO4 A;  4IRP A;  4B3U A;  1QGQ A;  1ZI5 A;  4KNX A;  4ASY A;  3K8D A;  2FYC B;  1NQI B;  3ZLK A;  4J18 A;  2YCM A;  3Q4S A;  5DDV A;  2P6W A;  4HOC A;  3LW6 A;  1O7Q A;  2VS5 A;  4L41 C;  3I0J A;  4D0Z A;  2XWL A;  1VZX A;  1ZCU A;  5IDS A;  3SXD A;  1H5R B;  1MP3 A;  1I52 A;  1H4E A;  3IOH A;  3SX7 A;  2RJ7 A;  4D11 A;  2BO7 A;  2VD4 A;  4NAN A;  2P73 A;  3OAM A;  2RJ1 A;  1FO9 A;  4HO0 A;  3CGX A;  4HO3 A;  2C0N A;  1O7O A;  4ECM A;  1ZJP A;  3KIA A;  4FRL A;  2Q4J A;  2W0W A;  4Y7T A;  5J49 A;  1G23 A;  2RJ8 A;  3POL A;  2E3D A;  4P00 A;  5C3B A;  1NMM B;  4Y7U A;  1E5K A;  4FRP A;  1INJ A;  2ICY A;  2YQH A;  1YRO B;  5FYE A;  1Z90 A; 
#chains in the Genus database with same CATH homology
 2D0J A;  3D98 A;  5BXC A;  3JUK A;  4EE3 A;  2ZU7 A;  3Q80 A;  4O6M A;  1H5S C;  1HM9 A;  1IIN A;  5C1G A;  4NAK A;  5EJ1 A;  4B4B A;  2NXV A;  4KC1 A;  2ICX A;  2GGO A;  3I0G A;  2RJ9 A;  3E25 A;  1WT0 A;  1FWY A;  1ZDG A;  2Y7A A;  1ZJ2 A;  4M28 A;  5AJP A;  2V0H A;  4M4K A;  1R7X A;  3U0Y A;  5EJZ A;  4JD0 A;  1VIC A;  2D7R A;  2P72 A;  2V0K A;  4Y62 A;  2X5S A;  4CVH A;  3V8Z A;  3V0M A;  1GWW A;  2GGQ A;  2RJ5 A;  1JV1 A;  3E26 A;  4Y6N A;  2I5E A;  5CMJ A;  2J0B A;  1JVD A;  1FO8 A;  3V0P A;  1GA8 A;  5FU8 A;  1ZCY A;  2YES A;  1H5S A;  2OEG A;  3JUJ A;  5D92 A;  5C1L A;  1FG5 N;  3I0L A;  3F1C A;  3OH0 A;  5HS2 A;  2X5Z A;  4DEC A;  2O1H A;  2VFZ A;  1H7H A;  5DDT A;  5IFY A;  1XZ6 A;  1V84 A;  4NAI A;  2WE9 A;  4KT7 A;  1ZJ3 A;  1S4P A;  4C2S A;  5AJO A;  3ZLL A;  5C48 A;  4Y6U A;  1H7T A;  4EE5 A;  4EVW A;  4FIX A;  1W57 A;  4FRB A;  3USR A;  1KWS A;  1ZJO A;  1QGS A;  4FIY A;  1G3L A;  1G0R A;  5CQO A;  1VH1 A;  1EZI A;  1VGW A;  3CKJ A;  3O3P A;  3N9W A;  3OGZ A;  1H5S D;  3OH4 A;  4B5B A;  1OMX A;  3RSB A;  1H7E A;  4ARW A;  2WAW A;  3SXG A;  2V0J A;  4D48 A;  4DDZ A;  1YP4 A;  3OC9 A;  1TVY A;  1LL2 A;  3CKO A;  5FU0 A;  3V0O A;  3ZGF A;  2AES A;  3FOQ A;  4HCQ A;  1ZJ1 A;  3DUV A;  4G3S A;  1MP4 A;  2WVM A;  5C36 A;  3Q7U A;  3TQD A;  4Y7F A;  2OI7 A;  2O1F A;  1H5T A;  