1H5TB

Thymidylyltransferase complexed with thymidylyldiphosphate-glucose
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
290
structure length
290
Chain Sequence
KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVALMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKQTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucose-1-phosphate thymidylyltransferase 1
publication title Kinetic and Crystallographic Analyses Support a Sequential-Ordered Bi Bi Catalytic Mechanism for Escherichia Coli Glucose-1-Phosphate Thymidylyltransferase
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 290
sequence length 290
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h5tB00
1GX0A 5IDTA 2WVMA 2YC5A 1ZI3A 4NAIA 3CKNA 1FO8A 1G95A 1H5SA 2X65A 4Y7TA 4FRQA 5J49A 1W55A 2O1HA 1QG8A 2OEFA 1FGXA 5C38A 4JD0A 3BRKX 4KC2A 3IOHA 1G2VA 5C4CA 1NF5B 3I0JA 3CKJA 1ZDGA 2RJ7A 4CVHA 5DDVA 3GUEA 1R7YA 2ZU9A 1NQIB 1H5SC 3SXCA 1JYKA 2Q4JA 5EJ1A 3R3IA 2AH9A 2OEGA 3OAMA 4DECA 3OH3A 4K6RA 3T7NA 5EIYA 2XWLA 1ZJ2A 1H7HA 1TW1A 1ZCTA 4IRPA 1G97A 3SX3A 2W0WA 2Y6PA 2GGOA 3V0MA 4YS8A 4CJCA 2O1FA 1HM8A 1JYLA 3LW6A 1QWJA 2YQCA 1INJA 3TQDA 1G9RA 4CJBA 3ZF8A 2DPWA 1ZIZA 2W0VA 3SXDA 5AJPA 3PKQA 3DJ4A 3SXAA 2AESA 3U2VA 1H5TA 4Y62A 5C4DA 4EEMA 1H7TA 4FQWA 1VPAA 1ZJ0A 2YESA 1VICA 1O23B 1H4EA 1HM9A 1W77A 2D0JA 4KXOA 3PKPA 5C48A 5FTVA 2JCLA 4P02A 1G3LA 1R81A 4G3SA 1O7QA 1YP2A 4HCQA 1VZUA 4Y7VA 1GX4A 2PGYA 5CMFX 2FYCB 1SS9A 5AJNA 3U2WA 1LZ0A 4JISA 4EE4A 2D7IA 3SX8A 1ZDFA 3RSBA 5C3BA 1KWSA 1FXJA 1V83A 2P6WA 3I0FA 2QGIA 1NMMB 3BCVA 4AAWA 5FU8A 3V8ZA 2YQHA 4J18A 2WAWA 3D5NA 3I0LA 1PZTA 3ZLLA 1OMZA 1VH3A 2V0LA 3V0LA 5AJOA 3I0IX 1LVWA 4M28A 1ZCUA 4HO0A 4M4KA 1HJJA 4HO3A 2I7BA 2VFZA 2RJ8A 2WGZA 3D8VA 1MP4A 4ARWA 5L6SA 2YCMA 1LZJA 3DUVA 3I0KA 3ZLKA 1H5SB 4MYBA 5FUHA 5FYEA 5JQQA 1XHBA 2X60A 2I5EA 1FO9A 2AM4A 1VGZA 1WVCA 4B4GA 2YQSA 1R7UA 1FG5N 4Y7FA 1LL2A 4DE7A 1ZCVA 1ZCYA 4XWIA 2YC3A 3I0CA 2ZU8A 4E1KA 5CQLX 1LZIA 4B2WA 1ZHJA 2Y4KA 4FRMA 5CQMX 1H4DA 4G3PA 3OC9A 4EE3A 1FWYA 1VGTA 4KNRA 4AYLA 2JCJA 3SXBA 1FZWA 2MZBA 4D48A 4BMAA 4ASJA 1YROB 3U0YA 5C4EA 4KPZA 1Z90A 5CQNX 3U2TA 2RIYA 1E5KA 4HO2A 4L41C 5C3DA 4FRAA 4NAKA 1FOAA 1H5RB 3IOJA 5I1FA 4DDZA 4KNXA 3T7MA 4Y7GA 4Y64A 1EYRA 2BO4A 5L6VA 2Y7AA 2P72A 4HOCA 4KQLA 4KC4A 2E8BA 2GGQA 2VS4A 1QGSA 3FOQA 5CMHA 2WE9A 5CMGX 4EEOA 1ZJOA 2BO8A 1WT0A 1ZJ3A 1W57A 1ZI5A 3I0EA 4B3UA 3CGXA 3CKQA 1JV1A 1ZJ1A 3V8YA 3ZGGA 2WVKA 3POLA 1OQMB 1EZIA 3CKVA 4P00A 2VSIA 2FFVA 1I52A 1V82A 4LW3A 1R7VA 2OI5A 1MP3A 2RITA 5C1GA 2X5SA 5C1HA 2V0KA 4FROA 1ON6A 4HO5A 3DK5A 4EVWA 1INIA 1VZXA 3V0NA 1FR9A 2Y4JA 4FRBA 3I0GA 3U2XA 3SPTA 2Z87A 2VS3A 1VGWA 4FRLA 3D98A 2RIZA 1GQCA 5C4FA 3JUJA 2AGDA 4GBPA 1H3MA 4EEAA 4BQHA 4FRPA 1JV3A 3OGZA 2E3DA 1TVYA 2RJ1A 4KC1A 1LZ7A 2FYBA 1FXOA 2Y4MA 4D11A 4FRHA 4R7PA 2NXVA 4IRQA 2YQJA 2D7RA 4HO4A 1H4CA 2FFUA 2BO7A 5FU0A 2FY7A 1R7TA 5DDTA 2PX7A 2PGVA 2BO6A 3O3PA 2XWNA 3OH1A 1FGGA 2XWMA 4Y63A 4G87A 1WT2A 4D11C 2AM3A 4AC3A 1VGUA 3TZTA 4B4BA 4KT7A 2AE7A 1IINA 4ASYA 1JVDA 2FYDB 3F1YA 3Q4SA 3SXGA 1QGQA 1PZYB 3USRA 3F1CA 2CU2A 4NANA 1MC3A 3K8EA 2ICXA 5C36A 2P73A 2JCOA 3FWWA 4Y7UA 1NWGB 3E25A 2ZU7A 2APCA 2RJ0A 1XZ6A 1S4PA 2WVLA 3ZGFA 1TW5A 2XMHA 5C1LA 1WSZA 1NKHB 1G93A 2PA4A 1H7GA 3SXEA 1FRWA 2V0JA 1YP3A 5IFYA 4ECMA 1R7XA 3Q80A 4LW6A 5CQPA 5C47A 3V90A 4AYJA 4KPXA 4HG6A 1IIMA 1YP4A 3V0OA 1O7OA 3Q7UA 3V91A 2X5ZA 5EJZA 3V0QA 1V84A 2UX8A 1FR8A 1H7LA 3QVBA 2QH5A 2RIXA 5IDSA 1LL0A 2Y4LA 5CMJA 4B42A 1R80A 4KRVA 3V0PA 2A8WA 3OKRA 1S4NA 4EE5A 1GA8A 5BXCA 