2E3DA

Crystal structure of e. coli glucose-1-phosphate uridylyltransferase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
294
structure length
286
Chain Sequence
NTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTSFELEAMLERQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGVVDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPEIQLTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
publication title The molecular architecture of glucose-1-phosphate uridylyltransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 286
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2e3dA00
2X5ZA 3JUJA 1FR8A 1FGXA 3Q80A 5C47A 1NQIB 1OQMB 1H5RB 1LL0A 4FRBA 1NKHB 4FRDA 5C3DA 4KNXA 1G93A 3FOQA 2FYDB 4Y6NA 4Y7VA 1LL2A 4Y64A 2ICXA 4R7PA 3CKVA 2RIXA 1JV3A 2D0JA 4DE7A 2WE9A 4G3QA 4B4MA 5FYEA 3V0NA 4C2SA 5FU8A 4DDZA 4FQWA 2A8UA 3Q7UA 1ZI5A 2P73A 3O3PA 3V91A 2NXVA 1WT2A 5EIYA 1FRWA 1R80A 3POLA 2YQCA 3K8EA 1H7HA 2PA4A 1IINA 4MYBA 5IDTA 2YC3A 1HV9A 1PZTA 3I0DA 3OKRA 5IFYA 1MP3A 5AJOA 3U2VA 3T7NA 3TQDA 3U2UA 1G2VA 3V90A 4CJCA 1VICA 3PNNA 1ZJOA 4Y7UA 4HO2A 1R7YA 3RMWA 1VGUA 4HO4A 4FROA 2Y4LA 3IOHA 5C38A 1H5SC 4M28A 3V0LA 1G97A 1KWSA 2AH9A 2OI5A 2YQJA 2X5SA 5JQQA 2QGIA 1W55A 4EEOA 4B2WA 2WVKA 2O1FA 3I0KA 1H5SA 1E5KA 2XMHA 2XWNA 2PGYA 2WVLA 1TW5A 4FRQA 3KIAA 1ZI4A 3D5NA 5EJ1A 1H5TB 3EE5A 3I0FA 4EEMA 5I1FA 1V84A 3RMVA 1H7EA 1LZ0A 4KC1A 1LL3A 1HM9A 1OMXA 4B4BA 2AESA 2V0KA 3Q4SA 4D11C 5C49A 3U0YA 1W57A 5CQOA 2E3DA 1ZHJA 1VGZA 3I0CA 1WT3A 4FCEA 4D11A 3OH0A 2V0LA 2BO8A 2ZU8A 1ZCYA 4EE4A 1EYRA 3V8YA 5C1GA 5EJZA 4ECMA 3JTJA 1WVCA 3LW6A 1H5RA 4FRPA 1K4VA 2I7BA 1EZIA 4NALA 1FXOA 2AECA 4MNDA 2AM3A 2RIYA 1HJLA 2Y7AA 4JD0A 1FG5N 4KQLA 1H4EA 2VS5A 2YQSA 1QGQA 2GGQA 2ZU7A 4B5BA 1TW1A 2X60A 4HOCA 1QG8A 1MP4A 2OI7A 5IDSA 4HO0A 3V0MA 3K8DA 3CGXA 5L6SA 2FYBA 1JVGA 1O0RA 4CJ8A 4M2AA 1LZJA 4FCUA 1VH3A 3V0OA 1R82A 3HL3A 2O1GA 3T7MA 1SS9A 4KPZA 2AM5A 4CJBA 1FO8A 2Y4JA 5C8RA 3OC9A 1OMZA 1JYLA 3USRA 2X65A 4G87A 1G23A 5CQLX 2D7RA 1GQCA 1R7VA 4EEAA 3QVBA 4BQHA 4IRPA 5C3BA 4LW6A 1I52A 1TZFA 3U2TA 1ZI1A 1LVWA 2W0VA 5C1HA 4Y9XA 5FV9A 2WEEA 1S4PA 2FFVA 3ZF8A 1YP2A 1W77A 1VGTA 3R3IA 3IOJA 3V8ZA 4M2BA 5C4BA 2RJ1A 3U2XA 1MC3A 1FOAA 1G0RA 2JCOA 1ON6A 2BO6A 4KNRA 1ZJ0A 3CU0A 4G3SA 4M4KA 2RJ9A 3OH3A 2BO4A 1GWWA 1TVYA 5C4DA 1YP4A 2V0JA 2OEFA 1ZJPA 2I5EA 3DJ4A 3PKPA 4ARWA 2O1HA 3ZGGA 4Y7TA 1WSZA 3I0HA 3SPTA 4EVWA 2Y4KA 4HO9A 1YP3A 2WAWA 4EE3A 5CQMX 3ST8A 3E26A 1VGWA 2RJ4A 1NWGB 1Z90A 4EEGA 1GX0A 5DDTA 1GWVA 1QGSA 3SXEA 3U0XA 4KXOA 3R2WA 4Y6UA 5FTVA 3I0EA 4HO3A 3T7OA 3FWWA 1S4NA 4HO8A 4YS8A 1XHBA 5C4EA 5CMHA 2ICYA 4HCQA 4HG6A 1R7XA 2FFUA 1R7UA 2BO7A 4ASYA 5CQNX 2I5KA 5FUHA 1H4CA 3DUVA 4UEGA 3N9WA 2OI6A 2RITA 3CKNA 4NAKA 4Y63A 2PX7A 1ZCVA 4FREA 3SXAA 2ZU9A 4ZDQA 1LZ7A 2D7IA 5C1LA 2Z86A 2RJ8A 2VXMA 1GA8A 4B42A 4J18A 4Y7FA 1H5SD 3DK5A 1H7GA 5CQPA 4Y7GA 1FZWA 1H7TA 3I0LA 2QKXA 5DDVA 4D0TA 3SXGA 3TZTA 2AM4A 2RJ7A 5CMGX 2VFZA 2P6WA 1LZIA 2RJ6A 2UX8A 2YC5A 4LW3A 1JVDA 1O7QA 2VD4A 3CKOA 4KPXA 5C36A 5J49A 1G95A 3I0JA 1HJJA 3E25A 5C48A 3I0GA 4K6RA 1G3LA 1ZCTA 3D8VA 1ZI3A 3SX3A 3BCVA 1PZYB 1JYKA 3U2WA 3RSBA 1FR9A 4BMAA 4KRVA 1XZ6A 3I0IX 5C3AA 4B4GA 3OH1A 4FRAA 4AC3A 1ZJ2A 3V0PA 2WVMA 4HO5A 4KC2A 4Y62A 1FO9A 4HO6A 1ZCUA 2OEGA 3ZGFA 5FU0A 2VSIA 4CVHA 1O7OA 5AJPA 1H7LA 2XMEA 5CMJA 1ZJ1A 2JCLA 3V0QA 2YESA 1ZDGA 2CU2A 3SX8A 1H4DA 4FRHA 4L41C 4NANA 3SX5A 3CKQA 1H5TA 1GX4A 2JCJA 2AGDA 3D98A 1HM8A 1QWJA 4P02A 3OH2A 4IRQA 4DECA 4D48A 2AE7A 2V0IA 2FYCB 3USQA 5BXCA 2YCMA 5AJNA 3SXCA 4AAWA 