1ZCVA

Apo form of a mutant of glycogenin in which asp159 is replaced by asn
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
260
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFNGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSMTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Requirements for catalysis in mammalian glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 82
structure length 260
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zcvA00
2RJ6A 1G3LA 3D5NA 1ZJ0A 4D0TA 2D7IA 4Y7UA 1VGZA 1LL2A 4LW6A 1NF5B 5EJZA 4D11C 3SX7A 2PA4A 1LZJA 3CU0A 4Y63A 1OMXA 1VGWA 4YS8A 4KNXA 1VZXA 1HM8A 4G3PA 1G0RA 4KT7A 2MZBA 3CKOA 1R7YA 1TVYA 1ZI4A 1R82A 4AYJA 2BO4A 1JYLA 3QVBA 1H7QA 4Y7VA 2FYCB 4EE3A 2X65A 4GBPA 5C1HA 2APCA 3D98A 3E25A 1R7VA 2YQCA 1GQCA 2FYDB 4FCUA 2ZU7A 1MP5A 2RIYA 4L41C 5AJNA 4KXOA 3I0JA 1XZ6A 1TW5A 2RJ7A 4M28A 4DE7A 3U2XA 5CQPA 1LZ7A 1G1LA 1HJJA 2GGQA 4KC1A 1YROB 4FRBA 4E1KA 5IDSA 4FRHA 2WEEA 3OH3A 3N9WA 1FOAA 1H7TA 1K4VA 2VD4A 1LVWA 1OMZA 1FR9A 4D48A 1GX4A 4DECA 1H4CA 4KNRA 2XWNA 1W57A 4HO2A 3U2VA 1H5TA 1GWVA 1IINA 1MP3A 2OI5A 3SX3A 4B4GA 1FZWA 2D0JA 1JV3A 1ON8A 3POLA 1HM0A 3T7MA 2D7RA 2FFVA 3ZGGA 4B2WA 2WVMA 3BRKX 1PZTA 4UEGA 5C36A 1JV1A 2WE9A 3OGZA 4HOCA 3DJ4A 5J49A 1VICA 4M4KA 5CQLX 2Q4JA 4BQHA 1QGQA 3I0GA 1H7FA 2ICXA 2NXVA 3BCVA 2JCLA 2PGVA 3DUVA 5C49A 3TZTA 5C38A 1H5SC 1GA8A 5CMJA 5C3BA 1HV9A 2YQSA 4G87A 3CKVA 3CKQA 2Y4LA 2JCOA 5DDVA 4FRAA 3R3IA 4FCEA 2Y4MA 1W77A 1PZYB 5C4CA 2Y4KA 4CJBA 2V0LA 2RJ9A 2RIZA 4C2SA 3OH2A 5EJ1A 4EVWA 3EE5A 2A8WA 3IOHA 4NAKA 1LL3A 2DPWA 3TQDA 1S4OA 5DDTA 2FFUA 2W0WA 3LW6A 1INJA 2JCKA 4FRPA 1ZCUA 3CKNA 4HO5A 1ZI3A 1S4NA 3ZF8A 1IIMA 3JUKA 1ZI5A 1G97A 2RJ0A 1NHEB 1ZHJA 3F1YA 3V8YA 4XWIA 1QWJA 1FO8A 2OI7A 4JISA 2I5EA 1VH1A 3HL3A 1ZIZA 1FXOA 1ZCYA 4Y7TA 1R7UA 2I7BA 5FU8A 1WT3A 3SXCA 2YC5A 1YP3A 3K8EA 4FRMA 3V90A 5FTVA 1FG5N 1NKHB 4EE4A 4AC3A 2YESA 2V0IA 3SXEA 3Q7UA 4Y7GA 5C48A 1SS9A 3I0EA 4KRVA 4P00A 4ZDQA 1WSZA 1R7XA 3JUJA 2X60A 1H4DA 3JTJA 4EEAA 1V84A 5I1FA 4FRDA 1LL0A 4R7PA 1GX0A 1H5SD 4MYBA 1R81A 5IDTA 3U0YA 5FYEA 4D11A 1TW1A 4NAIA 2OEFA 4KPXA 3FOQA 4CVHA 1OQMB 2ZU8A 3USQA 4EEOA 4Y64A 5CQNX 4B5BA 1FRWA 3OC9A 3OKRA 4FRLA 4IRPA 5IFYA 2WVKA 2Z86A 2VSHA 2AM5A 1H7LA 4HO4A 4CJ8A 3T7NA 3U2UA 3Q4SA 3I0FA 5C1LA 3ZGFA 2X5SA 3Q80A 3DK5A 1YP2A 3SX5A 1G9RA 4B3UA 1H4EA 1VZTA 2RJ4A 2YQJA 1H5RA 1JYKA 3SXGA 4Y6NA 4CJCA 1H7EA 1TZFA 1VPAA 4DDZA 1G23A 5C4EA 1H5RB 5C4DA 2AECA 1WT2A 4LW3A 1ZCTA 5JQQA 4M2AA 5AJPA 5CMHA 3IOIA 4M2BA 2XWLA 4KPZA 3FWWA 4IRQA 5C3AA 3NGWA 5C4FA 1NMMB 2QH5A 4B4BA 5C47A 1VH3A 3I0DA 1FXJA 3I0LA 1S4PA 2WGZA 3D8VA 2GGOA 2AGDA 2AE7A 3SPTA 2FYBA 4Y6UA 3V0PA 2CU2A 1G2VA 2V0KA 4ECMA 2VSIA 4HO3A 3I0CA 1H7HA 2V0HA 1VGUA 3ZLLA 1ZCVA 1WT1A 4HO8A 3CGXA 1GWWA 2V0JA 3I0KA 3I0IX 2AM3A 4D0ZA 4KC4A 1ZJ2A 5C1GA 2VS4A 1E5KA 3PKPA 3R2WA 1FGXA 1ZJOA 1H5SA 1ZI1A 4ASYA 3OAMA 1I52A 2XWMA 2OEGA 3KIAA 4G3SA 1O7QA 2PX7A 1ON6A 1QG8A 3V0QA 5HS2A 1H5SB 1G95A 1O7OA 3SXAA 1MP4A 2XMEA 4FQWA 1FO9A 2A8UA 1ZJ1A 2VXLA 3V0NA 3GUEA 2RIXA 1G8OA 1VZUA 2AESA 2RJ5A 1O23B 1YP4A 2XMHA 2VXMA 3O3PA 2I5KA 2BO6A 4KC2A 1LZ0A 4G3QA 3I0HA 3RMWA 2P72A 3OH1A 3U2WA 5CQMX 4B4MA 3T7OA 3USRA 3RSBA 1VM8A 2WVLA 4HG6A 4AAWA 2QKXA 5FTSA 3PKQA 1FR8A 3V0OA 1EZIA 4JD0A 5C3DA 1W55A 1GQ9A 1ZDFA 1ZDGA 2Y6PA 1JVDA 3E26A 1V82A 1NWGB 2AM4A 3OH0A 1ZJPA 4EEGA 4B42A 2OI6A 4EE5A 4HO0A 5EIYA 2YCMA 2YQHA 1O0RA 2VS5A 1WVCA 2O1FA 3PNNA 3ZLKA 4B2XA 2E3DA 2RJ1A 2O1GA 1EYRA 5CMFX 3V0LA 5FUHA 3V91A 2BO8A 2Z87A 3SXBA 