1WT1A 5C49A 1H5TB 1ZI4A 1JVGA 2VXLA 1VM8A 1H5RA 4FRDA 2AM5A 5HS2A 2A8UA 4D0ZA 3RMVA 2VXMA 1G8OA 1ON8A 1K4VA 1VZTA 3R2WA 4B4MA 4Y9XA 3E26A 3NGWA 1R82A 1WT3A 1TZFA 2OI7A 1S4OA 3OH0A 2XMEA 3ST8A 2O1GA 5FV9A 5C4BA 3K8DA 1OMXA 2V0IA 1NHEB 3SX5A 3JUKA 3N9WA 3I0HA 3KIAA 4FREA 4C2SA 2V0HA 1G23A 3IOIA 5FTSA 2FYAA 4G3QA 2WEEA 2AECA 4Y6NA 4HO6A 2ICYA 2Z86A 1LL3A 3HL3A 4ZDQA 5CQOA 3I0DA 3RMWA 1GWVA 1VH1A 3CU0A 3CKOA 4M2AA 2I5KA 1GQ9A 3OH4A 2QKXA 2OI6A 2VD4A 2VSHA 1ZJPA 4HO8A 1HM0A 1H5SD 1MP5A 3U2UA 4EEGA 2RJ6A 5C3AA 4FCEA 2RJ9A 3USQA 3EE5A 4Y6UA 1ZI1A 5C8RA 1HJLA 1GWWA 1O0RA 1H7EA 1H7FA 2JCKA 1G0RA 3OH2A 1G1LA 2VS5A 5CMIA 4B5BA 4B2XA 4HO9A 4D0TA 2RJ4A 4MNDA 1HV9A 3PNNA 3SX7A 4M2BA 2RJ5A 3U0XA 4UEGA 1H7QA 3T7OA 3JTJA 4CJ8A 4FCUA 4NALA
chains in the Genus database with same CATH superfamily
1GX0A 5IDTA 2WVMA 2YC5A 1ZI3A 4NAIA 3CKNA 1FO8A 1G95A 1H5SA 2X65A 4Y7TA 4FRQA 5J49A 1W55A 2O1HA 1QG8A 2OEFA 1FGXA 5C38A 4JD0A 3BRKX 4KC2A 3IOHA 1G2VA 5C4CA 1NF5B 3I0JA 3CKJA 1ZDGA 2RJ7A 4CVHA 5DDVA 3GUEA 1R7YA 2ZU9A 1NQIB 1H5SC 3SXCA 1JYKA 2Q4JA 5EJ1A 3R3IA 2AH9A 2OEGA 3OAMA 4DECA 3OH3A 4K6RA 3T7NA 5EIYA 2XWLA 1ZJ2A 1H7HA 1TW1A 1ZCTA 4IRPA 1G97A 3SX3A 2W0WA 2Y6PA 2GGOA 3V0MA 4YS8A 4Q7CA 4CJCA 2O1FA 1HM8A 1JYLA 3LW6A 1QWJA 2YQCA 1INJA 3TQDA 1G9RA 4CJBA 3ZF8A 2DPWA 1ZIZA 2W0VA 3SXDA 5AJPA 3PKQA 4O6MA 3DJ4A 3SXAA 2AESA 3U2VA 1H5TA 4Y62A 5C4DA 4EEMA 1H7TA 4FQWA 1VPAA 1ZJ0A 2YESA 1VICA 1O23B 1H4EA 1HM9A 1W77A 2D0JA 4KXOA 3PKPA 5C48A 5FTVA 2JCLA 4P02A 1G3LA 1R81A 4G3SA 1O7QA 1YP2A 4HCQA 1VZUA 4Y7VA 1GX4A 2PGYA 5CMFX 2FYCB 1SS9A 5AJNA 3U2WA 1LZ0A 4JISA 4EE4A 2D7IA 3SX8A 1ZDFA 3RSBA 5C3BA 1KWSA 1FXJA 1V83A 2P6WA 3I0FA 2QGIA 1NMMB 3BCVA 4AAWA 5FU8A 3V8ZA 2YQHA 4J18A 2WAWA 3D5NA 3I0LA 1PZTA 3ZLLA 1OMZA 1VH3A 2V0LA 3V0LA 5AJOA 3I0IX 1LVWA 4M28A 1ZCUA 4HO0A 4M4KA 1HJJA 4HO3A 2I7BA 2VFZA 2RJ8A 2WGZA 3D8VA 1MP4A 4ARWA 5L6SA 2YCMA 1LZJA 3DUVA 3I0KA 3ZLKA 1H5SB 4MYBA 5FUHA 5FYEA 5JQQA 1XHBA 2X60A 2I5EA 1FO9A 2AM4A 1VGZA 1WVCA 4B4GA 2YQSA 1R7UA 1FG5N 4Y7FA 1LL2A 4DE7A 1ZCVA 1ZCYA 4XWIA 2YC3A 4FIXA 3I0CA 2ZU8A 4E1KA 5CQLX 1LZIA 4B2WA 1ZHJA 2Y4KA 4FRMA 5CQMX 1H4DA 4G3PA 3OC9A 4EE3A 1FWYA 1VGTA 4KNRA 4AYLA 2JCJA 3SXBA 1FZWA 2MZBA 4D48A 4BMAA 4ASJA 1YROB 3U0YA 5C4EA 4KPZA 1Z90A 5CQNX 3U2TA 2RIYA 1E5KA 4HO2A 4L41C 5C3DA 4FRAA 4NAKA 1FOAA 1H5RB 3IOJA 5I1FA 4DDZA 5D91A 4KNXA 3T7MA 4Y7GA 4Y64A 1EYRA 2BO4A 5L6VA 2Y7AA 2P72A 4HOCA 4KQLA 4KC4A 2E8BA 2GGQA 2VS4A 1QGSA 3FOQA 5CMHA 2WE9A 5CMGX 4EEOA 1ZJOA 2BO8A 1WT0A 1ZJ3A 1W57A 1ZI5A 3I0EA 4B3UA 3CGXA 3CKQA 1JV1A 1ZJ1A 3V8YA 3ZGGA 2WVKA 3POLA 1OQMB 1EZIA 3CKVA 4P00A 2VSIA 2FFVA 1I52A 1V82A 4LW3A 1R7VA 2OI5A 1MP3A 2RITA 5C1GA 2X5SA 5C1HA 2V0KA 4FROA 1ON6A 4HO5A 4MIXA 3DK5A 4EVWA 1INIA 1VZXA 3V0NA 1FR9A 2Y4JA 4FRBA 3I0GA 3U2XA 3SPTA 2Z87A 2VS3A 1VGWA 4FRLA 3D98A 2RIZA 1GQCA 5C4FA 3JUJA 2AGDA 4GBPA 1H3MA 4EEAA 4BQHA 4FRPA 1JV3A 3OGZA 2E3DA 1TVYA 2RJ1A 4KC1A 1LZ7A 2FYBA 1FXOA 2Y4MA 4D11A 4FRHA 4R7PA 2NXVA 4IRQA 2YQJA 2D7RA 4HO4A 1H4CA 2FFUA 2BO7A 5FU0A 2FY7A 1R7TA 5DDTA 2PX7A 2PGVA 2BO6A 3O3PA 2XWNA 3OH1A 1FGGA 2XWMA 4Y63A 4G87A 1WT2A 4D11C 2AM3A 4AC3A 1VGUA 3TZTA 4B4BA 4KT7A 2AE7A 1IINA 4ASYA 1JVDA 2FYDB 3F1YA 3Q4SA 3SXGA 1QGQA 4FIYA 1PZYB 3USRA 3F1CA 2CU2A 4NANA 1MC3A 3K8EA 2ICXA 5C36A 2P73A 2JCOA 3FWWA 4Y7UA 1NWGB 3E25A 2ZU7A 2APCA 2RJ0A 1XZ6A 1S4PA 2WVLA 3ZGFA 1TW5A 2XMHA 5C1LA 1WSZA 1NKHB 1G93A 2PA4A 1H7GA 3SXEA 2J0BA 1FRWA 2V0JA 1YP3A 5IFYA 4ECMA 1R7XA 3Q80A 4LW6A 5CQPA 5C47A 3V90A 4AYJA 4KPXA 4HG6A 1IIMA 1YP4A 3V0OA 1O7OA 3Q7UA 3V91A 