2RJ5A 1S4OA 3OH4A 2E8BA 4KT7A 4NAIA 1VZTA 2VS4A 1NHEB 3GUEA 2RJ0A 1H3MA 5C4CA 2XWMA 2QH5A 2A8WA 3OAMA 1FXJA 1NMMB 2W0WA 3SXBA 2VS3A 1ON8A 1R7TA 1G1LA 2YQHA 2PGVA 2VSHA 2JCKA 5HS2A 3ZLKA 1FWYA 2XWLA 1VZXA 3OGZA 5L6VA 1VM8A 2Y6PA 3SXDA 1R81A 1V82A 4D0ZA 1YROB 4GBPA 1IIMA 2MZBA 4JISA 2FY7A 1ZIZA 1V83A 2V0HA 5CMFX 2FYAA 5CMIA 5C4FA 2RIZA 4AYLA 4AYJA 4FRMA 1INIA 1MP5A 4KC4A 4FRLA 3ZLLA 1H5SB 3PKQA 4E1KA 2Z87A 1H7QA 4G3PA 2Y4MA 3JUKA 2GGOA 3CKJA 2WGZA 1WT1A 1FGGA 1G9RA 1O23B 3IOIA 3SX7A 1GQ9A 1VPAA 1VH1A 4B2XA 1HM0A 4ASJA 2VXLA 1H7FA 1ZDFA 4EE5A 4B3UA 4P00A 1NF5B 1WT0A 1VZUA 2P72A 3BRKX 5FTSA 3F1CA 3F1YA 1JV1A 3NGWA 2Q4JA 1ZJ3A 2DPWA 4XWIA 1G8OA 1INJA 2APCA
chains in the Genus database with same CATH superfamily
2X5ZA 3JUJA 1FR8A 1FGXA 3Q80A 5C47A 1NQIB 1OQMB 1H5RB 4Q7CA 1LL0A 4FRBA 1NKHB 4FRDA 5C3DA 4KNXA 1G93A 3FOQA 2FYDB 4Y6NA 4Y7VA 1LL2A 4Y64A 2ICXA 4R7PA 3CKVA 2RIXA 1JV3A 2D0JA 4DE7A 2WE9A 4G3QA 4B4MA 5FYEA 3V0NA 4C2SA 5FU8A 4DDZA 4FQWA 2A8UA 3Q7UA 1ZI5A 2P73A 3O3PA 3V91A 2NXVA 1WT2A 5EIYA 4O6MA 1FRWA 1R80A 3POLA 2YQCA 3K8EA 1H7HA 2PA4A 2J0AA 1IINA 4MYBA 5IDTA 2YC3A 1HV9A 1PZTA 3I0DA 3OKRA 5IFYA 1MP3A 5AJOA 3U2VA 3T7NA 3TQDA 3U2UA 1G2VA 3V90A 4CJCA 1VICA 3PNNA 1ZJOA 4Y7UA 4HO2A 1R7YA 3RMWA 1VGUA 4HO4A 4FROA 2Y4LA 3IOHA 5C38A 1H5SC 4M28A 3V0LA 1G97A 1KWSA 2AH9A 2OI5A 2YQJA 2X5SA 5JQQA 2QGIA 1W55A 4EEOA 2C0NA 4B2WA 2WVKA 2O1FA 3I0KA 1H5SA 1E5KA 2XMHA 2XWNA 2PGYA 2WVLA 1TW5A 4FIYA 4FRQA 3KIAA 1ZI4A 3D5NA 5EJ1A 1H5TB 3EE5A 3I0FA 4EEMA 5I1FA 1V84A 3RMVA 1H7EA 1LZ0A 4KC1A 1LL3A 1HM9A 1OMXA 4B4BA 2AESA 2V0KA 3Q4SA 4D11C 2VK9A 5C49A 3U0YA 1W57A 5CQOA 2E3DA 1ZHJA 1VGZA 3I0CA 1WT3A 4FCEA 4D11A 3OH0A 2V0LA 2BO8A 2ZU8A 1ZCYA 4EE4A 1EYRA 3V8YA 5C1GA 5EJZA 4ECMA 3JTJA 1WVCA 2J0BA 3LW6A 1H5RA 4FRPA 1K4VA 2I7BA 1EZIA 4NALA 1FXOA 2AECA 4MNDA 2AM3A 2RIYA 1HJLA 2Y7AA 4JD0A 1FG5N 4KQLA 1H4EA 2VS5A 2YQSA 1QGQA 2GGQA 2ZU7A 4B5BA 1TW1A 2X60A 4HOCA 1QG8A 1MP4A 2OI7A 5IDSA 4HO0A 3V0MA 3K8DA 3CGXA 5L6SA 2FYBA 1JVGA 1O0RA 4CJ8A 4M2AA 1LZJA 4FCUA 1VH3A 3V0OA 1R82A 3HL3A 2O1GA 3T7MA 1SS9A 4KPZA 2AM5A 4CJBA 1FO8A 2Y4JA 5C8RA 3OC9A 1OMZA 1JYLA 3USRA 2X65A 4G87A 1G23A 5CQLX 2D7RA 1GQCA 1R7VA 4EEAA 3QVBA 4BQHA 4IRPA 5C3BA 4LW6A 1I52A 1TZFA 3U2TA 1ZI1A 1LVWA 2W0VA 5C1HA 4Y9XA 5FV9A 2WEEA 1S4PA 2FFVA 3ZF8A 1YP2A 1W77A 1VGTA 3R3IA 3IOJA 3V8ZA 4M2BA 5C4BA 2RJ1A 3U2XA 1MC3A 1FOAA 1G0RA 2JCOA 1ON6A 2BO6A 4KNRA 1ZJ0A 3CU0A 4G3SA 4M4KA 2RJ9A 3OH3A 2BO4A 1GWWA 1TVYA 5C4DA 1YP4A 2V0JA 2OEFA 1ZJPA 2I5EA 3DJ4A 3PKPA 4ARWA 2O1HA 3ZGGA 4Y7TA 1WSZA 3I0HA 3SPTA 4EVWA 2Y4KA 4HO9A 1YP3A 2WAWA 4EE3A 5CQMX 3ST8A 3E26A 1VGWA 2RJ4A 1NWGB 1Z90A 4EEGA 1GX0A 5DDTA 1GWVA 1QGSA 3SXEA 3U0XA 4KXOA 3R2WA 4Y6UA 5FTVA 3I0EA 4HO3A 3T7OA 3FWWA 1S4NA 4HO8A 4YS8A 1XHBA 5D92A 5C4EA 5CMHA 2ICYA 4HCQA 4HG6A 1R7XA 2FFUA 1R7UA 2BO7A 4ASYA 5CQNX 2I5KA 5FUHA 1H4CA 3DUVA 4UEGA 3N9WA 2OI6A 2RITA 3CKNA 4NAKA 4Y63A 2PX7A 1ZCVA 4FREA 3SXAA 2ZU9A 4ZDQA 1LZ7A 2D7IA 5C1LA 2Z86A 2RJ8A 2VXMA 1GA8A 4B42A 4J18A 4Y7FA 5D91A 1H5SD 3DK5A 1H7GA 5CQPA 4Y7GA 1FZWA 1H7TA 3I0LA 2QKXA 5DDVA 4D0TA 3SXGA 3TZTA 2AM4A 2RJ7A 5CMGX 2VFZA 2P6WA 1LZIA 2RJ6A 2UX8A 2YC5A 4LW3A 1JVDA 1O7QA 2VD4A 3CKOA 4KPXA 5C36A 5J49A 1G95A 3I0JA 1HJJA 3E25A 5C48A 3I0GA 4K6RA 1G3LA 1ZCTA 3D8VA 1ZI3A 3SX3A 3BCVA 4FIXA 1PZYB 1JYKA 3U2WA 3RSBA 1FR9A 4BMAA 4KRVA 1XZ6A 3I0IX 5C3AA 4B4GA 3OH1A 4FRAA 4AC3A 4O6NA 1ZJ2A 3V0PA 2WVMA 4HO5A 4KC2A 4Y62A 1FO9A 4HO6A 1ZCUA 2OEGA 3ZGFA 5FU0A 2VSIA 4CVHA 1O7OA 5AJPA 1H7LA 2XMEA 5CMJA 1ZJ1A 2JCLA 3V0QA 2YESA 