5C4BA 1VGTA 3F1CA 4Y7FA 1FGGA 3U0XA 1G93A 2FYAA 5CQOA 3RMVA 4NANA 2WAWA 2PGYA 4FRQA 3V0MA 1XHBA 1H5TB 1NQIB 4Y62A 4ASJA 4HO6A 1R7TA 5AJOA 5FV9A 1WT0A 3CKJA 5L6SA 2W0VA 4K6RA 4P02A 1FWYA 5BXCA 2VS3A 2AH9A 4BMAA 2BO7A 5CMIA 4MNDA 1ZJ3A 1MC3A 4J18A 4EEMA 2QGIA 2O1HA 2ICYA 2FY7A 2X5ZA 4AYLA 4KQLA 1JVGA 2P73A 2Y7AA 1Z90A 1H3MA 3U2TA 2Y4JA 1KWSA 2VFZA 4FREA 1R80A 5FU0A 4HO9A 4HCQA 5CMGX 1QGSA 5C8RA 3ST8A 2YC3A 3OH4A 2E8BA 3V8ZA 2P6WA 1V83A 2RITA 2RJ8A 5L6VA 2UX8A 2ZU9A 3K8DA 3SXDA 3IOJA 1HM9A 1H7GA 1HJLA 4ARWA 4FROA 3SX8A 1LZIA 1INIA 4Y9XA 2JCJA 4NALA
chains in the Genus database with same CATH superfamily
2RJ6A 1G3LA 3D5NA 1ZJ0A 4D0TA 2D7IA 4Y7UA 1VGZA 1LL2A 4LW6A 1NF5B 5EJZA 4D11C 3SX7A 2PA4A 1LZJA 3CU0A 4Y63A 1OMXA 1VGWA 4YS8A 4KNXA 1VZXA 1HM8A 4G3PA 1G0RA 4KT7A 2MZBA 3CKOA 1R7YA 1TVYA 1ZI4A 1R82A 4AYJA 2BO4A 1JYLA 3QVBA 1H7QA 4Y7VA 2FYCB 4EE3A 2X65A 4GBPA 5C1HA 2APCA 3D98A 3E25A 1R7VA 2YQCA 1GQCA 2FYDB 4FCUA 2ZU7A 4O6NA 1MP5A 2RIYA 4L41C 5AJNA 4KXOA 3I0JA 1XZ6A 1TW5A 2RJ7A 4M28A 4DE7A 3U2XA 5CQPA 1LZ7A 1G1LA 1HJJA 2GGQA 4KC1A 1YROB 4FRBA 4E1KA 5IDSA 4FRHA 2WEEA 3OH3A 3N9WA 1FOAA 1H7TA 1K4VA 2VD4A 1LVWA 1OMZA 1FR9A 4D48A 1GX4A 4DECA 1H4CA 4KNRA 2XWNA 1W57A 4HO2A 3U2VA 1H5TA 1GWVA 1IINA 1MP3A 2OI5A 3SX3A 4B4GA 1FZWA 2D0JA 1JV3A 1ON8A 3POLA 1HM0A 3T7MA 2D7RA 2FFVA 3ZGGA 4B2WA 2WVMA 3BRKX 1PZTA 4UEGA 5C36A 1JV1A 2WE9A 3OGZA 4HOCA 3DJ4A 5J49A 1VICA 4M4KA 5CQLX 2Q4JA 4BQHA 1QGQA 3I0GA 1H7FA 2ICXA 2NXVA 3BCVA 2JCLA 2PGVA 3DUVA 5C49A 3TZTA 5C38A 1H5SC 1GA8A 5CMJA 5C3BA 1HV9A 2YQSA 2J0BA 4G87A 3CKVA 3CKQA 2Y4LA 2JCOA 5DDVA 4FRAA 3R3IA 4FCEA 2Y4MA 1W77A 1PZYB 5C4CA 2Y4KA 4CJBA 2V0LA 2RJ9A 2RIZA 4C2SA 3OH2A 5EJ1A 4EVWA 3EE5A 2VK9A 2A8WA 3IOHA 4NAKA 1LL3A 2DPWA 3TQDA 1S4OA 5DDTA 2FFUA 2W0WA 3LW6A 1INJA 2JCKA 4FRPA 1ZCUA 3CKNA 4HO5A 1ZI3A 1S4NA 3ZF8A 1IIMA 3JUKA 1ZI5A 1G97A 2RJ0A 1NHEB 1ZHJA 3F1YA 3V8YA 4XWIA 1QWJA 1FO8A 2OI7A 4JISA 2I5EA 1VH1A 3HL3A 1ZIZA 1FXOA 1ZCYA 4Y7TA 1R7UA 2I7BA 5FU8A 1WT3A 3SXCA 2YC5A 1YP3A 3K8EA 4FRMA 3V90A 5FTVA 1FG5N 1NKHB 4EE4A 4AC3A 2YESA 2V0IA 3SXEA 3Q7UA 4Y7GA 5C48A 1SS9A 3I0EA 4KRVA 4P00A 4ZDQA 1WSZA 1R7XA 3JUJA 4FIXA 2X60A 1H4DA 3JTJA 4EEAA 1V84A 5I1FA 4FRDA 1LL0A 4R7PA 1GX0A 1H5SD 4MYBA 1R81A 5IDTA 3U0YA 5FYEA 4D11A 1TW1A 4NAIA 2OEFA 4KPXA 3FOQA 4CVHA 1OQMB 2ZU8A 3USQA 4EEOA 4Y64A 5CQNX 4B5BA 1FRWA 3OC9A 3OKRA 4FRLA 4IRPA 5IFYA 2WVKA 2Z86A 2VSHA 2AM5A 1H7LA 4HO4A 4CJ8A 4FIYA 3T7NA 3U2UA 3Q4SA 3I0FA 5C1LA 3ZGFA 2X5SA 3Q80A 3DK5A 1YP2A 3SX5A 1G9RA 4B3UA 1H4EA 1VZTA 2RJ4A 2YQJA 1H5RA 1JYKA 3SXGA 4Y6NA 4CJCA 1H7EA 1TZFA 1VPAA 4DDZA 1G23A 5C4EA 1H5RB 5C4DA 2AECA 1WT2A 4LW3A 1ZCTA 5JQQA 4M2AA 5AJPA 5CMHA 3IOIA 4M2BA 2XWLA 4KPZA 3FWWA 4IRQA 5C3AA 4MIXA 3NGWA 5C4FA 1NMMB 2QH5A 4B4BA 5C47A 1VH3A 3I0DA 1FXJA 3I0LA 1S4PA 2WGZA 3D8VA 2GGOA 2AGDA 2AE7A 3SPTA 2FYBA 4Y6UA 3V0PA 2CU2A 1G2VA 2V0KA 4ECMA 2VSIA 4HO3A 3I0CA 1H7HA 2V0HA 1VGUA 3ZLLA 1ZCVA 1WT1A 4HO8A 3CGXA 1GWWA 2C0NA 2V0JA 3I0KA 3I0IX 2AM3A 4D0ZA 4KC4A 1ZJ2A 5C1GA 2VS4A 1E5KA 3PKPA 3R2WA 1FGXA 1ZJOA 1H5SA 1ZI1A 4ASYA 3OAMA 1I52A 2XWMA 2OEGA 3KIAA 4G3SA 1O7QA 2PX7A 1ON6A 1QG8A 3V0QA 5HS2A 1H5SB 1G95A 1O7OA 3SXAA 1MP4A 2XMEA 4FQWA 1FO9A 2A8UA 1ZJ1A 2VXLA 3V0NA 3GUEA 2RIXA 1G8OA 1VZUA 2AESA 2RJ5A 1O23B 1YP4A 2XMHA 5D92A 2VXMA 3O3PA 2I5KA 2BO6A 4KC2A 1LZ0A 4G3QA 3I0HA 4O6MA 2J0AA 3RMWA 2P72A 3OH1A 3U2WA 5CQMX 4B4MA 3T7OA 5D91A 3USRA 3RSBA 1VM8A 2WVLA 4HG6A 4AAWA 2QKXA 5FTSA 3PKQA 1FR8A 3V0OA 1EZIA 4JD0A 5C3DA 1W55A 1GQ9A 1ZDFA 1ZDGA 2Y6PA 1JVDA 