2X5ZA 5EJZA 3V0QA 1V84A 2UX8A 1FR8A 1H7LA 3QVBA 2QH5A 2RIXA 5IDSA 1LL0A 2Y4LA 5CMJA 4B42A 1R80A 4KRVA 3V0PA 2A8WA 3OKRA 1S4NA 4EE5A 1GA8A 5BXCA 1WT1A 5C49A 1H5TB 1ZI4A 1JVGA 2VXLA 1VM8A 2VK9A 1H5RA 4FRDA 2AM5A 5HS2A 2A8UA 4O6NA 4D0ZA 3RMVA 2VXMA 1G8OA 1ON8A 1K4VA 1VZTA 3R2WA 5D92A 4B4MA 4Y9XA 3E26A 3NGWA 1R82A 1WT3A 1TZFA 2OI7A 1S4OA 3OH0A 2XMEA 3ST8A 2O1GA 5FV9A 2J0AA 5C4BA 3K8DA 1OMXA 2V0IA 1NHEB 3SX5A 3JUKA 3N9WA 3I0HA 3KIAA 4FREA 4C2SA 2V0HA 1G23A 3IOIA 5FTSA 2FYAA 4G3QA 2WEEA 2AECA 4Y6NA 4HO6A 2ICYA 2Z86A 1LL3A 3HL3A 4ZDQA 5CQOA 3I0DA 3RMWA 1GWVA 1VH1A 3CU0A 3CKOA 4M2AA 2I5KA 1GQ9A 3OH4A 2QKXA 2OI6A 2VD4A 2VSHA 1ZJPA 4HO8A 1HM0A 1H5SD 1MP5A 3U2UA 4EEGA 2RJ6A 5C3AA 4FCEA 2RJ9A 3USQA 3EE5A 4Y6UA 1ZI1A 5C8RA 1HJLA 1GWWA 1O0RA 1H7EA 1H7FA 2JCKA 1G0RA 3OH2A 1G1LA 2VS5A 5CMIA 4B5BA 4B2XA 4HO9A 2C0NA 4D0TA 2RJ4A 4MNDA 1HV9A 3PNNA 3SX7A 4M2BA 2RJ5A 3U0XA 4UEGA 1H7QA 3T7OA 3JTJA 4CJ8A 4FCUA 4NALA
chains in the Genus database with same CATH topology
1GX0A 5IDTA 2WVMA 2YC5A 1ZI3A 4NAIA 3CKNA 1FO8A 1G95A 1H5SA 2X65A 4Y7TA 4FRQA 5J49A 1W55A 2O1HA 1QG8A 2OEFA 1FGXA 5C38A 4JD0A 3BRKX 4KC2A 3IOHA 1G2VA 5C4CA 1NF5B 3I0JA 3CKJA 1ZDGA 2RJ7A 4CVHA 5DDVA 3GUEA 1R7YA 2ZU9A 1NQIB 1H5SC 3SXCA 1JYKA 2Q4JA 5EJ1A 3R3IA 2AH9A 2OEGA 3OAMA 4DECA 3OH3A 4K6RA 3T7NA 5EIYA 2XWLA 1ZJ2A 1H7HA 1TW1A 1ZCTA 4IRPA 1G97A 3SX3A 2W0WA 2Y6PA 2GGOA 3V0MA 4YS8A 4Q7CA 4CJCA 2O1FA 1HM8A 1JYLA 3LW6A 1QWJA 2YQCA 1INJA 3TQDA 1G9RA 4CJBA 3ZF8A 2DPWA 1ZIZA 2W0VA 3SXDA 5AJPA 3PKQA 4O6MA 3DJ4A 3SXAA 2AESA 3U2VA 1H5TA 4Y62A 5C4DA 4EEMA 1H7TA 4FQWA 1VPAA 1ZJ0A 2YESA 1VICA 1O23B 1H4EA 1HM9A 1W77A 2D0JA 4KXOA 3PKPA 5C48A 5FTVA 2JCLA 4P02A 1G3LA 1R81A 4G3SA 1O7QA 1YP2A 4HCQA 1VZUA 4Y7VA 1GX4A 2PGYA 5CMFX 2FYCB 1SS9A 5AJNA 3U2WA 1LZ0A 4JISA 4EE4A 2D7IA 3SX8A 1ZDFA 3RSBA 5C3BA 1KWSA 1FXJA 1V83A 2P6WA 3I0FA 2QGIA 1NMMB 3BCVA 4AAWA 5FU8A 3V8ZA 2YQHA 4J18A 2WAWA 3D5NA 3I0LA 1PZTA 3ZLLA 1OMZA 1VH3A 2V0LA 3V0LA 5AJOA 3I0IX 1LVWA 4M28A 1ZCUA 4HO0A 4M4KA 1HJJA 4HO3A 2I7BA 2VFZA 2RJ8A 2WGZA 3D8VA 1MP4A 4ARWA 5L6SA 2YCMA 1LZJA 3DUVA 3I0KA 3ZLKA 1H5SB 4MYBA 5FUHA 5FYEA 5JQQA 1XHBA 2X60A 2I5EA 1FO9A 2AM4A 1VGZA 1WVCA 4B4GA 2YQSA 1R7UA 1FG5N 4Y7FA 1LL2A 4DE7A 1ZCVA 1ZCYA 4XWIA 2YC3A 4FIXA 3I0CA 2ZU8A 4E1KA 5CQLX 1LZIA 4B2WA 1ZHJA 2Y4KA 4FRMA 5CQMX 1H4DA 4G3PA 3OC9A 4EE3A 1FWYA 1VGTA 4KNRA 4AYLA 2JCJA 3SXBA 1FZWA 2MZBA 4D48A 4BMAA 4ASJA 1YROB 3U0YA 5C4EA 4KPZA 1Z90A 5CQNX 3U2TA 2RIYA 1E5KA 4HO2A 4L41C 5C3DA 4FRAA 4NAKA 1FOAA 1H5RB 3IOJA 5I1FA 4DDZA 5D91A 4KNXA 3T7MA 4Y7GA 4Y64A 1EYRA 2BO4A 5L6VA 2Y7AA 2P72A 4HOCA 4KQLA 4KC4A 2E8BA 2GGQA 2VS4A 1QGSA 3FOQA 5CMHA 2WE9A 5CMGX 4EEOA 1ZJOA 2BO8A 1WT0A 1ZJ3A 1W57A 1ZI5A 3I0EA 4B3UA 3CGXA 3CKQA 1JV1A 1ZJ1A 3V8YA 3ZGGA 2WVKA 3POLA 1OQMB 1EZIA 3CKVA 4P00A 2VSIA 2FFVA 1I52A 1V82A 4LW3A 1R7VA 2OI5A 1MP3A 2RITA 5C1GA 2X5SA 5C1HA 2V0KA 4FROA 1ON6A 4HO5A 4MIXA 3DK5A 4EVWA 1INIA 1VZXA 3V0NA 1FR9A 2Y4JA 4FRBA 3I0GA 3U2XA 3SPTA 2Z87A 2VS3A 1VGWA 4FRLA 3D98A 2RIZA 1GQCA 5C4FA 3JUJA 2AGDA 4GBPA 1H3MA 4EEAA 4BQHA 4FRPA 1JV3A 3OGZA 2E3DA 1TVYA 2RJ1A 4KC1A 1LZ7A 2FYBA 1FXOA 2Y4MA 4D11A 4FRHA 4R7PA 2NXVA 4IRQA 2YQJA 2D7RA 4HO4A 1H4CA 2FFUA 2BO7A 5FU0A 2FY7A 1R7TA 5DDTA 2PX7A 2PGVA 2BO6A 3O3PA 2XWNA 3OH1A 1FGGA 2XWMA 4Y63A 4G87A 1WT2A 4D11C 2AM3A 4AC3A 1VGUA 3TZTA 4B4BA 4KT7A 2AE7A 1IINA 4ASYA 1JVDA 2FYDB 3F1YA 3Q4SA 3SXGA 1QGQA 4FIYA 1PZYB 3USRA 3F1CA 2CU2A 4NANA 1MC3A 3K8EA 2ICXA 5C36A 2P73A 2JCOA 3FWWA 4Y7UA 1NWGB 3E25A 2ZU7A 2APCA 2RJ0A 1XZ6A 1S4PA 2WVLA 3ZGFA 1TW5A 2XMHA 