1ZDGA 2CU2A 3SX8A 1H4DA 4FRHA 4L41C 4NANA 3SX5A 3CKQA 1H5TA 1GX4A 2JCJA 2AGDA 3D98A 1HM8A 1QWJA 4P02A 3OH2A 4IRQA 4DECA 4D48A 2AE7A 2V0IA 2FYCB 3USQA 5BXCA 2YCMA 5AJNA 3SXCA 4AAWA 2RJ5A 1S4OA 3OH4A 2E8BA 4KT7A 4NAIA 1VZTA 2VS4A 1NHEB 3GUEA 2RJ0A 1H3MA 5C4CA 2XWMA 2QH5A 2A8WA 3OAMA 1FXJA 1NMMB 2W0WA 3SXBA 2VS3A 1ON8A 1R7TA 1G1LA 2YQHA 2PGVA 2VSHA 2JCKA 5HS2A 3ZLKA 1FWYA 2XWLA 1VZXA 3OGZA 5L6VA 1VM8A 2Y6PA 3SXDA 1R81A 1V82A 4D0ZA 1YROB 4GBPA 1IIMA 2MZBA 4JISA 2FY7A 1ZIZA 1V83A 2V0HA 5CMFX 2FYAA 5CMIA 5C4FA 2RIZA 4AYLA 4AYJA 4FRMA 1INIA 1MP5A 4KC4A 4FRLA 3ZLLA 1H5SB 3PKQA 4E1KA 2Z87A 1H7QA 4MIXA 4G3PA 2Y4MA 3JUKA 2GGOA 3CKJA 2WGZA 1WT1A 1FGGA 1G9RA 1O23B 3IOIA 3SX7A 1GQ9A 1VPAA 1VH1A 4B2XA 1HM0A 4ASJA 2VXLA 1H7FA 1ZDFA 4EE5A 4B3UA 4P00A 1NF5B 1WT0A 1VZUA 2P72A 3BRKX 5FTSA 3F1CA 3F1YA 1JV1A 3NGWA 2Q4JA 1ZJ3A 2DPWA 4XWIA 1G8OA 1INJA 2APCA
chains in the Genus database with same CATH topology
2X5ZA 3JUJA 1FR8A 1FGXA 3Q80A 5C47A 1NQIB 1OQMB 1H5RB 4Q7CA 1LL0A 4FRBA 1NKHB 4FRDA 5C3DA 4KNXA 1G93A 3FOQA 2FYDB 4Y6NA 4Y7VA 1LL2A 4Y64A 2ICXA 4R7PA 3CKVA 2RIXA 1JV3A 2D0JA 4DE7A 2WE9A 4G3QA 4B4MA 5FYEA 3V0NA 4C2SA 5FU8A 4DDZA 4FQWA 2A8UA 3Q7UA 1ZI5A 2P73A 3O3PA 3V91A 2NXVA 1WT2A 5EIYA 4O6MA 1FRWA 1R80A 3POLA 2YQCA 3K8EA 1H7HA 2PA4A 2J0AA 1IINA 4MYBA 5IDTA 2YC3A 1HV9A 1PZTA 3I0DA 3OKRA 5IFYA 1MP3A 5AJOA 3U2VA 3T7NA 3TQDA 3U2UA 1G2VA 3V90A 4CJCA 1VICA 3PNNA 1ZJOA 4Y7UA 4HO2A 1R7YA 3RMWA 1VGUA 4HO4A 4FROA 2Y4LA 3IOHA 5C38A 1H5SC 4M28A 3V0LA 1G97A 1KWSA 2AH9A 2OI5A 2YQJA 2X5SA 5JQQA 2QGIA 1W55A 4EEOA 2C0NA 4B2WA 2WVKA 2O1FA 3I0KA 1H5SA 1E5KA 2XMHA 2XWNA 2PGYA 2WVLA 1TW5A 4FIYA 4FRQA 3KIAA 1ZI4A 3D5NA 5EJ1A 1H5TB 3EE5A 3I0FA 4EEMA 5I1FA 1V84A 3RMVA 1H7EA 1LZ0A 4KC1A 1LL3A 1HM9A 1OMXA 4B4BA 2AESA 2V0KA 3Q4SA 4D11C 2VK9A 5C49A 3U0YA 1W57A 5CQOA 2E3DA 1ZHJA 1VGZA 3I0CA 1WT3A 4FCEA 4D11A 3OH0A 2V0LA 2BO8A 2ZU8A 1ZCYA 4EE4A 1EYRA 3V8YA 5C1GA 5EJZA 4ECMA 3JTJA 1WVCA 2J0BA 3LW6A 1H5RA 4FRPA 1K4VA 2I7BA 1EZIA 4NALA 1FXOA 2AECA 4MNDA 2AM3A 2RIYA 1HJLA 2Y7AA 4JD0A 1FG5N 4KQLA 1H4EA 2VS5A 2YQSA 1QGQA 2GGQA 2ZU7A 4B5BA 1TW1A 2X60A 4HOCA 1QG8A 1MP4A 2OI7A 5IDSA 4HO0A 3V0MA 3K8DA 3CGXA 5L6SA 2FYBA 1JVGA 1O0RA 4CJ8A 4M2AA 1LZJA 4FCUA 1VH3A 3V0OA 1R82A 3HL3A 2O1GA 3T7MA 1SS9A 4KPZA 2AM5A 4CJBA 1FO8A 2Y4JA 5C8RA 3OC9A 1OMZA 1JYLA 3USRA 2X65A 4G87A 1G23A 5CQLX 2D7RA 1GQCA 1R7VA 4EEAA 3QVBA 4BQHA 4IRPA 5C3BA 4LW6A 1I52A 1TZFA 3U2TA 1ZI1A 1LVWA 2W0VA 5C1HA 4Y9XA 5FV9A 2WEEA 1S4PA 2FFVA 3ZF8A 1YP2A 1W77A 1VGTA 3R3IA 3IOJA 3V8ZA 4M2BA 5C4BA 2RJ1A 3U2XA 1MC3A 1FOAA 1G0RA 2JCOA 1ON6A 2BO6A 4KNRA 1ZJ0A 3CU0A 4G3SA 4M4KA 2RJ9A 3OH3A 2BO4A 1GWWA 1TVYA 5C4DA 1YP4A 2V0JA 2OEFA 1ZJPA 2I5EA 3DJ4A 3PKPA 4ARWA 2O1HA 3ZGGA 4Y7TA 1WSZA 3I0HA 3SPTA 4EVWA 2Y4KA 4HO9A 1YP3A 2WAWA 4EE3A 5CQMX 3ST8A 3E26A 1VGWA 2RJ4A 1NWGB 1Z90A 4EEGA 1GX0A 5DDTA 1GWVA 1QGSA 3SXEA 3U0XA 4KXOA 3R2WA 4Y6UA 5FTVA 3I0EA 4HO3A 3T7OA 3FWWA 1S4NA 4HO8A 4YS8A 1XHBA 5D92A 5C4EA 5CMHA 2ICYA 4HCQA 4HG6A 1R7XA 2FFUA 1R7UA 2BO7A 4ASYA 5CQNX 2I5KA 5FUHA 1H4CA 3DUVA 4UEGA 3N9WA 2OI6A 2RITA 3CKNA 4NAKA 4Y63A 2PX7A 1ZCVA 4FREA 3SXAA 2ZU9A 4ZDQA 1LZ7A 2D7IA 5C1LA 2Z86A 2RJ8A 2VXMA 1GA8A 4B42A 4J18A 4Y7FA 5D91A 1H5SD 3DK5A 1H7GA 5CQPA 4Y7GA 1FZWA 1H7TA 3I0LA 2QKXA 5DDVA 4D0TA 3SXGA 3TZTA 2AM4A 2RJ7A 5CMGX 2VFZA 2P6WA 1LZIA 2RJ6A 2UX8A 2YC5A 4LW3A 1JVDA 1O7QA 2VD4A 3CKOA 4KPXA 5C36A 5J49A 1G95A 3I0JA 1HJJA 3E25A 5C48A 3I0GA 4K6RA 1G3LA 1ZCTA 3D8VA 1ZI3A 3SX3A 3BCVA 4FIXA 1PZYB 1JYKA 3U2WA 3RSBA 1FR9A 4BMAA 4KRVA 1XZ6A 3I0IX 