3E26A 1V82A 1NWGB 2AM4A 3OH0A 1ZJPA 4EEGA 4B42A 2OI6A 4EE5A 4HO0A 5EIYA 2YCMA 2YQHA 1O0RA 2VS5A 1WVCA 2O1FA 3PNNA 3ZLKA 4B2XA 2E3DA 2RJ1A 2O1GA 1EYRA 5CMFX 3V0LA 5FUHA 3V91A 2BO8A 2Z87A 3SXBA 5C4BA 1VGTA 3F1CA 4Y7FA 1FGGA 3U0XA 1G93A 2FYAA 5CQOA 3RMVA 4NANA 2WAWA 2PGYA 4FRQA 3V0MA 1XHBA 1H5TB 1NQIB 4Y62A 4ASJA 4HO6A 1R7TA 5AJOA 5FV9A 1WT0A 3CKJA 5L6SA 2W0VA 4K6RA 4P02A 1FWYA 4Q7CA 5BXCA 2VS3A 2AH9A 4BMAA 2BO7A 5CMIA 4MNDA 1ZJ3A 1MC3A 4J18A 4EEMA 2QGIA 2O1HA 2ICYA 2FY7A 2X5ZA 4AYLA 4KQLA 1JVGA 2P73A 2Y7AA 1Z90A 1H3MA 3U2TA 2Y4JA 1KWSA 2VFZA 4FREA 1R80A 5FU0A 4HO9A 4HCQA 5CMGX 1QGSA 5C8RA 3ST8A 2YC3A 3OH4A 2E8BA 3V8ZA 2P6WA 1V83A 2RITA 2RJ8A 5L6VA 2UX8A 2ZU9A 3K8DA 3SXDA 3IOJA 1HM9A 1H7GA 1HJLA 4ARWA 4FROA 3SX8A 1LZIA 1INIA 4Y9XA 2JCJA 4NALA
chains in the Genus database with same CATH topology
2RJ6A 1G3LA 3D5NA 1ZJ0A 4D0TA 2D7IA 4Y7UA 1VGZA 1LL2A 4LW6A 1NF5B 5EJZA 4D11C 3SX7A 2PA4A 1LZJA 3CU0A 4Y63A 1OMXA 1VGWA 4YS8A 4KNXA 1VZXA 1HM8A 4G3PA 1G0RA 4KT7A 2MZBA 3CKOA 1R7YA 1TVYA 1ZI4A 1R82A 4AYJA 2BO4A 1JYLA 3QVBA 1H7QA 4Y7VA 2FYCB 4EE3A 2X65A 4GBPA 5C1HA 2APCA 3D98A 3E25A 1R7VA 2YQCA 1GQCA 2FYDB 4FCUA 2ZU7A 4O6NA 1MP5A 2RIYA 4L41C 5AJNA 4KXOA 3I0JA 1XZ6A 1TW5A 2RJ7A 4M28A 4DE7A 3U2XA 5CQPA 1LZ7A 1G1LA 1HJJA 2GGQA 4KC1A 1YROB 4FRBA 4E1KA 5IDSA 4FRHA 2WEEA 3OH3A 3N9WA 1FOAA 1H7TA 1K4VA 2VD4A 1LVWA 1OMZA 1FR9A 4D48A 1GX4A 4DECA 1H4CA 4KNRA 2XWNA 1W57A 4HO2A 3U2VA 1H5TA 1GWVA 1IINA 1MP3A 2OI5A 3SX3A 4B4GA 1FZWA 2D0JA 1JV3A 1ON8A 3POLA 1HM0A 3T7MA 2D7RA 2FFVA 3ZGGA 4B2WA 2WVMA 3BRKX 1PZTA 4UEGA 5C36A 1JV1A 2WE9A 3OGZA 4HOCA 3DJ4A 5J49A 1VICA 4M4KA 5CQLX 2Q4JA 4BQHA 1QGQA 3I0GA 1H7FA 2ICXA 2NXVA 3BCVA 2JCLA 2PGVA 3DUVA 5C49A 3TZTA 5C38A 1H5SC 1GA8A 5CMJA 5C3BA 1HV9A 2YQSA 2J0BA 4G87A 3CKVA 3CKQA 2Y4LA 2JCOA 5DDVA 4FRAA 3R3IA 4FCEA 2Y4MA 1W77A 1PZYB 5C4CA 2Y4KA 4CJBA 2V0LA 2RJ9A 2RIZA 4C2SA 3OH2A 5EJ1A 4EVWA 3EE5A 2VK9A 2A8WA 3IOHA 4NAKA 1LL3A 2DPWA 3TQDA 1S4OA 5DDTA 2FFUA 2W0WA 3LW6A 1INJA 2JCKA 4FRPA 1ZCUA 3CKNA 4HO5A 1ZI3A 1S4NA 3ZF8A 1IIMA 3JUKA 1ZI5A 1G97A 2RJ0A 1NHEB 1ZHJA 3F1YA 3V8YA 4XWIA 1QWJA 1FO8A 2OI7A 4JISA 2I5EA 1VH1A 3HL3A 1ZIZA 1FXOA 1ZCYA 4Y7TA 1R7UA 2I7BA 5FU8A 1WT3A 3SXCA 2YC5A 1YP3A 3K8EA 4FRMA 3V90A 5FTVA 1FG5N 1NKHB 4EE4A 4AC3A 2YESA 2V0IA 3SXEA 3Q7UA 4Y7GA 5C48A 1SS9A 3I0EA 4KRVA 4P00A 4ZDQA 1WSZA 1R7XA 3JUJA 4FIXA 2X60A 1H4DA 3JTJA 4EEAA 1V84A 5I1FA 4FRDA 1LL0A 4R7PA 1GX0A 1H5SD 4MYBA 1R81A 5IDTA 3U0YA 5FYEA 4D11A 1TW1A 4NAIA 2OEFA 4KPXA 3FOQA 4CVHA 1OQMB 2ZU8A 3USQA 4EEOA 4Y64A 5CQNX 4B5BA 1FRWA 3OC9A 3OKRA 4FRLA 4IRPA 5IFYA 2WVKA 2Z86A 2VSHA 2AM5A 1H7LA 4HO4A 4CJ8A 4FIYA 3T7NA 3U2UA 3Q4SA 3I0FA 5C1LA 3ZGFA 2X5SA 3Q80A 3DK5A 1YP2A 3SX5A 1G9RA 4B3UA 1H4EA 1VZTA 2RJ4A 2YQJA 1H5RA 1JYKA 3SXGA 4Y6NA 4CJCA 1H7EA 1TZFA 1VPAA 4DDZA 1G23A 5C4EA 1H5RB 5C4DA 2AECA 1WT2A 4LW3A 1ZCTA 5JQQA 4M2AA 5AJPA 5CMHA 3IOIA 4M2BA 2XWLA 4KPZA 3FWWA 4IRQA 5C3AA 4MIXA 3NGWA 5C4FA 1NMMB 2QH5A 4B4BA 5C47A 1VH3A 3I0DA 1FXJA 3I0LA 1S4PA 2WGZA 3D8VA 2GGOA 2AGDA 2AE7A 3SPTA 2FYBA 4Y6UA 3V0PA 2CU2A 1G2VA 2V0KA 4ECMA 2VSIA 4HO3A 3I0CA 1H7HA 2V0HA 1VGUA 3ZLLA 1ZCVA 1WT1A 4HO8A 3CGXA 1GWWA 2C0NA 2V0JA 3I0KA 3I0IX 2AM3A 4D0ZA 4KC4A 1ZJ2A 5C1GA 2VS4A 1E5KA 3PKPA 3R2WA 1FGXA 1ZJOA 1H5SA 1ZI1A 4ASYA 3OAMA 1I52A 2XWMA 2OEGA 3KIAA 4G3SA 1O7QA 2PX7A 1ON6A 1QG8A 3V0QA 5HS2A 1H5SB 1G95A 1O7OA 3SXAA 1MP4A 2XMEA 4FQWA 1FO9A 2A8UA 1ZJ1A 2VXLA 3V0NA 3GUEA 2RIXA 1G8OA 1VZUA 2AESA 2RJ5A 1O23B 1YP4A 2XMHA 5D92A 2VXMA 3O3PA 2I5KA 2BO6A 4KC2A 1LZ0A 