5C1LA 1WSZA 1NKHB 1G93A 2PA4A 1H7GA 3SXEA 2J0BA 1FRWA 2V0JA 1YP3A 5IFYA 4ECMA 1R7XA 3Q80A 4LW6A 5CQPA 5C47A 3V90A 4AYJA 4KPXA 4HG6A 1IIMA 1YP4A 3V0OA 1O7OA 3Q7UA 3V91A 2X5ZA 5EJZA 3V0QA 1V84A 2UX8A 1FR8A 1H7LA 3QVBA 2QH5A 2RIXA 5IDSA 1LL0A 2Y4LA 5CMJA 4B42A 1R80A 4KRVA 3V0PA 2A8WA 3OKRA 1S4NA 4EE5A 1GA8A 5BXCA 1WT1A 5C49A 1H5TB 1ZI4A 1JVGA 2VXLA 1VM8A 2VK9A 1H5RA 4FRDA 2AM5A 5HS2A 2A8UA 4O6NA 4D0ZA 3RMVA 2VXMA 1G8OA 1ON8A 1K4VA 1VZTA 3R2WA 5D92A 4B4MA 4Y9XA 3E26A 3NGWA 1R82A 1WT3A 1TZFA 2OI7A 1S4OA 3OH0A 2XMEA 3ST8A 2O1GA 5FV9A 2J0AA 5C4BA 3K8DA 1OMXA 2V0IA 1NHEB 3SX5A 3JUKA 3N9WA 3I0HA 3KIAA 4FREA 4C2SA 2V0HA 1G23A 3IOIA 5FTSA 2FYAA 4G3QA 2WEEA 2AECA 4Y6NA 4HO6A 2ICYA 2Z86A 1LL3A 3HL3A 4ZDQA 5CQOA 3I0DA 3RMWA 1GWVA 1VH1A 3CU0A 3CKOA 4M2AA 2I5KA 1GQ9A 3OH4A 2QKXA 2OI6A 2VD4A 2VSHA 1ZJPA 4HO8A 1HM0A 1H5SD 1MP5A 3U2UA 4EEGA 2RJ6A 5C3AA 4FCEA 2RJ9A 3USQA 3EE5A 4Y6UA 1ZI1A 5C8RA 1HJLA 1GWWA 1O0RA 1H7EA 1H7FA 2JCKA 1G0RA 3OH2A 1G1LA 2VS5A 5CMIA 4B5BA 4B2XA 4HO9A 2C0NA 4D0TA 2RJ4A 4MNDA 1HV9A 3PNNA 3SX7A 4M2BA 2RJ5A 3U0XA 4UEGA 1H7QA 3T7OA 3JTJA 4CJ8A 4FCUA 4NALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX0 A;  5IDT A;  2WVM A;  2YC5 A;  1ZI3 A;  4NAI A;  3CKN A;  1FO8 A;  1G95 A;  1H5S A;  2X65 A;  4Y7T A;  4FRQ A;  5J49 A;  1W55 A;  2O1H A;  1QG8 A;  2OEF A;  1FGX A;  5C38 A;  4JD0 A;  3BRK X;  4KC2 A;  3IOH A;  1G2V A;  5C4C A;  1NF5 B;  3I0J A;  3CKJ A;  1ZDG A;  2RJ7 A;  4CVH A;  5DDV A;  3GUE A;  1R7Y A;  2ZU9 A;  1NQI B;  1H5S C;  3SXC A;  1JYK A;  2Q4J A;  5EJ1 A;  3R3I A;  2AH9 A;  2OEG A;  3OAM A;  4DEC A;  3OH3 A;  4K6R A;  3T7N A;  5EIY A;  2XWL A;  1ZJ2 A;  1H7H A;  1TW1 A;  1ZCT A;  4IRP A;  1G97 A;  3SX3 A;  2W0W A;  2Y6P A;  2GGO A;  3V0M A;  4YS8 A;  4CJC A;  2O1F A;  1HM8 A;  1JYL A;  3LW6 A;  1QWJ A;  2YQC A;  1INJ A;  3TQD A;  1G9R A;  4CJB A;  3ZF8 A;  2DPW A;  1ZIZ A;  2W0V A;  3SXD A;  5AJP A;  3PKQ A;  3DJ4 A;  3SXA A;  2AES A;  3U2V A;  1H5T A;  4Y62 A;  5C4D A;  4EEM A;  1H7T A;  4FQW A;  1VPA A;  1ZJ0 A;  2YES A;  1VIC A;  1O23 B;  1H4E A;  1HM9 A;  1W77 A;  2D0J A;  4KXO A;  3PKP A;  5C48 A;  5FTV A;  2JCL A;  4P02 A;  1G3L A;  1R81 A;  4G3S A;  1O7Q A;  1YP2 A;  4HCQ A;  1VZU A;  4Y7V A;  1GX4 A;  2PGY A;  5CMF X;  2FYC B;  1SS9 A;  5AJN A;  3U2W A;  1LZ0 A;  4JIS A;  4EE4 A;  2D7I A;  3SX8 A;  1ZDF A;  3RSB A;  5C3B A;  1KWS A;  1FXJ A;  1V83 A;  2P6W A;  3I0F A;  2QGI A;  1NMM B;  3BCV A;  4AAW A;  5FU8 A;  3V8Z A;  2YQH A;  4J18 A;  2WAW A;  3D5N A;  3I0L A;  1PZT A;  3ZLL A;  1OMZ A;  1VH3 A;  2V0L A;  3V0L A;  5AJO A;  3I0I X;  1LVW A;  4M28 A;  1ZCU A;  4HO0 A;  4M4K A;  1HJJ A;  4HO3 A;  2I7B A;  2VFZ A;  2RJ8 A;  2WGZ A;  3D8V A;  1MP4 A;  4ARW A;  5L6S A;  2YCM A;  1LZJ A;  3DUV A;  3I0K A;  3ZLK A;  1H5S B;  4MYB A;  5FUH A;  5FYE A;  5JQQ A;  1XHB A;  2X60 A;  2I5E A;  1FO9 A;  2AM4 A;  1VGZ A;  1WVC A;  4B4G A;  2YQS A;  1R7U A;  1FG5 N;  4Y7F A;  1LL2 A;  4DE7 A;  1ZCV A;  1ZCY A;  4XWI A;  2YC3 A;  3I0C A;  2ZU8 A;  4E1K A;  5CQL X;  1LZI A;  4B2W A;  1ZHJ A;  2Y4K A;  4FRM A;  5CQM X;  1H4D A;  4G3P A;  3OC9 A;  4EE3 A;  1FWY A;  1VGT A;  4KNR A;  4AYL A;  2JCJ A;  3SXB A;  1FZW A;  2MZB A;  4D48 A;  4BMA A;  4ASJ A;  1YRO B;  3U0Y A;  5C4E A;  4KPZ A;  1Z90 A;  5CQN X;  3U2T A;  2RIY A;  1E5K A;  4HO2 A;  4L41 C;  5C3D A;  4FRA A;  4NAK A;  1FOA A;  1H5R B;  3IOJ A;  5I1F A;  4DDZ A;  4KNX A;  3T7M A;  4Y7G A;  4Y64 A;  1EYR A;  2BO4 A;  5L6V A;  2Y7A A;  2P72 A;  4HOC A;  4KQL A;  4KC4 