5C3AA 4B4GA 3OH1A 4FRAA 4AC3A 4O6NA 1ZJ2A 3V0PA 2WVMA 4HO5A 4KC2A 4Y62A 1FO9A 4HO6A 1ZCUA 2OEGA 3ZGFA 5FU0A 2VSIA 4CVHA 1O7OA 5AJPA 1H7LA 2XMEA 5CMJA 1ZJ1A 2JCLA 3V0QA 2YESA 1ZDGA 2CU2A 3SX8A 1H4DA 4FRHA 4L41C 4NANA 3SX5A 3CKQA 1H5TA 1GX4A 2JCJA 2AGDA 3D98A 1HM8A 1QWJA 4P02A 3OH2A 4IRQA 4DECA 4D48A 2AE7A 2V0IA 2FYCB 3USQA 5BXCA 2YCMA 5AJNA 3SXCA 4AAWA 2RJ5A 1S4OA 3OH4A 2E8BA 4KT7A 4NAIA 1VZTA 2VS4A 1NHEB 3GUEA 2RJ0A 1H3MA 5C4CA 2XWMA 2QH5A 2A8WA 3OAMA 1FXJA 1NMMB 2W0WA 3SXBA 2VS3A 1ON8A 1R7TA 1G1LA 2YQHA 2PGVA 2VSHA 2JCKA 5HS2A 3ZLKA 1FWYA 2XWLA 1VZXA 3OGZA 5L6VA 1VM8A 2Y6PA 3SXDA 1R81A 1V82A 4D0ZA 1YROB 4GBPA 1IIMA 2MZBA 4JISA 2FY7A 1ZIZA 1V83A 2V0HA 5CMFX 2FYAA 5CMIA 5C4FA 2RIZA 4AYLA 4AYJA 4FRMA 1INIA 1MP5A 4KC4A 4FRLA 3ZLLA 1H5SB 3PKQA 4E1KA 2Z87A 1H7QA 4MIXA 4G3PA 2Y4MA 3JUKA 2GGOA 3CKJA 2WGZA 1WT1A 1FGGA 1G9RA 1O23B 3IOIA 3SX7A 1GQ9A 1VPAA 1VH1A 4B2XA 1HM0A 4ASJA 2VXLA 1H7FA 1ZDFA 4EE5A 4B3UA 4P00A 1NF5B 1WT0A 1VZUA 2P72A 3BRKX 5FTSA 3F1CA 3F1YA 1JV1A 3NGWA 2Q4JA 1ZJ3A 2DPWA 4XWIA 1G8OA 1INJA 2APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5Z A;  3JUJ A;  1FR8 A;  1FGX A;  3Q80 A;  5C47 A;  1NQI B;  1OQM B;  1H5R B;  1LL0 A;  4FRB A;  1NKH B;  4FRD A;  5C3D A;  4KNX A;  1G93 A;  3FOQ A;  2FYD B;  4Y6N A;  4Y7V A;  1LL2 A;  4Y64 A;  2ICX A;  4R7P A;  3CKV A;  2RIX A;  1JV3 A;  2D0J A;  4DE7 A;  2WE9 A;  4G3Q A;  4B4M A;  5FYE A;  3V0N A;  4C2S A;  5FU8 A;  4DDZ A;  4FQW A;  2A8U A;  3Q7U A;  1ZI5 A;  2P73 A;  3O3P A;  3V91 A;  2NXV A;  1WT2 A;  5EIY A;  1FRW A;  1R80 A;  3POL A;  2YQC A;  3K8E A;  1H7H A;  2PA4 A;  1IIN A;  4MYB A;  5IDT A;  2YC3 A;  1HV9 A;  1PZT A;  3I0D A;  3OKR A;  5IFY A;  1MP3 A;  5AJO A;  3U2V A;  3T7N A;  3TQD A;  3U2U A;  1G2V A;  3V90 A;  4CJC A;  1VIC A;  3PNN A;  1ZJO A;  4Y7U A;  4HO2 A;  1R7Y A;  3RMW A;  1VGU A;  4HO4 A;  4FRO A;  2Y4L A;  3IOH A;  5C38 A;  1H5S C;  4M28 A;  3V0L A;  1G97 A;  1KWS A;  2AH9 A;  2OI5 A;  2YQJ A;  2X5S A;  5JQQ A;  2QGI A;  1W55 A;  4EEO A;  4B2W A;  2WVK A;  2O1F A;  3I0K A;  1H5S A;  1E5K A;  2XMH A;  2XWN A;  2PGY A;  2WVL A;  1TW5 A;  4FRQ A;  3KIA A;  1ZI4 A;  3D5N A;  5EJ1 A;  1H5T B;  3EE5 A;  3I0F A;  4EEM A;  5I1F A;  1V84 A;  3RMV A;  1H7E A;  1LZ0 A;  4KC1 A;  1LL3 A;  1HM9 A;  1OMX A;  4B4B A;  2AES A;  2V0K A;  3Q4S A;  4D11 C;  5C49 A;  3U0Y A;  1W57 A;  5CQO A;  2E3D A;  1ZHJ A;  1VGZ A;  3I0C A;  1WT3 A;  4FCE A;  4D11 A;  3OH0 A;  2V0L A;  2BO8 A;  2ZU8 A;  1ZCY A;  4EE4 A;  1EYR A;  3V8Y A;  5C1G A;  5EJZ A;  4ECM A;  3JTJ A;  1WVC A;  3LW6 A;  1H5R A;  4FRP A;  1K4V A;  2I7B A;  1EZI A;  4NAL A;  1FXO A;  2AEC A;  4MND A;  2AM3 A;  2RIY A;  1HJL A;  2Y7A A;  4JD0 A;  1FG5 N;  4KQL A;  1H4E A;  2VS5 A;  2YQS A;  1QGQ A;  2GGQ A;  2ZU7 A;  4B5B A;  1TW1 A;  2X60 A;  4HOC A;  1QG8 A;  1MP4 A;  2OI7 A;  5IDS A;  4HO0 A;  3V0M A;  3K8D A;  3CGX A;  5L6S A;  2FYB A;  1JVG A;  1O0R A;  4CJ8 A;  4M2A A;  1LZJ A;  4FCU A;  1VH3 A;  3V0O A;  1R82 A;  3HL3 A;  2O1G A;  3T7M A;  1SS9 A;  4KPZ A;  2AM5 A;  4CJB A;  1FO8 A;  2Y4J A;  5C8R A;  3OC9 A;  1OMZ A;  1JYL A;  3USR A;  2X65 A;  4G87 A;  1G23 A;  5CQL X;  2D7R A;  1GQC A;  1R7V A;  4EEA A;  3QVB A;  4BQH A;  4IRP A;  5C3B A;  4LW6 A;  1I52 A;  1TZF A;  3U2T A;  1ZI1 A;  1LVW A;  2W0V A;  5C1H A;  4Y9X A;  5FV9 A;  2WEE A;  1S4P A;  2FFV A;  3ZF8 A;  1YP2 A;  1W77 A;  1VGT A;  3R3I A;  3IOJ A;  3V8Z A;  4M2B A;  5C4B A;  2RJ1 A;  3U2X A;  1MC3 A;  1FOA A;  1G0R A;  2JCO A;  1ON6 A;  