4G3QA 3I0HA 4O6MA 2J0AA 3RMWA 2P72A 3OH1A 3U2WA 5CQMX 4B4MA 3T7OA 5D91A 3USRA 3RSBA 1VM8A 2WVLA 4HG6A 4AAWA 2QKXA 5FTSA 3PKQA 1FR8A 3V0OA 1EZIA 4JD0A 5C3DA 1W55A 1GQ9A 1ZDFA 1ZDGA 2Y6PA 1JVDA 3E26A 1V82A 1NWGB 2AM4A 3OH0A 1ZJPA 4EEGA 4B42A 2OI6A 4EE5A 4HO0A 5EIYA 2YCMA 2YQHA 1O0RA 2VS5A 1WVCA 2O1FA 3PNNA 3ZLKA 4B2XA 2E3DA 2RJ1A 2O1GA 1EYRA 5CMFX 3V0LA 5FUHA 3V91A 2BO8A 2Z87A 3SXBA 5C4BA 1VGTA 3F1CA 4Y7FA 1FGGA 3U0XA 1G93A 2FYAA 5CQOA 3RMVA 4NANA 2WAWA 2PGYA 4FRQA 3V0MA 1XHBA 1H5TB 1NQIB 4Y62A 4ASJA 4HO6A 1R7TA 5AJOA 5FV9A 1WT0A 3CKJA 5L6SA 2W0VA 4K6RA 4P02A 1FWYA 4Q7CA 5BXCA 2VS3A 2AH9A 4BMAA 2BO7A 5CMIA 4MNDA 1ZJ3A 1MC3A 4J18A 4EEMA 2QGIA 2O1HA 2ICYA 2FY7A 2X5ZA 4AYLA 4KQLA 1JVGA 2P73A 2Y7AA 1Z90A 1H3MA 3U2TA 2Y4JA 1KWSA 2VFZA 4FREA 1R80A 5FU0A 4HO9A 4HCQA 5CMGX 1QGSA 5C8RA 3ST8A 2YC3A 3OH4A 2E8BA 3V8ZA 2P6WA 1V83A 2RITA 2RJ8A 5L6VA 2UX8A 2ZU9A 3K8DA 3SXDA 3IOJA 1HM9A 1H7GA 1HJLA 4ARWA 4FROA 3SX8A 1LZIA 1INIA 4Y9XA 2JCJA 4NALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJ6 A;  1G3L A;  3D5N A;  1ZJ0 A;  4D0T A;  2D7I A;  4Y7U A;  1VGZ A;  1LL2 A;  4LW6 A;  1NF5 B;  5EJZ A;  4D11 C;  3SX7 A;  2PA4 A;  1LZJ A;  3CU0 A;  4Y63 A;  1OMX A;  1VGW A;  4YS8 A;  4KNX A;  1VZX A;  1HM8 A;  4G3P A;  1G0R A;  4KT7 A;  2MZB A;  3CKO A;  1R7Y A;  1TVY A;  1ZI4 A;  1R82 A;  4AYJ A;  2BO4 A;  1JYL A;  3QVB A;  1H7Q A;  4Y7V A;  2FYC B;  4EE3 A;  2X65 A;  4GBP A;  5C1H A;  2APC A;  3D98 A;  3E25 A;  1R7V A;  2YQC A;  1GQC A;  2FYD B;  4FCU A;  2ZU7 A;  1MP5 A;  2RIY A;  4L41 C;  5AJN A;  4KXO A;  3I0J A;  1XZ6 A;  1TW5 A;  2RJ7 A;  4M28 A;  4DE7 A;  3U2X A;  5CQP A;  1LZ7 A;  1G1L A;  1HJJ A;  2GGQ A;  4KC1 A;  1YRO B;  4FRB A;  4E1K A;  5IDS A;  4FRH A;  2WEE A;  3OH3 A;  3N9W A;  1FOA A;  1H7T A;  1K4V A;  2VD4 A;  1LVW A;  1OMZ A;  1FR9 A;  4D48 A;  1GX4 A;  4DEC A;  1H4C A;  4KNR A;  2XWN A;  1W57 A;  4HO2 A;  3U2V A;  1H5T A;  1GWV A;  1IIN A;  1MP3 A;  2OI5 A;  3SX3 A;  4B4G A;  1FZW A;  2D0J A;  1JV3 A;  1ON8 A;  3POL A;  1HM0 A;  3T7M A;  2D7R A;  2FFV A;  3ZGG A;  4B2W A;  2WVM A;  3BRK X;  1PZT A;  4UEG A;  5C36 A;  1JV1 A;  2WE9 A;  3OGZ A;  4HOC A;  3DJ4 A;  5J49 A;  1VIC A;  4M4K A;  5CQL X;  2Q4J A;  4BQH A;  1QGQ A;  3I0G A;  1H7F A;  2ICX A;  2NXV A;  3BCV A;  2JCL A;  2PGV A;  3DUV A;  5C49 A;  3TZT A;  5C38 A;  1H5S C;  1GA8 A;  5CMJ A;  5C3B A;  1HV9 A;  2YQS A;  4G87 A;  3CKV A;  3CKQ A;  2Y4L A;  2JCO A;  5DDV A;  4FRA A;  3R3I A;  4FCE A;  2Y4M A;  1W77 A;  1PZY B;  5C4C A;  2Y4K A;  4CJB A;  2V0L A;  2RJ9 A;  2RIZ A;  4C2S A;  3OH2 A;  5EJ1 A;  4EVW A;  3EE5 A;  2A8W A;  3IOH A;  4NAK A;  1LL3 A;  2DPW A;  3TQD A;  1S4O A;  5DDT A;  2FFU A;  2W0W A;  3LW6 A;  1INJ A;  2JCK A;  4FRP A;  1ZCU A;  3CKN A;  4HO5 A;  1ZI3 A;  1S4N A;  3ZF8 A;  1IIM A;  3JUK A;  1ZI5 A;  1G97 A;  2RJ0 A;  1NHE B;  1ZHJ A;  3F1Y A;  3V8Y A;  4XWI A;  1QWJ A;  1FO8 A;  2OI7 A;  4JIS A;  2I5E A;  1VH1 A;  3HL3 A;  1ZIZ A;  1FXO A;  1ZCY A;  4Y7T A;  1R7U A;  2I7B A;  5FU8 A;  1WT3 A;  3SXC A;  2YC5 A;  1YP3 A;  3K8E A;  4FRM A;  3V90 A;  5FTV A;  1FG5 N;  1NKH B;  4EE4 A;  4AC3 A;  2YES A;  2V0I A;  3SXE A;  3Q7U A;  4Y7G A;  5C48 A;  1SS9 A;  3I0E A;  4KRV A;  4P00 A;  4ZDQ A;  1WSZ A;  1R7X A;  3JUJ A;  2X60 A;  1H4D A;  3JTJ A;  4EEA A;  1V84 A;  5I1F A;  4FRD A;  1LL0 A;  4R7P A;  1GX0 A;  1H5S D;  4MYB A;  1R81 A;  5IDT A;  3U0Y A;  5FYE A;  4D11 A;  1TW1 A;  4NAI A;  2OEF A;  4KPX A;  3FOQ A;  4CVH A;  1OQM B;  