1HJJ A;  5CMF X;  1MP5 A;  4EEG A;  1FR9 A;  1FXJ A;  1H3M A;  4AYL A;  2I7B A;  2ZU9 A;  2XMH A;  2RIX A;  4G87 A;  4Q7C A;  3U2U A;  1ON6 A;  2D7I A;  3PNN A;  2Y4J A;  1HM8 A;  4FRH A;  3U2X A;  2YQJ A;  4Y7G A;  2A8W A;  2CU2 A;  1ZI4 A;  4KXO A;  1TW1 A;  4LW6 A;  5C4F A;  2Y4K A;  2OI6 A;  1NHE B;  1NF5 B;  1JYL A;  4DE7 A;  1SS9 A;  4FRA A;  5C1H A;  2JCK A;  3I0E A;  2X65 A;  4B4G A;  4AAW A;  3GUE A;  1LL3 A;  4FRE A;  2QGI A;  3V0N A;  2I5K A;  3V0L A;  2VS3 A;  1R7Y A;  4K6R A;  1G9R A;  4Y7V A;  5C4C A;  5D91 A;  1LVW A;  1QG8 A;  2BO4 A;  2FY7 A;  4KPZ A;  2VSH A;  3T7M A;  4KQL A;  4G3Q A;  3I0D A;  5I1F A;  1HM0 A;  1G8O A;  5FV9 A;  4HO2 A;  3IOJ A;  2Y4M A;  3I0F A;  2E8B A;  3F1Y A;  3I0K A;  1ZI1 A;  5C4E A;  2AM5 A;  4KPX A;  2OI5 A;  1VGT A;  4CJC A;  3R3I A;  1YP3 A;  2AEC A;  3SPT A;  2Z86 A;  5FTS A;  5C4D A;  1WT1 A;  2DPW A;  4O6N A;  3R2W A;  4CJ8 A;  2VXL A;  3I0I X;  2YQC A;  3USQ A;  3DK5 A;  1LZ0 A;  2AM3 A;  2J0A A;  3SX3 A;  3V91 A;  5C4B A;  1HV9 A;  1W55 A;  5CQM X;  1WVC A;  3OKR A;  3U0X A;  4B2X A;  5L6V A;  1K4V A;  2AM4 A;  1FGX A;  4EEA A;  2FFV A;  4MND A;  1FZW A;  2BO8 A;  2VK9 A;  3SX5 A;  4Y64 A;  1R7T A;  3EE5 A;  4IRQ A;  1FXO A;  1OQM B;  3BRK X;  2VS4 A;  2YC3 A;  3DJ4 A;  3HL3 A;  3OH1 A;  4FRQ A;  5C47 A;  1H5R A;  2PGV A;  2X60 A;  2XWM A;  5FUH A;  2FFU A;  5C3A A;  3V8Y A;  1R82 A;  1G95 A;  1FRW A;  2FYD B;  1LZI A;  1VGU A;  4FRM A;  3QVB A;  1PZY B;  5JQQ A;  1ZCV A;  5CMG X;  3D8V A;  3I0C A;  1NKH B;  3JTJ A;  4ZDQ A;  2UX8 A;  2JCO A;  2XWN A;  1IIM A;  1H7Q A;  1VH3 A;  4FQW A;  1H5S B;  1S4N A;  4EEM A;  2RJ6 A;  1V82 A;  1GX0 A;  4M2B A;  2PX7 A;  2VSI A;  1VPA A;  2WEE A;  2ZU8 A;  1JVG A;  2Y4L A;  1G2V A;  4B4M A;  5CQL X;  5CMI A;  2JCL A;  1G97 A;  3CKQ A;  5C8R A;  3SX8 A;  2PGY A;  4MYB A;  3TZT A;  2WVK A;  1FOA A;  1FGG A;  1R80 A;  3D5N A;  2QH5 A;  2MZB A;  4FRO A;  4JIS A;  3OH2 A;  4KC2 A;  1G93 A;  2RIZ A;  3T7O A;  1YP2 A;  3SXE A;  1LL0 A;  1PZT A;  5IDT A;  2BO6 A;  4P02 A;  4KC4 A;  4FCU A;  