2BO6 A;  4KNR A;  1ZJ0 A;  3CU0 A;  4G3S A;  4M4K A;  2RJ9 A;  3OH3 A;  2BO4 A;  1GWW A;  1TVY A;  5C4D A;  1YP4 A;  2V0J A;  2OEF A;  1ZJP A;  2I5E A;  3DJ4 A;  3PKP A;  4ARW A;  2O1H A;  3ZGG A;  4Y7T A;  1WSZ A;  3I0H A;  3SPT A;  4EVW A;  2Y4K A;  4HO9 A;  1YP3 A;  2WAW A;  4EE3 A;  5CQM X;  3ST8 A;  3E26 A;  1VGW A;  2RJ4 A;  1NWG B;  1Z90 A;  4EEG A;  1GX0 A;  5DDT A;  1GWV A;  1QGS A;  3SXE A;  3U0X A;  4KXO A;  3R2W A;  4Y6U A;  5FTV A;  3I0E A;  4HO3 A;  3T7O A;  3FWW A;  1S4N A;  4HO8 A;  4YS8 A;  1XHB A;  5C4E A;  5CMH A;  2ICY A;  4HCQ A;  4HG6 A;  1R7X A;  2FFU A;  1R7U A;  2BO7 A;  4ASY A;  5CQN X;  2I5K A;  5FUH A;  1H4C A;  3DUV A;  4UEG A;  3N9W A;  2OI6 A;  2RIT A;  3CKN A;  4NAK A;  4Y63 A;  2PX7 A;  1ZCV A;  4FRE A;  3SXA A;  2ZU9 A;  4ZDQ A;  1LZ7 A;  2D7I A;  5C1L A;  2Z86 A;  2RJ8 A;  2VXM A;  1GA8 A;  4B42 A;  4J18 A;  4Y7F A;  1H5S D;  3DK5 A;  1H7G A;  5CQP A;  4Y7G A;  1FZW A;  1H7T A;  3I0L A;  2QKX A;  5DDV A;  4D0T A;  3SXG A;  3TZT A;  2AM4 A;  2RJ7 A;  5CMG X;  2VFZ A;  2P6W A;  1LZI A;  2RJ6 A;  2UX8 A;  2YC5 A;  4LW3 A;  1JVD A;  1O7Q A;  2VD4 A;  3CKO A;  4KPX A;  5C36 A;  5J49 A;  1G95 A;  3I0J A;  1HJJ A;  3E25 A;  5C48 A;  3I0G A;  4K6R A;  1G3L A;  1ZCT A;  3D8V A;  1ZI3 A;  3SX3 A;  3BCV A;  1PZY B;  1JYK A;  3U2W A;  3RSB A;  1FR9 A;  4BMA A;  4KRV A;  1XZ6 A;  3I0I X;  5C3A A;  4B4G A;  3OH1 A;  4FRA A;  4AC3 A;  1ZJ2 A;  3V0P A;  2WVM A;  4HO5 A;  4KC2 A;  4Y62 A;  1FO9 A;  4HO6 A;  1ZCU A;  2OEG A;  3ZGF A;  5FU0 A;  2VSI A;  4CVH A;  1O7O A;  5AJP A;  1H7L A;  2XME A;  5CMJ A;  1ZJ1 A;  2JCL A;  3V0Q A;  2YES A;  1ZDG A;  2CU2 A;  3SX8 A;  1H4D A;  4FRH A;  4L41 C;  4NAN A;  3SX5 A;  3CKQ A;  1H5T A;  1GX4 A;  2JCJ A;  2AGD A;  3D98 A;  1HM8 A;  1QWJ A;  4P02 A;  3OH2 A;  4IRQ A;  4DEC A;  4D48 A;  2AE7 A;  2V0I A;  2FYC B;  3USQ A;  5BXC A;  2YCM A;  5AJN A;  3SXC A;  4AAW A;  2RJ5 A;  1S4O A;  3OH4 A;  2E8B A;  4KT7 A;  4NAI A;  1VZT A;  2VS4 A;  1NHE B;  3GUE A;  2RJ0 A;  1H3M A;  5C4C A;  2XWM A;  2QH5 A;  2A8W A;  3OAM A;  1FXJ A;  1NMM B;  2W0W A;  3SXB A;  2VS3 A;  1ON8 A;  1R7T A;  1G1L A;  2YQH A;  2PGV A;  2VSH A;  2JCK A;  5HS2 A;  3ZLK A;  1FWY A;  2XWL A;  1VZX A;  3OGZ A;  5L6V A;  1VM8 A;  2Y6P A;  3SXD A;  1R81 A;  1V82 A;  4D0Z A;  1YRO B;  4GBP A;  1IIM A;  2MZB A;  4JIS A;  2FY7 A;  1ZIZ A;  1V83 A;  2V0H A;  5CMF X;  2FYA A;  5CMI A;  5C4F A;  2RIZ A;  4AYL A;  4AYJ A;  4FRM A;  1INI A;  1MP5 A;  4KC4 A;  4FRL A;  3ZLL A;  1H5S B;  3PKQ A;  4E1K A;  2Z87 A;  1H7Q A;  4G3P A;  2Y4M A;  3JUK A;  2GGO A;  3CKJ A;  2WGZ A;  1WT1 A;  1FGG A;  1G9R A;  1O23 B;  3IOI A;  3SX7 A;  1GQ9 A;  1VPA A;  1VH1 A;  4B2X A;  1HM0 A;  4ASJ A;  2VXL A;  1H7F A;  1ZDF A;  4EE5 A;  4B3U A;  4P00 A;  1NF5 B;  1WT0 A;  1VZU A;  2P72 A;  3BRK X;  5FTS A;  3F1C A;  3F1Y A;  1JV1 A;  3NGW A;  2Q4J A;  1ZJ3 A;  2DPW A;  4XWI A;  1G8O A;  1INJ A;  2APC A; 
#chains in the Genus database with same CATH topology