2ZU8 A;  3USQ A;  4EEO A;  4Y64 A;  5CQN X;  4B5B A;  1FRW A;  3OC9 A;  3OKR A;  4FRL A;  4IRP A;  5IFY A;  2WVK A;  2Z86 A;  2VSH A;  2AM5 A;  1H7L A;  4HO4 A;  4CJ8 A;  3T7N A;  3U2U A;  3Q4S A;  3I0F A;  5C1L A;  3ZGF A;  2X5S A;  3Q80 A;  3DK5 A;  1YP2 A;  3SX5 A;  1G9R A;  4B3U A;  1H4E A;  1VZT A;  2RJ4 A;  2YQJ A;  1H5R A;  1JYK A;  3SXG A;  4Y6N A;  4CJC A;  1H7E A;  1TZF A;  1VPA A;  4DDZ A;  1G23 A;  5C4E A;  1H5R B;  5C4D A;  2AEC A;  1WT2 A;  4LW3 A;  1ZCT A;  5JQQ A;  4M2A A;  5AJP A;  5CMH A;  3IOI A;  4M2B A;  2XWL A;  4KPZ A;  3FWW A;  4IRQ A;  5C3A A;  3NGW A;  5C4F A;  1NMM B;  2QH5 A;  4B4B A;  5C47 A;  1VH3 A;  3I0D A;  1FXJ A;  3I0L A;  1S4P A;  2WGZ A;  3D8V A;  2GGO A;  2AGD A;  2AE7 A;  3SPT A;  2FYB A;  4Y6U A;  3V0P A;  2CU2 A;  1G2V A;  2V0K A;  4ECM A;  2VSI A;  4HO3 A;  3I0C A;  1H7H A;  2V0H A;  1VGU A;  3ZLL A;  1ZCV A;  1WT1 A;  4HO8 A;  3CGX A;  1GWW A;  2V0J A;  3I0K A;  3I0I X;  2AM3 A;  4D0Z A;  4KC4 A;  1ZJ2 A;  5C1G A;  2VS4 A;  1E5K A;  3PKP A;  3R2W A;  1FGX A;  1ZJO A;  1H5S A;  1ZI1 A;  4ASY A;  3OAM A;  1I52 A;  2XWM A;  2OEG A;  3KIA A;  4G3S A;  1O7Q A;  2PX7 A;  1ON6 A;  1QG8 A;  3V0Q A;  5HS2 A;  1H5S B;  1G95 A;  1O7O A;  3SXA A;  1MP4 A;  2XME A;  4FQW A;  1FO9 A;  2A8U A;  1ZJ1 A;  2VXL A;  3V0N A;  3GUE A;  2RIX A;  1G8O A;  1VZU A;  2AES A;  2RJ5 A;  1O23 B;  1YP4 A;  2XMH A;  2VXM A;  3O3P A;  2I5K A;  2BO6 A;  4KC2 A;  1LZ0 A;  4G3Q A;  3I0H A;  3RMW A;  2P72 A;  3OH1 A;  3U2W A;  5CQM X;  4B4M A;  3T7O A;  3USR A;  3RSB A;  1VM8 A;  2WVL A;  4HG6 A;  4AAW A;  2QKX A;  5FTS A;  3PKQ A;  1FR8 A;  3V0O A;  1EZI A;  4JD0 A;  5C3D A;  1W55 A;  1GQ9 A;  1ZDF A;  1ZDG A;  2Y6P A;  1JVD A;  3E26 A;  1V82 A;  1NWG B;  2AM4 A;  3OH0 A;  1ZJP A;  4EEG A;  4B42 A;  2OI6 A;  4EE5 A;  4HO0 A;  5EIY A;  2YCM A;  2YQH A;  1O0R A;  2VS5 A;  1WVC A;  2O1F A;  3PNN A;  3ZLK A;  4B2X A;  2E3D A;  2RJ1 A;  2O1G A;  1EYR A;  5CMF X;  3V0L A;  5FUH A;  3V91 A;  2BO8 A;  2Z87 A;  3SXB A;  5C4B A;  1VGT A;  3F1C A;  4Y7F A;  1FGG A;  3U0X A;  1G93 A;  2FYA A;  5CQO A;  3RMV A;  4NAN A;  2WAW A;  2PGY A;  4FRQ A;  3V0M A;  1XHB A;  1H5T B;  1NQI B;  4Y62 A;  4ASJ A;  4HO6 A;  1R7T A;  5AJO A;  5FV9 A;  1WT0 A;  3CKJ A;  5L6S A;  2W0V A;  4K6R A;  4P02 A;  1FWY A;  5BXC A;  2VS3 A;  2AH9 A;  4BMA A;  2BO7 A;  5CMI A;  4MND A;  1ZJ3 A;  1MC3 A;  4J18 A;  4EEM A;  2QGI A;  2O1H A;  2ICY A;  2FY7 A;  2X5Z A;  4AYL A;  4KQL A;  1JVG A;  2P73 A;  2Y7A A;  1Z90 A;  1H3M A;  3U2T A;  2Y4J A;  1KWS A;  2VFZ A;  4FRE A;  1R80 A;  5FU0 A;  4HO9 A;  4HCQ A;  5CMG X;  1QGS A;  5C8R A;  3ST8 A;  2YC3 A;  3OH4 A;  2E8B A;  3V8Z A;  2P6W A;  1V83 A;  2RIT A;  2RJ8 A;  5L6V A;  2UX8 A;  2ZU9 A;  3K8D A;  3SXD A;  3IOJ A;  1HM9 A;  1H7G A;  1HJL A;  4ARW A;  4FRO A;  3SX8 A;  1LZI A;  1INI A;  4Y9X A;  2JCJ A;  4NAL A; 
#chains in the Genus database with same CATH topology
 2RJ6 A;  1G3L A;  3D5N A;  1ZJ0 A;  4D0T A;  2D7I A;  4Y7U A;  1VGZ A;  1LL2 A;  4LW6 A;  1NF5 B;  5EJZ A;  4D11 C;  3SX7 A;  2PA4 A;  1LZJ A;  3CU0 A;  4Y63 A;  1OMX A;  1VGW A;  4YS8 A;  4KNX A;  1VZX A;  1HM8 A;  4G3P A;  1G0R A;  4KT7 A;  2MZB A;  3CKO A;  1R7Y A;  1TVY A;  1ZI4 A;  1R82 A;  4AYJ A;  2BO4 A;  1JYL A;  3QVB A;  1H7Q A;  4Y7V A;  2FYC B;  4EE3 A;  2X65 A;  4GBP A;  5C1H A;  2APC A;  3D98 A;  3E25 A;  1R7V A;  2YQC A;  1GQC A;  2FYD B;  4FCU A;  2ZU7 A;  4O6N A;  1MP5 A;  2RIY A;  4L41 C;  5AJN A;  4KXO A;  