A;  2E8B A;  2GGQ A;  2VS4 A;  1QGS A;  3FOQ A;  5CMH A;  2WE9 A;  5CMG X;  4EEO A;  1ZJO A;  2BO8 A;  1WT0 A;  1ZJ3 A;  1W57 A;  1ZI5 A;  3I0E A;  4B3U A;  3CGX A;  3CKQ A;  1JV1 A;  1ZJ1 A;  3V8Y A;  3ZGG A;  2WVK A;  3POL A;  1OQM B;  1EZI A;  3CKV A;  4P00 A;  2VSI A;  2FFV A;  1I52 A;  1V82 A;  4LW3 A;  1R7V A;  2OI5 A;  1MP3 A;  2RIT A;  5C1G A;  2X5S A;  5C1H A;  2V0K A;  4FRO A;  1ON6 A;  4HO5 A;  3DK5 A;  4EVW A;  1INI A;  1VZX A;  3V0N A;  1FR9 A;  2Y4J A;  4FRB A;  3I0G A;  3U2X A;  3SPT A;  2Z87 A;  2VS3 A;  1VGW A;  4FRL A;  3D98 A;  2RIZ A;  1GQC A;  5C4F A;  3JUJ A;  2AGD A;  4GBP A;  1H3M A;  4EEA A;  4BQH A;  4FRP A;  1JV3 A;  3OGZ A;  2E3D A;  1TVY A;  2RJ1 A;  4KC1 A;  1LZ7 A;  2FYB A;  1FXO A;  2Y4M A;  4D11 A;  4FRH A;  4R7P A;  2NXV A;  4IRQ A;  2YQJ A;  2D7R A;  4HO4 A;  1H4C A;  2FFU A;  2BO7 A;  5FU0 A;  2FY7 A;  1R7T A;  5DDT A;  2PX7 A;  2PGV A;  2BO6 A;  3O3P A;  2XWN A;  3OH1 A;  1FGG A;  2XWM A;  4Y63 A;  4G87 A;  1WT2 A;  4D11 C;  2AM3 A;  4AC3 A;  1VGU A;  3TZT A;  4B4B A;  4KT7 A;  2AE7 A;  1IIN A;  4ASY A;  1JVD A;  2FYD B;  3F1Y A;  3Q4S A;  3SXG A;  1QGQ A;  1PZY B;  3USR A;  3F1C A;  2CU2 A;  4NAN A;  1MC3 A;  3K8E A;  2ICX A;  5C36 A;  2P73 A;  2JCO A;  3FWW A;  4Y7U A;  1NWG B;  3E25 A;  2ZU7 A;  2APC A;  2RJ0 A;  1XZ6 A;  1S4P A;  2WVL A;  3ZGF A;  1TW5 A;  2XMH A;  5C1L A;  1WSZ A;  1NKH B;  1G93 A;  2PA4 A;  1H7G A;  3SXE A;  1FRW A;  2V0J A;  1YP3 A;  5IFY A;  4ECM A;  1R7X A;  3Q80 A;  4LW6 A;  5CQP A;  5C47 A;  3V90 A;  4AYJ A;  4KPX A;  4HG6 A;  1IIM A;  1YP4 A;  3V0O A;  1O7O A;  3Q7U A;  3V91 A;  2X5Z A;  5EJZ A;  3V0Q A;  1V84 A;  2UX8 A;  1FR8 A;  1H7L A;  3QVB A;  2QH5 A;  2RIX A;  5IDS A;  1LL0 A;  2Y4L A;  5CMJ A;  4B42 A;  1R80 A;  4KRV A;  3V0P A;  2A8W A;  3OKR A;  1S4N A;  4EE5 A;  1GA8 A;  5BXC A;  1WT1 A;  5C49 A;  1H5T B;  1ZI4 A;  1JVG A;  2VXL A;  1VM8 A;  1H5R A;  4FRD A;  2AM5 A;  5HS2 A;  2A8U A;  4D0Z A;  3RMV A;  2VXM A;  1G8O A;  1ON8 A;  1K4V A;  1VZT A;  3R2W A;  4B4M A;  4Y9X A;  3E26 A;  3NGW A;  1R82 A;  1WT3 A;  1TZF A;  2OI7 A;  1S4O A;  3OH0 A;  2XME A;  3ST8 A;  2O1G A;  5FV9 A;  5C4B A;  3K8D A;  1OMX A;  2V0I A;  1NHE B;  3SX5 A;  3JUK A;  3N9W A;  3I0H A;  3KIA A;  4FRE A;  4C2S A;  2V0H A;  1G23 A;  3IOI A;  5FTS A;  2FYA A;  4G3Q A;  2WEE A;  2AEC A;  4Y6N A;  4HO6 A;  2ICY A;  2Z86 A;  1LL3 A;  3HL3 A;  4ZDQ A;  5CQO A;  3I0D A;  3RMW A;  1GWV A;  1VH1 A;  3CU0 A;  3CKO A;  4M2A A;  2I5K A;  1GQ9 A;  3OH4 A;  2QKX A;  2OI6 A;  2VD4 A;  2VSH A;  1ZJP A;  4HO8 A;  1HM0 A;  1H5S D;  1MP5 A;  3U2U A;  4EEG A;  2RJ6 A;  5C3A A;  4FCE A;  2RJ9 A;  3USQ A;  3EE5 A;  4Y6U A;  1ZI1 A;  5C8R A;  1HJL A;  1GWW A;  1O0R A;  1H7E A;  1H7F A;  2JCK A;  1G0R A;  3OH2 A;  1G1L A;  2VS5 A;  5CMI A;  4B5B A;  4B2X A;  4HO9 A;  4D0T A;  2RJ4 A;  4MND A;  1HV9 A;  3PNN A;  3SX7 A;  4M2B A;  2RJ5 A;  3U0X A;  4UEG A;  1H7Q A;  3T7O A;  3JTJ A;  4CJ8 A;  4FCU A;  4NAL A; 
#chains in the Genus database with same CATH topology