 2X5Z A;  3JUJ A;  1FR8 A;  1FGX A;  3Q80 A;  5C47 A;  1NQI B;  1OQM B;  1H5R B;  4Q7C A;  1LL0 A;  4FRB A;  1NKH B;  4FRD A;  5C3D A;  4KNX A;  1G93 A;  3FOQ A;  2FYD B;  4Y6N A;  4Y7V A;  1LL2 A;  4Y64 A;  2ICX A;  4R7P A;  3CKV A;  2RIX A;  1JV3 A;  2D0J A;  4DE7 A;  2WE9 A;  4G3Q A;  4B4M A;  5FYE A;  3V0N A;  4C2S A;  5FU8 A;  4DDZ A;  4FQW A;  2A8U A;  3Q7U A;  1ZI5 A;  2P73 A;  3O3P A;  3V91 A;  2NXV A;  1WT2 A;  5EIY A;  4O6M A;  1FRW A;  1R80 A;  3POL A;  2YQC A;  3K8E A;  1H7H A;  2PA4 A;  2J0A A;  1IIN A;  4MYB A;  5IDT A;  2YC3 A;  1HV9 A;  1PZT A;  3I0D A;  3OKR A;  5IFY A;  1MP3 A;  5AJO A;  3U2V A;  3T7N A;  3TQD A;  3U2U A;  1G2V A;  3V90 A;  4CJC A;  1VIC A;  3PNN A;  1ZJO A;  4Y7U A;  4HO2 A;  1R7Y A;  3RMW A;  1VGU A;  4HO4 A;  4FRO A;  2Y4L A;  3IOH A;  5C38 A;  1H5S C;  4M28 A;  3V0L A;  1G97 A;  1KWS A;  2AH9 A;  2OI5 A;  2YQJ A;  2X5S A;  5JQQ A;  2QGI A;  1W55 A;  4EEO A;  2C0N A;  4B2W A;  2WVK A;  2O1F A;  3I0K A;  1H5S A;  1E5K A;  2XMH A;  2XWN A;  2PGY A;  2WVL A;  1TW5 A;  4FIY A;  4FRQ A;  3KIA A;  1ZI4 A;  3D5N A;  5EJ1 A;  1H5T B;  3EE5 A;  3I0F A;  4EEM A;  5I1F A;  1V84 A;  3RMV A;  1H7E A;  1LZ0 A;  4KC1 A;  1LL3 A;  1HM9 A;  1OMX A;  4B4B A;  2AES A;  2V0K A;  3Q4S A;  4D11 C;  2VK9 A;  5C49 A;  3U0Y A;  1W57 A;  5CQO A;  2E3D A;  1ZHJ A;  1VGZ A;  3I0C A;  1WT3 A;  4FCE A;  4D11 A;  3OH0 A;  2V0L A;  2BO8 A;  2ZU8 A;  1ZCY A;  4EE4 A;  1EYR A;  3V8Y A;  5C1G A;  5EJZ A;  4ECM A;  3JTJ A;  1WVC A;  2J0B A;  3LW6 A;  1H5R A;  4FRP A;  1K4V A;  2I7B A;  1EZI A;  4NAL A;  1FXO A;  2AEC A;  4MND A;  2AM3 A;  2RIY A;  1HJL A;  2Y7A A;  4JD0 A;  1FG5 N;  4KQL A;  1H4E A;  2VS5 A;  2YQS A;  1QGQ A;  2GGQ A;  2ZU7 A;  4B5B A;  1TW1 A;  2X60 A;  4HOC A;  1QG8 A;  1MP4 A;  2OI7 A;  5IDS A;  4HO0 A;  3V0M A;  3K8D A;  3CGX A;  5L6S A;  2FYB A;  1JVG A;  1O0R A;  4CJ8 A;  4M2A A;  1LZJ A;  4FCU A;  1VH3 A;  3V0O A;  1R82 A;  3HL3 A;  2O1G A;  3T7M A;  1SS9 A;  4KPZ A;  2AM5 A;  4CJB A;  1FO8 A;  2Y4J A;  5C8R A;  3OC9 A;  1OMZ A;  1JYL A;  3USR A;  2X65 A;  4G87 A;  1G23 A;  5CQL X;  2D7R A;  1GQC A;  1R7V A;  4EEA A;  3QVB A;  4BQH A;  4IRP A;  5C3B A;  4LW6 A;  1I52 A;  1TZF A;  3U2T A;  1ZI1 A;  1LVW A;  2W0V A;  5C1H A;  4Y9X A;  5FV9 A;  2WEE A;  1S4P A;  2FFV A;  3ZF8 A;  1YP2 A;  1W77 A;  1VGT A;  3R3I A;  3IOJ A;  3V8Z A;  4M2B A;  5C4B A;  2RJ1 A;  3U2X A;  1MC3 A;  1FOA A;  1G0R A;  2JCO A;  1ON6 A;  2BO6 A;  4KNR A;  1ZJ0 A;  3CU0 A;  4G3S A;  4M4K A;  2RJ9 A;  3OH3 A;  2BO4 A;  1GWW A;  1TVY A;  5C4D A;  1YP4 A;  2V0J A;  2OEF A;  1ZJP A;  2I5E A;  3DJ4 A;  3PKP A;  4ARW A;  2O1H A;  3ZGG A;  4Y7T A;  1WSZ A;  3I0H A;  3SPT A;  4EVW A;  2Y4K A;  4HO9 A;  1YP3 A;  2WAW A;  4EE3 A;  5CQM X;  3ST8 A;  3E26 A;  1VGW A;  2RJ4 A;  1NWG B;  1Z90 A;  4EEG A;  1GX0 A;  5DDT A;  1GWV A;  1QGS A;  3SXE A;  3U0X A;  4KXO A;  3R2W A;  4Y6U A;  5FTV A;  3I0E A;  4HO3 A;  3T7O A;  3FWW A;  1S4N A;  4HO8 A;  4YS8 A;  1XHB A;  5D92 A;  5C4E A;  5CMH A;  2ICY A;  4HCQ A;  4HG6 A;  1R7X A;  2FFU A;  1R7U A;  2BO7 A;  4ASY A;  5CQN X;  2I5K A;  5FUH A;  1H4C A;  3DUV A;  4UEG A;  3N9W A;  2OI6 A;  2RIT A;  3CKN A;  4NAK A;  4Y63 A;  2PX7 A;  1ZCV A;  4FRE A;  3SXA A;  2ZU9 A;  4ZDQ A;  1LZ7 A;  2D7I A;  5C1L A;  2Z86 A;  2RJ8 A;  2VXM A;  1GA8 A;  4B42 A;  4J18 A;  4Y7F A;  5D91 A;  1H5S D;  3DK5 A;  1H7G A;  5CQP A;  4Y7G A;  1FZW A;  1H7T A;  3I0L A;  2QKX A;  5DDV A;  4D0T A;  3SXG A;  3TZT A;  2AM4 A;  2RJ7 A;  5CMG X;  2VFZ A;  2P6W A;  1LZI A;  2RJ6 A;  2UX8 A;  2YC5 A;  4LW3 A;  1JVD A;  1O7Q A;  2VD4 A;  3CKO A;  4KPX A;  5C36 A;  5J49 A;  1G95 A;  3I0J A;  1HJJ A;  3E25 A;  5C48 A;  3I0G A;  4K6R A;  1G3L A;  1ZCT A;  3D8V A;  1ZI3 A;  3SX3 A;  3BCV A;  4FIX A;  1PZY B;  1JYK A;  3U2W A;  3RSB A;  1FR9 A;  4BMA A;  4KRV A;  1XZ6 A;  3I0I X;  5C3A A;  4B4G A;  3OH1 A;  4FRA A;  4AC3 A;  4O6N A;  1ZJ2 A;  3V0P A;  2WVM A;  4HO5 A;  4KC2 A;  4Y62 A;  1FO9 A;  4HO6 A;  1ZCU