3I0J A;  1XZ6 A;  1TW5 A;  2RJ7 A;  4M28 A;  4DE7 A;  3U2X A;  5CQP A;  1LZ7 A;  1G1L A;  1HJJ A;  2GGQ A;  4KC1 A;  1YRO B;  4FRB A;  4E1K A;  5IDS A;  4FRH A;  2WEE A;  3OH3 A;  3N9W A;  1FOA A;  1H7T A;  1K4V A;  2VD4 A;  1LVW A;  1OMZ A;  1FR9 A;  4D48 A;  1GX4 A;  4DEC A;  1H4C A;  4KNR A;  2XWN A;  1W57 A;  4HO2 A;  3U2V A;  1H5T A;  1GWV A;  1IIN A;  1MP3 A;  2OI5 A;  3SX3 A;  4B4G A;  1FZW A;  2D0J A;  1JV3 A;  1ON8 A;  3POL A;  1HM0 A;  3T7M A;  2D7R A;  2FFV A;  3ZGG A;  4B2W A;  2WVM A;  3BRK X;  1PZT A;  4UEG A;  5C36 A;  1JV1 A;  2WE9 A;  3OGZ A;  4HOC A;  3DJ4 A;  5J49 A;  1VIC A;  4M4K A;  5CQL X;  2Q4J A;  4BQH A;  1QGQ A;  3I0G A;  1H7F A;  2ICX A;  2NXV A;  3BCV A;  2JCL A;  2PGV A;  3DUV A;  5C49 A;  3TZT A;  5C38 A;  1H5S C;  1GA8 A;  5CMJ A;  5C3B A;  1HV9 A;  2YQS A;  2J0B A;  4G87 A;  3CKV A;  3CKQ A;  2Y4L A;  2JCO A;  5DDV A;  4FRA A;  3R3I A;  4FCE A;  2Y4M A;  1W77 A;  1PZY B;  5C4C A;  2Y4K A;  4CJB A;  2V0L A;  2RJ9 A;  2RIZ A;  4C2S A;  3OH2 A;  5EJ1 A;  4EVW A;  3EE5 A;  2VK9 A;  2A8W A;  3IOH A;  4NAK A;  1LL3 A;  2DPW A;  3TQD A;  1S4O A;  5DDT A;  2FFU A;  2W0W A;  3LW6 A;  1INJ A;  2JCK A;  4FRP A;  1ZCU A;  3CKN A;  4HO5 A;  1ZI3 A;  1S4N A;  3ZF8 A;  1IIM A;  3JUK A;  1ZI5 A;  1G97 A;  2RJ0 A;  1NHE B;  1ZHJ A;  3F1Y A;  3V8Y A;  4XWI A;  1QWJ A;  1FO8 A;  2OI7 A;  4JIS A;  2I5E A;  1VH1 A;  3HL3 A;  1ZIZ A;  1FXO A;  1ZCY A;  4Y7T A;  1R7U A;  2I7B A;  5FU8 A;  1WT3 A;  3SXC A;  2YC5 A;  1YP3 A;  3K8E A;  4FRM A;  3V90 A;  5FTV A;  1FG5 N;  1NKH B;  4EE4 A;  4AC3 A;  2YES A;  2V0I A;  3SXE A;  3Q7U A;  4Y7G A;  5C48 A;  1SS9 A;  3I0E A;  4KRV A;  4P00 A;  4ZDQ A;  1WSZ A;  1R7X A;  3JUJ A;  4FIX A;  2X60 A;  1H4D A;  3JTJ A;  4EEA A;  1V84 A;  5I1F A;  4FRD A;  1LL0 A;  4R7P A;  1GX0 A;  1H5S D;  4MYB A;  1R81 A;  5IDT A;  3U0Y A;  5FYE A;  4D11 A;  1TW1 A;  4NAI A;  2OEF A;  4KPX A;  3FOQ A;  4CVH A;  1OQM B;  2ZU8 A;  3USQ A;  4EEO A;  4Y64 A;  5CQN X;  4B5B A;  1FRW A;  3OC9 A;  3OKR A;  4FRL A;  4IRP A;  5IFY A;  2WVK A;  2Z86 A;  2VSH A;  2AM5 A;  1H7L A;  4HO4 A;  4CJ8 A;  4FIY A;  3T7N A;  3U2U A;  3Q4S A;  3I0F A;  5C1L A;  3ZGF A;  2X5S A;  3Q80 A;  3DK5 A;  1YP2 A;  3SX5 A;  1G9R A;  4B3U A;  1H4E A;  1VZT A;  2RJ4 A;  2YQJ A;  1H5R A;  1JYK A;  3SXG A;  4Y6N A;  4CJC A;  1H7E A;  1TZF A;  1VPA A;  4DDZ A;  1G23 A;  5C4E A;  1H5R B;  5C4D A;  2AEC A;  1WT2 A;  4LW3 A;  1ZCT A;  5JQQ A;  4M2A A;  5AJP A;  5CMH A;  3IOI A;  4M2B A;  2XWL A;  4KPZ A;  3FWW A;  4IRQ A;  5C3A A;  4MIX A;  3NGW A;  5C4F A;  1NMM B;  2QH5 A;  4B4B A;  5C47 A;  1VH3 A;  3I0D A;  1FXJ A;  3I0L A;  1S4P A;  2WGZ A;  3D8V A;  2GGO A;  2AGD A;  2AE7 A;  3SPT A;  2FYB A;  4Y6U A;  3V0P A;  2CU2 A;  1G2V A;  2V0K A;  4ECM A;  2VSI A;  4HO3 A;  3I0C A;  1H7H A;  2V0H A;  1VGU A;  3ZLL A;  1ZCV A;  1WT1 A;  4HO8 A;  3CGX A;  1GWW A;  2C0N A;  2V0J A;  3I0K A;  3I0I X;  2AM3 A;  4D0Z A;  4KC4 A;  1ZJ2 A;  5C1G A;  2VS4 A;  1E5K A;  3PKP A;  3R2W A;  1FGX A;  1ZJO A;  1H5S A;  1ZI1 A;  4ASY A;  3OAM A;  1I52 A;  2XWM A;  2OEG A;  3KIA A;  4G3S A;  1O7Q A;  2PX7 A;  1ON6 A;  1QG8 A;  3V0Q A;  5HS2 A;  1H5S B;  1G95 A;  1O7O A;  3SXA A;  1MP4 A;  2XME A;  4FQW A;  1FO9 A;  2A8U A;  1ZJ1 A;  2VXL A;  3V0N A;  3GUE A;  2RIX A;  1G8O A;  1VZU A;  2AES A;  2RJ5 A;  1O23 B;  1YP4 A;  2XMH A;  5D92 A;  2VXM A;  3O3P A;  2I5K A;  2BO6 A;  4KC2 A;  1LZ0 A;  4G3Q A;  3I0H A;  4O6M A;  2J0A A;  3RMW A;  