 1GX0 A;  5IDT A;  2WVM A;  2YC5 A;  1ZI3 A;  4NAI A;  3CKN A;  1FO8 A;  1G95 A;  1H5S A;  2X65 A;  4Y7T A;  4FRQ A;  5J49 A;  1W55 A;  2O1H A;  1QG8 A;  2OEF A;  1FGX A;  5C38 A;  4JD0 A;  3BRK X;  4KC2 A;  3IOH A;  1G2V A;  5C4C A;  1NF5 B;  3I0J A;  3CKJ A;  1ZDG A;  2RJ7 A;  4CVH A;  5DDV A;  3GUE A;  1R7Y A;  2ZU9 A;  1NQI B;  1H5S C;  3SXC A;  1JYK A;  2Q4J A;  5EJ1 A;  3R3I A;  2AH9 A;  2OEG A;  3OAM A;  4DEC A;  3OH3 A;  4K6R A;  3T7N A;  5EIY A;  2XWL A;  1ZJ2 A;  1H7H A;  1TW1 A;  1ZCT A;  4IRP A;  1G97 A;  3SX3 A;  2W0W A;  2Y6P A;  2GGO A;  3V0M A;  4YS8 A;  4Q7C A;  4CJC A;  2O1F A;  1HM8 A;  1JYL A;  3LW6 A;  1QWJ A;  2YQC A;  1INJ A;  3TQD A;  1G9R A;  4CJB A;  3ZF8 A;  2DPW A;  1ZIZ A;  2W0V A;  3SXD A;  5AJP A;  3PKQ A;  4O6M A;  3DJ4 A;  3SXA A;  2AES A;  3U2V A;  1H5T A;  4Y62 A;  5C4D A;  4EEM A;  1H7T A;  4FQW A;  1VPA A;  1ZJ0 A;  2YES A;  1VIC A;  1O23 B;  1H4E A;  1HM9 A;  1W77 A;  2D0J A;  4KXO A;  3PKP A;  5C48 A;  5FTV A;  2JCL A;  4P02 A;  1G3L A;  1R81 A;  4G3S A;  1O7Q A;  1YP2 A;  4HCQ A;  1VZU A;  4Y7V A;  1GX4 A;  2PGY A;  5CMF X;  2FYC B;  1SS9 A;  5AJN A;  3U2W A;  1LZ0 A;  4JIS A;  4EE4 A;  2D7I A;  3SX8 A;  1ZDF A;  3RSB A;  5C3B A;  1KWS A;  1FXJ A;  1V83 A;  2P6W A;  3I0F A;  2QGI A;  1NMM B;  3BCV A;  4AAW A;  5FU8 A;  3V8Z A;  2YQH A;  4J18 A;  2WAW A;  3D5N A;  3I0L A;  1PZT A;  3ZLL A;  1OMZ A;  1VH3 A;  2V0L A;  3V0L A;  5AJO A;  3I0I X;  1LVW A;  4M28 A;  1ZCU A;  4HO0 A;  4M4K A;  1HJJ A;  4HO3 A;  2I7B A;  2VFZ A;  2RJ8 A;  2WGZ A;  3D8V A;  1MP4 A;  4ARW A;  5L6S A;  2YCM A;  1LZJ A;  3DUV A;  3I0K A;  3ZLK A;  1H5S B;  4MYB A;  5FUH A;  5FYE A;  5JQQ A;  1XHB A;  2X60 A;  2I5E A;  1FO9 A;  2AM4 A;  1VGZ A;  1WVC A;  4B4G A;  2YQS A;  1R7U A;  1FG5 N;  4Y7F A;  1LL2 A;  4DE7 A;  1ZCV A;  1ZCY A;  4XWI A;  2YC3 A;  4FIX A;  3I0C A;  2ZU8 A;  4E1K A;  5CQL X;  1LZI A;  4B2W A;  1ZHJ A;  2Y4K A;  4FRM A;  5CQM X;  1H4D A;  4G3P A;  3OC9 A;  4EE3 A;  1FWY A;  1VGT A;  4KNR A;  4AYL A;  2JCJ A;  3SXB A;  1FZW A;  2MZB A;  4D48 A;  4BMA A;  4ASJ A;  1YRO B;  3U0Y A;  5C4E A;  4KPZ A;  1Z90 A;  5CQN X;  3U2T A;  2RIY A;  1E5K A;  4HO2 A;  4L41 C;  5C3D A;  4FRA A;  4NAK A;  1FOA A;  1H5R B;  3IOJ A;  5I1F A;  4DDZ A;  5D91 A;  4KNX A;  3T7M A;  4Y7G A;  4Y64 A;  1EYR A;  2BO4 A;  5L6V A;  2Y7A A;  2P72 A;  4HOC A;  4KQL A;  4KC4 A;  2E8B A;  2GGQ A;  2VS4 A;  1QGS A;  3FOQ A;  5CMH A;  2WE9 A;  5CMG X;  4EEO A;  1ZJO A;  2BO8 A;  1WT0 A;  1ZJ3 A;  1W57 A;  1ZI5 A;  3I0E A;  4B3U A;  3CGX A;  3CKQ A;  1JV1 A;  1ZJ1 A;  3V8Y A;  3ZGG A;  2WVK A;  3POL A;  1OQM B;  1EZI A;  3CKV A;  4P00 A;  2VSI A;  2FFV A;  1I52 A;  1V82 A;  4LW3 A;  1R7V A;  2OI5 A;  1MP3 A;  2RIT A;  5C1G A;  2X5S A;  5C1H A;  2V0K A;  4FRO A;  1ON6 A;  4HO5 A;  4MIX A;  3DK5 A;  4EVW A;  1INI A;  1VZX A;  3V0N A;  1FR9 A;  2Y4J A;  4FRB A;  3I0G A;  3U2X A;  3SPT A;  2Z87 A;  2VS3 A;  1VGW A;  4FRL A;  3D98 A;  2RIZ A;  1GQC A;  5C4F A;  3JUJ A;  2AGD A;  4GBP A;  1H3M A;  4EEA A;  4BQH A;  4FRP A;  1JV3 A;  3OGZ A;  2E3D A;  1TVY A;  2RJ1 A;  4KC1 A;  1LZ7 A;  2FYB A;  1FXO A;  2Y4M A;  4D11 A;  4FRH A;  4R7P A;  2NXV A;  4IRQ A;  2YQJ A;  2D7R A;  4HO4 A;  1H4C A;  2FFU A;  2BO7 A;  5FU0 A;  2FY7 A;  1R7T A;  5DDT A;  2PX7 A;  2PGV A;  2BO6 A;  3O3P A;  2XWN A;  3OH1 A;  1FGG A;  2XWM A;  4Y63 A;  4G87 A;  1WT2 A;  4D11 C;  2AM3 A;  4AC3 A;  1VGU A;  3TZT A;  4B4B A;  4KT7 A;  2AE7 A;  1IIN A;  4ASY A;  1JVD A;  2FYD B;  3F1Y A;  3Q4S A;  3SXG A;  1QGQ A;  4FIY A;  1PZY B;  3USR A;  3F1C A;  2CU2 A;  4NAN A;  1MC3 A;  3K8E A;  2ICX A;  5C36 A;  2P73 A;  2JCO A;  3FWW A;  4Y7U A;  1NWG B;  3E25 A;  2ZU7 A;  2APC A;  2RJ0 A;  1XZ6 A;  1S4P A;  2WVL A;  3ZGF A;  1TW5 A;  2XMH A;  5C1L A;  1WSZ A;  1NKH B;  1G93 A;  2PA4 A;  1H7G A;  3SXE A;  2J0B A;  1FRW A;  2V0J A;  1YP3 A;  5IFY A;  4ECM A;  1R7X A;  3Q80 A;  4LW6 A;  5CQP A;  5C47 A;  3V90 A;  4AYJ A;  4KPX A;  4HG6 