A;  2OEG A;  3ZGF A;  5FU0 A;  2VSI A;  4CVH A;  1O7O A;  5AJP A;  1H7L A;  2XME A;  5CMJ A;  1ZJ1 A;  2JCL A;  3V0Q A;  2YES A;  1ZDG A;  2CU2 A;  3SX8 A;  1H4D A;  4FRH A;  4L41 C;  4NAN A;  3SX5 A;  3CKQ A;  1H5T A;  1GX4 A;  2JCJ A;  2AGD A;  3D98 A;  1HM8 A;  1QWJ A;  4P02 A;  3OH2 A;  4IRQ A;  4DEC A;  4D48 A;  2AE7 A;  2V0I A;  2FYC B;  3USQ A;  5BXC A;  2YCM A;  5AJN A;  3SXC A;  4AAW A;  2RJ5 A;  1S4O A;  3OH4 A;  2E8B A;  4KT7 A;  4NAI A;  1VZT A;  2VS4 A;  1NHE B;  3GUE A;  2RJ0 A;  1H3M A;  5C4C A;  2XWM A;  2QH5 A;  2A8W A;  3OAM A;  1FXJ A;  1NMM B;  2W0W A;  3SXB A;  2VS3 A;  1ON8 A;  1R7T A;  1G1L A;  2YQH A;  2PGV A;  2VSH A;  2JCK A;  5HS2 A;  3ZLK A;  1FWY A;  2XWL A;  1VZX A;  3OGZ A;  5L6V A;  1VM8 A;  2Y6P A;  3SXD A;  1R81 A;  1V82 A;  4D0Z A;  1YRO B;  4GBP A;  1IIM A;  2MZB A;  4JIS A;  2FY7 A;  1ZIZ A;  1V83 A;  2V0H A;  5CMF X;  2FYA A;  5CMI A;  5C4F A;  2RIZ A;  4AYL A;  4AYJ A;  4FRM A;  1INI A;  1MP5 A;  4KC4 A;  4FRL A;  3ZLL A;  1H5S B;  3PKQ A;  4E1K A;  2Z87 A;  1H7Q A;  4MIX A;  4G3P A;  2Y4M A;  3JUK A;  2GGO A;  3CKJ A;  2WGZ A;  1WT1 A;  1FGG A;  1G9R A;  1O23 B;  3IOI A;  3SX7 A;  1GQ9 A;  1VPA A;  1VH1 A;  4B2X A;  1HM0 A;  4ASJ A;  2VXL A;  1H7F A;  1ZDF A;  4EE5 A;  4B3U A;  4P00 A;  1NF5 B;  1WT0 A;  1VZU A;  2P72 A;  3BRK X;  5FTS A;  3F1C A;  3F1Y A;  1JV1 A;  3NGW A;  2Q4J A;  1ZJ3 A;  2DPW A;  4XWI A;  1G8O A;  1INJ A;  2APC A; 
#chains in the Genus database with same CATH homology
 2X5Z A;  3JUJ A;  1FR8 A;  1FGX A;  3Q80 A;  5C47 A;  1NQI B;  1OQM B;  1H5R B;  4Q7C A;  1LL0 A;  4FRB A;  1NKH B;  4FRD A;  5C3D A;  4KNX A;  1G93 A;  3FOQ A;  2FYD B;  4Y6N A;  4Y7V A;  1LL2 A;  4Y64 A;  2ICX A;  4R7P A;  3CKV A;  2RIX A;  1JV3 A;  2D0J A;  4DE7 A;  2WE9 A;  4G3Q A;  4B4M A;  5FYE A;  3V0N A;  4C2S A;  5FU8 A;  4DDZ A;  4FQW A;  2A8U A;  3Q7U A;  1ZI5 A;  2P73 A;  3O3P A;  3V91 A;  2NXV A;  1WT2 A;  5EIY A;  4O6M A;  1FRW A;  1R80 A;  3POL A;  2YQC A;  3K8E A;  1H7H A;  2PA4 A;  2J0A A;  1IIN A;  4MYB A;  5IDT A;  2YC3 A;  1HV9 A;  1PZT A;  3I0D A;  3OKR A;  5IFY A;  1MP3 A;  5AJO A;  3U2V A;  3T7N A;  3TQD A;  3U2U A;  1G2V A;  3V90 A;  4CJC A;  1VIC A;  3PNN A;  1ZJO A;  4Y7U A;  4HO2 A;  1R7Y A;  3RMW A;  1VGU A;  4HO4 A;  4FRO A;  2Y4L A;  3IOH A;  5C38 A;  1H5S C;  4M28 A;  3V0L A;  1G97 A;  1KWS A;  2AH9 A;  2OI5 A;  2YQJ A;  2X5S A;  5JQQ A;  2QGI A;  1W55 A;  4EEO A;  2C0N A;  4B2W A;  2WVK A;  2O1F A;  3I0K A;  1H5S A;  1E5K A;  2XMH A;  2XWN A;  2PGY A;  2WVL A;  1TW5 A;  4FIY A;  4FRQ A;  3KIA A;  1ZI4 A;  3D5N A;  5EJ1 A;  1H5T B;  3EE5 A;  3I0F A;  4EEM A;  5I1F A;  1V84 A;  3RMV A;  1H7E A;  1LZ0 A;  4KC1 A;  1LL3 A;  1HM9 A;  1OMX A;  4B4B A;  2AES A;  2V0K A;  3Q4S A;  4D11 C;  2VK9 A;  5C49 A;  3U0Y A;  1W57 A;  5CQO A;  2E3D A;  1ZHJ A;  1VGZ A;  3I0C A;  1WT3 A;  4FCE A;  4D11 A;  3OH0 A;  2V0L A;  2BO8 A;  2ZU8 A;  1ZCY A;  4EE4 A;  1EYR A;  3V8Y A;  5C1G A;  5EJZ A;  4ECM A;  3JTJ A;  1WVC A;  2J0B A;  3LW6 A;  1H5R A;  4FRP A;  1K4V A;  2I7B A;  1EZI A;  4NAL A;  1FXO A;  2AEC A;  4MND A;  2AM3 A;  2RIY A;  1HJL A;  2Y7A A;  4JD0 A;  1FG5 N;  4KQL A;  1H4E A;  2VS5 A;  2YQS A;  1QGQ A;  2GGQ A;  2ZU7 A;  4B5B A;  1TW1 A;  2X60 A;  4HOC A;  1QG8 A;  1MP4 A;  2OI7 A;  5IDS A;  4HO0 A;  3V0M A;  3K8D A;  3CGX A;  5L6S A;  2FYB A;  1JVG A;  1O0R A;  4CJ8 A;  4M2A A;  1LZJ A;  4FCU A;  1VH3 A;  3V0O A;  1R82 A;  3HL3 A;  2O1G A;  3T7M A;  1SS9 A;  4KPZ A;  2AM5 