2P72 A;  3OH1 A;  3U2W A;  5CQM X;  4B4M A;  3T7O A;  5D91 A;  3USR A;  3RSB A;  1VM8 A;  2WVL A;  4HG6 A;  4AAW A;  2QKX A;  5FTS A;  3PKQ A;  1FR8 A;  3V0O A;  1EZI A;  4JD0 A;  5C3D A;  1W55 A;  1GQ9 A;  1ZDF A;  1ZDG A;  2Y6P A;  1JVD A;  3E26 A;  1V82 A;  1NWG B;  2AM4 A;  3OH0 A;  1ZJP A;  4EEG A;  4B42 A;  2OI6 A;  4EE5 A;  4HO0 A;  5EIY A;  2YCM A;  2YQH A;  1O0R A;  2VS5 A;  1WVC A;  2O1F A;  3PNN A;  3ZLK A;  4B2X A;  2E3D A;  2RJ1 A;  2O1G A;  1EYR A;  5CMF X;  3V0L A;  5FUH A;  3V91 A;  2BO8 A;  2Z87 A;  3SXB A;  5C4B A;  1VGT A;  3F1C A;  4Y7F A;  1FGG A;  3U0X A;  1G93 A;  2FYA A;  5CQO A;  3RMV A;  4NAN A;  2WAW A;  2PGY A;  4FRQ A;  3V0M A;  1XHB A;  1H5T B;  1NQI B;  4Y62 A;  4ASJ A;  4HO6 A;  1R7T A;  5AJO A;  5FV9 A;  1WT0 A;  3CKJ A;  5L6S A;  2W0V A;  4K6R A;  4P02 A;  1FWY A;  4Q7C A;  5BXC A;  2VS3 A;  2AH9 A;  4BMA A;  2BO7 A;  5CMI A;  4MND A;  1ZJ3 A;  1MC3 A;  4J18 A;  4EEM A;  2QGI A;  2O1H A;  2ICY A;  2FY7 A;  2X5Z A;  4AYL A;  4KQL A;  1JVG A;  2P73 A;  2Y7A A;  1Z90 A;  1H3M A;  3U2T A;  2Y4J A;  1KWS A;  2VFZ A;  4FRE A;  1R80 A;  5FU0 A;  4HO9 A;  4HCQ A;  5CMG X;  1QGS A;  5C8R A;  3ST8 A;  2YC3 A;  3OH4 A;  2E8B A;  3V8Z A;  2P6W A;  1V83 A;  2RIT A;  2RJ8 A;  5L6V A;  2UX8 A;  2ZU9 A;  3K8D A;  3SXD A;  3IOJ A;  1HM9 A;  1H7G A;  1HJL A;  4ARW A;  4FRO A;  3SX8 A;  1LZI A;  1INI A;  4Y9X A;  2JCJ A;  4NAL A; 
#chains in the Genus database with same CATH homology
 2RJ6 A;  1G3L A;  3D5N A;  1ZJ0 A;  4D0T A;  2D7I A;  4Y7U A;  1VGZ A;  1LL2 A;  4LW6 A;  1NF5 B;  5EJZ A;  4D11 C;  3SX7 A;  2PA4 A;  1LZJ A;  3CU0 A;  4Y63 A;  1OMX A;  1VGW A;  4YS8 A;  4KNX A;  1VZX A;  1HM8 A;  4G3P A;  1G0R A;  4KT7 A;  2MZB A;  3CKO A;  1R7Y A;  1TVY A;  1ZI4 A;  1R82 A;  4AYJ A;  2BO4 A;  1JYL A;  3QVB A;  1H7Q A;  4Y7V A;  2FYC B;  4EE3 A;  2X65 A;  4GBP A;  5C1H A;  2APC A;  3D98 A;  3E25 A;  1R7V A;  2YQC A;  1GQC A;  2FYD B;  4FCU A;  2ZU7 A;  4O6N A;  1MP5 A;  2RIY A;  4L41 C;  5AJN A;  4KXO A;  3I0J A;  1XZ6 A;  1TW5 A;  2RJ7 A;  4M28 A;  4DE7 A;  3U2X A;  5CQP A;  1LZ7 A;  1G1L A;  1HJJ A;  2GGQ A;  4KC1 A;  1YRO B;  4FRB A;  4E1K A;  5IDS A;  4FRH A;  2WEE A;  3OH3 A;  3N9W A;  1FOA A;  1H7T A;  1K4V A;  2VD4 A;  1LVW A;  1OMZ A;  1FR9 A;  4D48 A;  1GX4 A;  4DEC A;  1H4C A;  4KNR A;  2XWN A;  1W57 A;  4HO2 A;  3U2V A;  1H5T A;  1GWV A;  1IIN A;  1MP3 A;  2OI5 A;  3SX3 A;  4B4G A;  1FZW A;  2D0J A;  1JV3 A;  1ON8 A;  3POL A;  1HM0 A;  3T7M A;  2D7R A;  2FFV A;  3ZGG A;  4B2W A;  2WVM A;  3BRK X;  1PZT A;  4UEG A;  5C36 A;  1JV1 A;  2WE9 A;  3OGZ A;  4HOC A;  3DJ4 A;  5J49 A;  1VIC A;  4M4K A;  5CQL X;  2Q4J A;  4BQH A;  1QGQ A;  3I0G A;  1H7F A;  2ICX A;  2NXV A;  3BCV A;  2JCL A;  2PGV A;  3DUV A;  5C49 A;  3TZT A;  5C38 A;  1H5S C;  1GA8 A;  5CMJ A;  5C3B A;  1HV9 A;  2YQS A;  2J0B A;  4G87 A;  3CKV A;  3CKQ A;  2Y4L A;  2JCO A;  5DDV A;  4FRA A;  3R3I A;  4FCE A;  2Y4M A;  1W77 A;  1PZY B;  5C4C A;  2Y4K A;  4CJB A;  2V0L A;  2RJ9 A;  2RIZ A;  4C2S A;  3OH2 A;  5EJ1 A;  4EVW A;  3EE5 A;  2VK9 A;  2A8W A;  3IOH A;  4NAK A;  1LL3 A;  2DPW A;  3TQD A;  1S4O A;  5DDT A;  2FFU A;  2W0W A;  3LW6 A;  1INJ A;  2JCK A;  4FRP A;  1ZCU A;  3CKN A;  4HO5 A;  1ZI3 A;  1S4N A;  3ZF8 A;  1IIM A;  3JUK A;  1ZI5 A;  1G97 A;  2RJ0 A;  1NHE B;  1ZHJ A;  3F1Y A;  3V8Y A;  4XWI A;  1QWJ A;  1FO8 A;  2OI7 A;  4JIS A;  2I5E A;  1VH1 A;  3HL3 A;  1ZIZ A;  1FXO A;  1ZCY A;  4Y7T A;  1R7U A;  2I7B A;  5FU8 