A;  1IIM A;  1YP4 A;  3V0O A;  1O7O A;  3Q7U A;  3V91 A;  2X5Z A;  5EJZ A;  3V0Q A;  1V84 A;  2UX8 A;  1FR8 A;  1H7L A;  3QVB A;  2QH5 A;  2RIX A;  5IDS A;  1LL0 A;  2Y4L A;  5CMJ A;  4B42 A;  1R80 A;  4KRV A;  3V0P A;  2A8W A;  3OKR A;  1S4N A;  4EE5 A;  1GA8 A;  5BXC A;  1WT1 A;  5C49 A;  1H5T B;  1ZI4 A;  1JVG A;  2VXL A;  1VM8 A;  2VK9 A;  1H5R A;  4FRD A;  2AM5 A;  5HS2 A;  2A8U A;  4O6N A;  4D0Z A;  3RMV A;  2VXM A;  1G8O A;  1ON8 A;  1K4V A;  1VZT A;  3R2W A;  5D92 A;  4B4M A;  4Y9X A;  3E26 A;  3NGW A;  1R82 A;  1WT3 A;  1TZF A;  2OI7 A;  1S4O A;  3OH0 A;  2XME A;  3ST8 A;  2O1G A;  5FV9 A;  2J0A A;  5C4B A;  3K8D A;  1OMX A;  2V0I A;  1NHE B;  3SX5 A;  3JUK A;  3N9W A;  3I0H A;  3KIA A;  4FRE A;  4C2S A;  2V0H A;  1G23 A;  3IOI A;  5FTS A;  2FYA A;  4G3Q A;  2WEE A;  2AEC A;  4Y6N A;  4HO6 A;  2ICY A;  2Z86 A;  1LL3 A;  3HL3 A;  4ZDQ A;  5CQO A;  3I0D A;  3RMW A;  1GWV A;  1VH1 A;  3CU0 A;  3CKO A;  4M2A A;  2I5K A;  1GQ9 A;  3OH4 A;  2QKX A;  2OI6 A;  2VD4 A;  2VSH A;  1ZJP A;  4HO8 A;  1HM0 A;  1H5S D;  1MP5 A;  3U2U A;  4EEG A;  2RJ6 A;  5C3A A;  4FCE A;  2RJ9 A;  3USQ A;  3EE5 A;  4Y6U A;  1ZI1 A;  5C8R A;  1HJL A;  1GWW A;  1O0R A;  1H7E A;  1H7F A;  2JCK A;  1G0R A;  3OH2 A;  1G1L A;  2VS5 A;  5CMI A;  4B5B A;  4B2X A;  4HO9 A;  2C0N A;  4D0T A;  2RJ4 A;  4MND A;  1HV9 A;  3PNN A;  3SX7 A;  4M2B A;  2RJ5 A;  3U0X A;  4UEG A;  1H7Q A;  3T7O A;  3JTJ A;  4CJ8 A;  4FCU A;  4NAL A; 
#chains in the Genus database with same CATH homology
 1GX0 A;  5IDT A;  2WVM A;  2YC5 A;  1ZI3 A;  4NAI A;  3CKN A;  1FO8 A;  1G95 A;  1H5S A;  2X65 A;  4Y7T A;  4FRQ A;  5J49 A;  1W55 A;  2O1H A;  1QG8 A;  2OEF A;  1FGX A;  5C38 A;  4JD0 A;  3BRK X;  4KC2 A;  3IOH A;  1G2V A;  5C4C A;  1NF5 B;  3I0J A;  3CKJ A;  1ZDG A;  2RJ7 A;  4CVH A;  5DDV A;  3GUE A;  1R7Y A;  2ZU9 A;  1NQI B;  1H5S C;  3SXC A;  1JYK A;  2Q4J A;  5EJ1 A;  3R3I A;  2AH9 A;  2OEG A;  3OAM A;  4DEC A;  3OH3 A;  4K6R A;  3T7N A;  5EIY A;  2XWL A;  1ZJ2 A;  1H7H A;  1TW1 A;  1ZCT A;  4IRP A;  1G97 A;  3SX3 A;  2W0W A;  2Y6P A;  2GGO A;  3V0M A;  4YS8 A;  4Q7C A;  4CJC A;  2O1F A;  1HM8 A;  1JYL A;  3LW6 A;  1QWJ A;  2YQC A;  1INJ A;  3TQD A;  1G9R A;  4CJB A;  3ZF8 A;  2DPW A;  1ZIZ A;  2W0V A;  3SXD A;  5AJP A;  3PKQ A;  4O6M A;  3DJ4 A;  3SXA A;  2AES A;  3U2V A;  1H5T A;  4Y62 A;  5C4D A;  4EEM A;  1H7T A;  4FQW A;  1VPA A;  1ZJ0 A;  2YES A;  1VIC A;  1O23 B;  1H4E A;  1HM9 A;  1W77 A;  2D0J A;  4KXO A;  3PKP A;  5C48 A;  5FTV A;  2JCL A;  4P02 A;  1G3L A;  1R81 A;  4G3S A;  1O7Q A;  1YP2 A;  4HCQ A;  1VZU A;  4Y7V A;  1GX4 A;  2PGY A;  5CMF X;  2FYC B;  1SS9 A;  5AJN A;  3U2W A;  1LZ0 A;  4JIS A;  4EE4 A;  2D7I A;  3SX8 A;  1ZDF A;  3RSB A;  5C3B A;  1KWS A;  1FXJ A;  1V83 A;  2P6W A;  3I0F A;  2QGI A;  1NMM B;  3BCV A;  4AAW A;  5FU8 A;  3V8Z A;  2YQH A;  4J18 A;  2WAW A;  3D5N A;  3I0L A;  1PZT A;  3ZLL A;  1OMZ A;  1VH3 A;  2V0L A;  3V0L A;  5AJO A;  3I0I X;  1LVW A;  4M28 A;  1ZCU A;  4HO0 A;  4M4K A;  1HJJ A;  4HO3 A;  2I7B A;  2VFZ A;  2RJ8 A;  2WGZ A;  3D8V A;  1MP4 A;  4ARW A;  5L6S A;  2YCM A;  1LZJ A;  3DUV A;  3I0K A;  3ZLK A;  1H5S B;  4MYB A;  5FUH A;  5FYE A;  5JQQ A;  1XHB A;  2X60 A;  2I5E A;  1FO9 A;  2AM4 A;  1VGZ A;  1WVC A;  4B4G A;  2YQS A;  1R7U A;  1FG5 N;  4Y7F A;  1LL2 A;  4DE7 A;  1ZCV A;  1ZCY A;  4XWI A;  2YC3 A;  4FIX A;  3I0C A;  2ZU8 A;  4E1K A;  5CQL X;  1LZI A;  4B2W A;  1ZHJ A;  2Y4K A;  4FRM A;  5CQM X;  1H4D A;  4G3P A;  3OC9 A;  4EE3 