A;  4CJB A;  1FO8 A;  2Y4J A;  5C8R A;  3OC9 A;  1OMZ A;  1JYL A;  3USR A;  2X65 A;  4G87 A;  1G23 A;  5CQL X;  2D7R A;  1GQC A;  1R7V A;  4EEA A;  3QVB A;  4BQH A;  4IRP A;  5C3B A;  4LW6 A;  1I52 A;  1TZF A;  3U2T A;  1ZI1 A;  1LVW A;  2W0V A;  5C1H A;  4Y9X A;  5FV9 A;  2WEE A;  1S4P A;  2FFV A;  3ZF8 A;  1YP2 A;  1W77 A;  1VGT A;  3R3I A;  3IOJ A;  3V8Z A;  4M2B A;  5C4B A;  2RJ1 A;  3U2X A;  1MC3 A;  1FOA A;  1G0R A;  2JCO A;  1ON6 A;  2BO6 A;  4KNR A;  1ZJ0 A;  3CU0 A;  4G3S A;  4M4K A;  2RJ9 A;  3OH3 A;  2BO4 A;  1GWW A;  1TVY A;  5C4D A;  1YP4 A;  2V0J A;  2OEF A;  1ZJP A;  2I5E A;  3DJ4 A;  3PKP A;  4ARW A;  2O1H A;  3ZGG A;  4Y7T A;  1WSZ A;  3I0H A;  3SPT A;  4EVW A;  2Y4K A;  4HO9 A;  1YP3 A;  2WAW A;  4EE3 A;  5CQM X;  3ST8 A;  3E26 A;  1VGW A;  2RJ4 A;  1NWG B;  1Z90 A;  4EEG A;  1GX0 A;  5DDT A;  1GWV A;  1QGS A;  3SXE A;  3U0X A;  4KXO A;  3R2W A;  4Y6U A;  5FTV A;  3I0E A;  4HO3 A;  3T7O A;  3FWW A;  1S4N A;  4HO8 A;  4YS8 A;  1XHB A;  5D92 A;  5C4E A;  5CMH A;  2ICY A;  4HCQ A;  4HG6 A;  1R7X A;  2FFU A;  1R7U A;  2BO7 A;  4ASY A;  5CQN X;  2I5K A;  5FUH A;  1H4C A;  3DUV A;  4UEG A;  3N9W A;  2OI6 A;  2RIT A;  3CKN A;  4NAK A;  4Y63 A;  2PX7 A;  1ZCV A;  4FRE A;  3SXA A;  2ZU9 A;  4ZDQ A;  1LZ7 A;  2D7I A;  5C1L A;  2Z86 A;  2RJ8 A;  2VXM A;  1GA8 A;  4B42 A;  4J18 A;  4Y7F A;  5D91 A;  1H5S D;  3DK5 A;  1H7G A;  5CQP A;  4Y7G A;  1FZW A;  1H7T A;  3I0L A;  2QKX A;  5DDV A;  4D0T A;  3SXG A;  3TZT A;  2AM4 A;  2RJ7 A;  5CMG X;  2VFZ A;  2P6W A;  1LZI A;  2RJ6 A;  2UX8 A;  2YC5 A;  4LW3 A;  1JVD A;  1O7Q A;  2VD4 A;  3CKO A;  4KPX A;  5C36 A;  5J49 A;  1G95 A;  3I0J A;  1HJJ A;  3E25 A;  5C48 A;  3I0G A;  4K6R A;  1G3L A;  1ZCT A;  3D8V A;  1ZI3 A;  3SX3 A;  3BCV A;  4FIX A;  1PZY B;  1JYK A;  3U2W A;  3RSB A;  1FR9 A;  4BMA A;  4KRV A;  1XZ6 A;  3I0I X;  5C3A A;  4B4G A;  3OH1 A;  4FRA A;  4AC3 A;  4O6N A;  1ZJ2 A;  3V0P A;  2WVM A;  4HO5 A;  4KC2 A;  4Y62 A;  1FO9 A;  4HO6 A;  1ZCU A;  2OEG A;  3ZGF A;  5FU0 A;  2VSI A;  4CVH A;  1O7O A;  5AJP A;  1H7L A;  2XME A;  5CMJ A;  1ZJ1 A;  2JCL A;  3V0Q A;  2YES A;  1ZDG A;  2CU2 A;  3SX8 A;  1H4D A;  4FRH A;  4L41 C;  4NAN A;  3SX5 A;  3CKQ A;  1H5T A;  1GX4 A;  2JCJ A;  2AGD A;  3D98 A;  1HM8 A;  1QWJ A;  4P02 A;  3OH2 A;  4IRQ A;  4DEC A;  4D48 A;  2AE7 A;  2V0I A;  2FYC B;  3USQ A;  5BXC A;  2YCM A;  5AJN A;  3SXC A;  4AAW A;  2RJ5 A;  1S4O A;  3OH4 A;  2E8B A;  4KT7 A;  4NAI A;  1VZT A;  2VS4 A;  1NHE B;  3GUE A;  2RJ0 A;  1H3M A;  5C4C A;  2XWM A;  2QH5 A;  2A8W A;  3OAM A;  1FXJ A;  1NMM B;  2W0W A;  3SXB A;  2VS3 A;  1ON8 A;  1R7T A;  1G1L A;  2YQH A;  2PGV A;  2VSH A;  2JCK A;  5HS2 A;  3ZLK A;  1FWY A;  2XWL A;  1VZX A;  3OGZ A;  5L6V A;  1VM8 A;  2Y6P A;  3SXD A;  1R81 A;  1V82 A;  4D0Z A;  1YRO B;  4GBP A;  1IIM A;  2MZB A;  4JIS A;  2FY7 A;  1ZIZ A;  1V83 A;  2V0H A;  5CMF X;  2FYA A;  5CMI A;  5C4F A;  2RIZ A;  4AYL A;  4AYJ A;  4FRM A;  1INI A;  1MP5 A;  4KC4 A;  4FRL A;  3ZLL A;  1H5S B;  3PKQ A;  4E1K A;  2Z87 A;  1H7Q A;  4MIX A;  4G3P A;  2Y4M A;  3JUK A;  2GGO A;  3CKJ A;  2WGZ A;  1WT1 A;  1FGG A;  1G9R A;  1O23 B;  3IOI A;  3SX7 A;  1GQ9 A;  1VPA A;  1VH1 A;  4B2X A;  1HM0 A;  4ASJ A;  2VXL A;  1H7F A;  1ZDF A;  4EE5 A;  4B3U A;  4P00 A;  1NF5 B;  1WT0 A;  1VZU A;  2P72 A;  3BRK X;  5FTS A;  3F1C A;  3F1Y A;  1JV1 A;  3NGW A;  2Q4J A;  1ZJ3 A;  2DPW A;  4XWI A;  1G8O A;  1INJ A;  2APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...