3SXC A;  3U2V A;  5C49 A;  2RJ0 A;  4LW3 A;  1ZDF A;  2A8U A;  2Z87 A;  1ZIZ A;  1H7L A;  1XHB A;  5CMH A;  2V0L A;  4BQH A;  4Y63 A;  4B42 A;  4Y9X A;  3ZGG A;  3OH3 A;  4AC3 A;  1R7U A;  1WT2 A;  3RMV A;  1MC3 A;  4E1K A;  1EYR A;  4HG6 A;  1GQ9 A;  1VM8 A;  4EEO A;  3I0H A;  1H7G A;  4XWI A;  1HJL A;  1VZT A;  3FWW A;  2QKX A;  2FYB A;  1JV3 A;  2VXM A;  3K8E A;  1W77 A;  2PA4 A;  1H5T B;  4GBP A;  1LZ7 A;  1FR8 A;  5FTV A;  2O1G A;  5CQP A;  2Y6P A;  2OEF A;  4BMA A;  4HO6 A;  1INI A;  4FRD A;  1GX4 A;  1GQC A;  1R7V A;  4HO5 A;  4KRV A;  4NAL A;  4G3P A;  1ZCT A;  1V83 A;  2RJ4 A;  4R7P A;  1O0R A;  3U2W A;  4MIX A;  5C3D A;  4M2A A;  2RIY A;  1R81 A;  5EIY A;  1WSZ A;  2FYA A;  4CJB A;  1H4C A;  5C38 A;  1G1L A;  1TW5 A;  5AJN A;  3SXB A;  4EE4 A;  3CU0 A;  2APC A;  3RMW A;  1ZJ0 A;  4YS8 A;  1QWJ A;  1ZI3 A;  3BCV A;  4HO8 A;  3PKQ A;  1JYK A;  3T7N A;  1TZF A;  1OMZ A;  3CKN A;  1NWG B;  2AH9 A;  2W0V A;  1VZU A;  3CKV A;  4UEG A;  4HO9 A;  2AE7 A;  4ASJ A;  3SXA A;  2WGZ A;  5L6S A;  3NGW A;  2AGD A;  1H4D A;  4AYJ A;  1ON8 A;  2YC5 A;  2WVL A;  3IOI A;  2YQS A;  3ST8 A;  3ZF8 A;  1VGZ A;  3PKP A;  3V0Q A;  2JCJ A;  2XME A;  1O23 B;  4D11 C;  1H7F A;  1WT3 A;  4B2W A;  2RIT A;  2V0I A;  5CQN X;  1GWV A;  1S4O A;  4FCE A;  1ZHJ A;  4KNR A;  4D0T A;  1LZJ A;  3U2T A;  3V90 A;  4HO4 A;  4IRP A;  4B3U A;  1QGQ A;  1ZI5 A;  4KNX A;  4ASY A;  3K8D A;  2FYC B;  1NQI B;  3ZLK A;  4J18 A;  2YCM A;  3Q4S A;  5DDV A;  2P6W A;  4HOC A;  3LW6 A;  1O7Q A;  2VS5 A;  4L41 C;  3I0J A;  4D0Z A;  2XWL A;  1VZX A;  1ZCU A;  5IDS A;  3SXD A;  1H5R B;  1MP3 A;  1I52 A;  1H4E A;  3IOH A;  3SX7 A;  2RJ7 A;  4D11 A;  2BO7 A;  2VD4 A;  4NAN A;  2P73 A;  3OAM A;  2RJ1 A;  1FO9 A;  4HO0 A;  3CGX A;  4HO3 A;  2C0N A;  1O7O A;  4ECM A;  1ZJP A;  3KIA A;  4FRL A;  2Q4J A;  2W0W A;  4Y7T A;  5J49 A;  1G23 A;  2RJ8 A;  3POL A;  2E3D A;  4P00 A;  5C3B A;  1NMM B;  4Y7U A;  1E5K A;  4FRP A;  1INJ A;  2ICY A;  2YQH A;  1YRO B;  5FYE A;  1Z90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...