A;  1FWY A;  1VGT A;  4KNR A;  4AYL A;  2JCJ A;  3SXB A;  1FZW A;  2MZB A;  4D48 A;  4BMA A;  4ASJ A;  1YRO B;  3U0Y A;  5C4E A;  4KPZ A;  1Z90 A;  5CQN X;  3U2T A;  2RIY A;  1E5K A;  4HO2 A;  4L41 C;  5C3D A;  4FRA A;  4NAK A;  1FOA A;  1H5R B;  3IOJ A;  5I1F A;  4DDZ A;  5D91 A;  4KNX A;  3T7M A;  4Y7G A;  4Y64 A;  1EYR A;  2BO4 A;  5L6V A;  2Y7A A;  2P72 A;  4HOC A;  4KQL A;  4KC4 A;  2E8B A;  2GGQ A;  2VS4 A;  1QGS A;  3FOQ A;  5CMH A;  2WE9 A;  5CMG X;  4EEO A;  1ZJO A;  2BO8 A;  1WT0 A;  1ZJ3 A;  1W57 A;  1ZI5 A;  3I0E A;  4B3U A;  3CGX A;  3CKQ A;  1JV1 A;  1ZJ1 A;  3V8Y A;  3ZGG A;  2WVK A;  3POL A;  1OQM B;  1EZI A;  3CKV A;  4P00 A;  2VSI A;  2FFV A;  1I52 A;  1V82 A;  4LW3 A;  1R7V A;  2OI5 A;  1MP3 A;  2RIT A;  5C1G A;  2X5S A;  5C1H A;  2V0K A;  4FRO A;  1ON6 A;  4HO5 A;  4MIX A;  3DK5 A;  4EVW A;  1INI A;  1VZX A;  3V0N A;  1FR9 A;  2Y4J A;  4FRB A;  3I0G A;  3U2X A;  3SPT A;  2Z87 A;  2VS3 A;  1VGW A;  4FRL A;  3D98 A;  2RIZ A;  1GQC A;  5C4F A;  3JUJ A;  2AGD A;  4GBP A;  1H3M A;  4EEA A;  4BQH A;  4FRP A;  1JV3 A;  3OGZ A;  2E3D A;  1TVY A;  2RJ1 A;  4KC1 A;  1LZ7 A;  2FYB A;  1FXO A;  2Y4M A;  4D11 A;  4FRH A;  4R7P A;  2NXV A;  4IRQ A;  2YQJ A;  2D7R A;  4HO4 A;  1H4C A;  2FFU A;  2BO7 A;  5FU0 A;  2FY7 A;  1R7T A;  5DDT A;  2PX7 A;  2PGV A;  2BO6 A;  3O3P A;  2XWN A;  3OH1 A;  1FGG A;  2XWM A;  4Y63 A;  4G87 A;  1WT2 A;  4D11 C;  2AM3 A;  4AC3 A;  1VGU A;  3TZT A;  4B4B A;  4KT7 A;  2AE7 A;  1IIN A;  4ASY A;  1JVD A;  2FYD B;  3F1Y A;  3Q4S A;  3SXG A;  1QGQ A;  4FIY A;  1PZY B;  3USR A;  3F1C A;  2CU2 A;  4NAN A;  1MC3 A;  3K8E A;  2ICX A;  5C36 A;  2P73 A;  2JCO A;  3FWW A;  4Y7U A;  1NWG B;  3E25 A;  2ZU7 A;  2APC A;  2RJ0 A;  1XZ6 A;  1S4P A;  2WVL A;  3ZGF A;  1TW5 A;  2XMH A;  5C1L A;  1WSZ A;  1NKH B;  1G93 A;  2PA4 A;  1H7G A;  3SXE A;  2J0B A;  1FRW A;  2V0J A;  1YP3 A;  5IFY A;  4ECM A;  1R7X A;  3Q80 A;  4LW6 A;  5CQP A;  5C47 A;  3V90 A;  4AYJ A;  4KPX A;  4HG6 A;  1IIM A;  1YP4 A;  3V0O A;  1O7O A;  3Q7U A;  3V91 A;  2X5Z A;  5EJZ A;  3V0Q A;  1V84 A;  2UX8 A;  1FR8 A;  1H7L A;  3QVB A;  2QH5 A;  2RIX A;  5IDS A;  1LL0 A;  2Y4L A;  5CMJ A;  4B42 A;  1R80 A;  4KRV A;  3V0P A;  2A8W A;  3OKR A;  1S4N A;  4EE5 A;  1GA8 A;  5BXC A;  1WT1 A;  5C49 A;  1H5T B;  1ZI4 A;  1JVG A;  2VXL A;  1VM8 A;  2VK9 A;  1H5R A;  4FRD A;  2AM5 A;  5HS2 A;  2A8U A;  4O6N A;  4D0Z A;  3RMV A;  2VXM A;  1G8O A;  1ON8 A;  1K4V A;  1VZT A;  3R2W A;  5D92 A;  4B4M A;  4Y9X A;  3E26 A;  3NGW A;  1R82 A;  1WT3 A;  1TZF A;  2OI7 A;  1S4O A;  3OH0 A;  2XME A;  3ST8 A;  2O1G A;  5FV9 A;  2J0A A;  5C4B A;  3K8D A;  1OMX A;  2V0I A;  1NHE B;  3SX5 A;  3JUK A;  3N9W A;  3I0H A;  3KIA A;  4FRE A;  4C2S A;  2V0H A;  1G23 A;  3IOI A;  5FTS A;  2FYA A;  4G3Q A;  2WEE A;  2AEC A;  4Y6N A;  4HO6 A;  2ICY A;  2Z86 A;  1LL3 A;  3HL3 A;  4ZDQ A;  5CQO A;  3I0D A;  3RMW A;  1GWV A;  1VH1 A;  3CU0 A;  3CKO A;  4M2A A;  2I5K A;  1GQ9 A;  3OH4 A;  2QKX A;  2OI6 A;  2VD4 A;  2VSH A;  1ZJP A;  4HO8 A;  1HM0 A;  1H5S D;  1MP5 A;  3U2U A;  4EEG A;  2RJ6 A;  5C3A A;  4FCE A;  2RJ9 A;  3USQ A;  3EE5 A;  4Y6U A;  1ZI1 A;  5C8R A;  1HJL A;  1GWW A;  1O0R A;  1H7E A;  1H7F A;  2JCK A;  1G0R A;  3OH2 A;  1G1L A;  2VS5 A;  5CMI A;  4B5B A;  4B2X A;  4HO9 A;  2C0N A;  4D0T A;  2RJ4 A;  4MND A;  1HV9 A;  3PNN A;  3SX7 A;  4M2B A;  2RJ5 A;  3U0X A;  4UEG A;  1H7Q A;  3T7O A;  3JTJ A;  4CJ8 A;  4FCU A;  4NAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...