A;  1WT3 A;  3SXC A;  2YC5 A;  1YP3 A;  3K8E A;  4FRM A;  3V90 A;  5FTV A;  1FG5 N;  1NKH B;  4EE4 A;  4AC3 A;  2YES A;  2V0I A;  3SXE A;  3Q7U A;  4Y7G A;  5C48 A;  1SS9 A;  3I0E A;  4KRV A;  4P00 A;  4ZDQ A;  1WSZ A;  1R7X A;  3JUJ A;  4FIX A;  2X60 A;  1H4D A;  3JTJ A;  4EEA A;  1V84 A;  5I1F A;  4FRD A;  1LL0 A;  4R7P A;  1GX0 A;  1H5S D;  4MYB A;  1R81 A;  5IDT A;  3U0Y A;  5FYE A;  4D11 A;  1TW1 A;  4NAI A;  2OEF A;  4KPX A;  3FOQ A;  4CVH A;  1OQM B;  2ZU8 A;  3USQ A;  4EEO A;  4Y64 A;  5CQN X;  4B5B A;  1FRW A;  3OC9 A;  3OKR A;  4FRL A;  4IRP A;  5IFY A;  2WVK A;  2Z86 A;  2VSH A;  2AM5 A;  1H7L A;  4HO4 A;  4CJ8 A;  4FIY A;  3T7N A;  3U2U A;  3Q4S A;  3I0F A;  5C1L A;  3ZGF A;  2X5S A;  3Q80 A;  3DK5 A;  1YP2 A;  3SX5 A;  1G9R A;  4B3U A;  1H4E A;  1VZT A;  2RJ4 A;  2YQJ A;  1H5R A;  1JYK A;  3SXG A;  4Y6N A;  4CJC A;  1H7E A;  1TZF A;  1VPA A;  4DDZ A;  1G23 A;  5C4E A;  1H5R B;  5C4D A;  2AEC A;  1WT2 A;  4LW3 A;  1ZCT A;  5JQQ A;  4M2A A;  5AJP A;  5CMH A;  3IOI A;  4M2B A;  2XWL A;  4KPZ A;  3FWW A;  4IRQ A;  5C3A A;  4MIX A;  3NGW A;  5C4F A;  1NMM B;  2QH5 A;  4B4B A;  5C47 A;  1VH3 A;  3I0D A;  1FXJ A;  3I0L A;  1S4P A;  2WGZ A;  3D8V A;  2GGO A;  2AGD A;  2AE7 A;  3SPT A;  2FYB A;  4Y6U A;  3V0P A;  2CU2 A;  1G2V A;  2V0K A;  4ECM A;  2VSI A;  4HO3 A;  3I0C A;  1H7H A;  2V0H A;  1VGU A;  3ZLL A;  1ZCV A;  1WT1 A;  4HO8 A;  3CGX A;  1GWW A;  2C0N A;  2V0J A;  3I0K A;  3I0I X;  2AM3 A;  4D0Z A;  4KC4 A;  1ZJ2 A;  5C1G A;  2VS4 A;  1E5K A;  3PKP A;  3R2W A;  1FGX A;  1ZJO A;  1H5S A;  1ZI1 A;  4ASY A;  3OAM A;  1I52 A;  2XWM A;  2OEG A;  3KIA A;  4G3S A;  1O7Q A;  2PX7 A;  1ON6 A;  1QG8 A;  3V0Q A;  5HS2 A;  1H5S B;  1G95 A;  1O7O A;  3SXA A;  1MP4 A;  2XME A;  4FQW A;  1FO9 A;  2A8U A;  1ZJ1 A;  2VXL A;  3V0N A;  3GUE A;  2RIX A;  1G8O A;  1VZU A;  2AES A;  2RJ5 A;  1O23 B;  1YP4 A;  2XMH A;  5D92 A;  2VXM A;  3O3P A;  2I5K A;  2BO6 A;  4KC2 A;  1LZ0 A;  4G3Q A;  3I0H A;  4O6M A;  2J0A A;  3RMW A;  2P72 A;  3OH1 A;  3U2W A;  5CQM X;  4B4M A;  3T7O A;  5D91 A;  3USR A;  3RSB A;  1VM8 A;  2WVL A;  4HG6 A;  4AAW A;  2QKX A;  5FTS A;  3PKQ A;  1FR8 A;  3V0O A;  1EZI A;  4JD0 A;  5C3D A;  1W55 A;  1GQ9 A;  1ZDF A;  1ZDG A;  2Y6P A;  1JVD A;  3E26 A;  1V82 A;  1NWG B;  2AM4 A;  3OH0 A;  1ZJP A;  4EEG A;  4B42 A;  2OI6 A;  4EE5 A;  4HO0 A;  5EIY A;  2YCM A;  2YQH A;  1O0R A;  2VS5 A;  1WVC A;  2O1F A;  3PNN A;  3ZLK A;  4B2X A;  2E3D A;  2RJ1 A;  2O1G A;  1EYR A;  5CMF X;  3V0L A;  5FUH A;  3V91 A;  2BO8 A;  2Z87 A;  3SXB A;  5C4B A;  1VGT A;  3F1C A;  4Y7F A;  1FGG A;  3U0X A;  1G93 A;  2FYA A;  5CQO A;  3RMV A;  4NAN A;  2WAW A;  2PGY A;  4FRQ A;  3V0M A;  1XHB A;  1H5T B;  1NQI B;  4Y62 A;  4ASJ A;  4HO6 A;  1R7T A;  5AJO A;  5FV9 A;  1WT0 A;  3CKJ A;  5L6S A;  2W0V A;  4K6R A;  4P02 A;  1FWY A;  4Q7C A;  5BXC A;  2VS3 A;  2AH9 A;  4BMA A;  2BO7 A;  5CMI A;  4MND A;  1ZJ3 A;  1MC3 A;  4J18 A;  4EEM A;  2QGI A;  2O1H A;  2ICY A;  2FY7 A;  2X5Z A;  4AYL A;  4KQL A;  1JVG A;  2P73 A;  2Y7A A;  1Z90 A;  1H3M A;  3U2T A;  2Y4J A;  1KWS A;  2VFZ A;  4FRE A;  1R80 A;  5FU0 A;  4HO9 A;  4HCQ A;  5CMG X;  1QGS A;  5C8R A;  3ST8 A;  2YC3 A;  3OH4 A;  2E8B A;  3V8Z A;  2P6W A;  1V83 A;  2RIT A;  2RJ8 A;  5L6V A;  2UX8 A;  2ZU9 A;  3K8D A;  3SXD A;  3IOJ A;  1HM9 A;  1H7G A;  1HJL A;  4ARW A;  4FRO A;  3SX8 A;  1LZI A;  1INI A;  4Y9X A;  2JCJ A;  4NAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...