4FRAA

Crystal structure of abba+udp+gal at ph 5.0 with mpd as the cryoprotectant
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
284
structure length
272
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 272
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4fraA00
3OAMA 4D0TA 5CMGX 3SXDA 2JCJA 5C4EA 2BO8A 2D7IA 2WGZA 1LZJA 1LZ7A 2GGQA 2RJ4A 2WVLA 4HG6A 5I1FA 1OMZA 1LZ0A 3SX8A 3SXGA 1G0RA 2BO7A 2W0WA 4NAKA 5J49A 1NQIB 4HO4A 1YROB 2AM3A 2RJ0A 3I0IX 2V0HA 2BO6A 1G8OA 2PA4A 3ZF8A 3DJ4A 4DDZA 5L6VA 1R7TA 4D48A 1ZJ2A 1H5TA 4M4KA 4JD0A 1KWSA 4G87A 1VPAA 3Q80A 5C8RA 2Y4KA 4B4BA 4Y9XA 3CKJA 2AESA 2JCKA 1W57A 1O0RA 1HJLA 1ZHJA 5FU0A 2JCLA 2PX7A 2WEEA 1NWGB 2X5SA 3OGZA 1ZJ0A 1R7XA 2OI6A 2WVMA 2VFZA 4NANA 5CMIA 1H5TB 4KRVA 1VICA 1H7LA 5EJZA 1ZI4A 5HS2A 1WSZA 2QH5A 2ZU9A 3E26A 5C36A 5C4FA 1E5KA 2V0JA 4ZDQA 3V0OA 1JV1A 4FRMA 3V0LA 5C4BA 3USRA 5C3DA 2AECA 3SXAA 3D8VA 2RIZA 1JYLA 1TW1A 2GGOA 2Y6PA 2X5ZA 4FRHA 2VS4A 1H5SB 3I0KA 4FRQA 2YQSA 1IIMA 4HO5A 1G9RA 1MP4A 1GQ9A 1FGXA 1H7HA 2I7BA 3O3PA 1YP3A 5FTSA 1FR9A 2A8UA 1HM8A 1VH1A 3R3IA 4KNXA 1H7QA 2O1HA 4K6RA 5EIYA 4Y7TA 2VS5A 4EE3A 5CQPA 2E3DA 3V91A 1H4EA 3JUKA 3D98A 2Y7AA 1NHEB 1FR8A 5FTVA 4CVHA 3I0LA 1G23A 4KT7A 1GWWA 2X60A 3SXCA 4M2BA 1ZI3A 2NXVA 4LW3A 2FFVA 4KQLA 4Y6NA 2FY7A 2Q4JA 3IOIA 2RJ7A 1R81A 1ZCYA 3U2XA 2XMEA 2YQCA 5IDTA 3V8YA 3ZLLA 1OMXA 1FZWA 1ZI1A 1SS9A 3I0HA 2V0LA 1EYRA 3U2VA 3SX7A 1MP5A 3SXBA 4KC4A 3KIAA 4Y64A 2YC3A 3OH3A 1H5SC 3U0XA 3I0CA 5IFYA 4CJ8A 2OEGA 3Q7UA 1H7EA 3T7NA 4FRDA 3SX5A 4C2SA 2V0IA 3V90A 4G3SA 4YS8A 3RMVA 1H3MA 4IRQA 1HV9A 4FQWA 1G97A 3OH2A 1G93A 3EE5A 4CJCA 1ZDGA 4J18A 3CKNA 4CJBA 2YESA 3ZGFA 3OH4A 2FYDB 2RJ8A 2Z86A 3I0FA 4MNDA 3K8DA 1ZIZA 3USQA 3PKQA 1INIA 1WT2A 4HO8A 1H7FA 1GQCA 3NGWA 1R7UA 1H5RB 4LW6A 3OKRA 1FOAA 2AGDA 1G95A 1QGQA 3I0JA 4B4MA 1G3LA 5C38A 4NAIA 1VM8A 4HO2A 1MC3A 5CQLX 1GX4A 1W77A 1FXJA 2PGYA 1H5SA 3JTJA 1HM9A 4B42A 3OH1A 5EJ1A 1FO8A 4JISA 2V0KA 2D0JA 3PKPA 2MZBA 4B2XA 4KXOA 1ZJ1A 1ON6A 2VD4A 2Y4LA 3PNNA 4DECA 1G1LA 2AM5A 4D11C 5CMHA 2XWMA 4L41C 2XWLA 4P00A 5C4DA 5C47A 2YC5A 2AH9A 3U2UA 2WE9A 4MYBA 4D0ZA 2E8BA 1VH3A 4GBPA 4NALA 2FYAA 3OH0A 4EVWA 1S4OA 2I5EA 1H7GA 4AYLA 4KC2A 3POLA 2VS3A 1WT0A 2RIYA 4M2AA 3BCVA 5C1HA 1GWVA 1V82A 1FXOA 5C1LA 1ZDFA 1Z90A 4Y7UA 2XMHA 5AJPA 3DUVA 4DE7A 1H4CA 2O1FA 4HCQA 4EE4A 4KPZA 1VGZA 3V0MA 4ECMA 3V8ZA 1ZJ3A 5L6SA 3CU0A 1S4NA 3ST8A 2P72A 4E1KA 2QKXA 4FRAA 2FFUA 4D11A 4FROA 1ZCVA 3IOHA 4B3UA 4AAWA 5C49A 4BMAA 2PGVA 2DPWA 4AYJA 2AE7A 4B2WA 3V0QA 3CKVA 5C3AA 5FUHA 5C4CA 3D5NA 4Y7GA 1FGGA 4ASJA 4IRPA 3U0YA 1PZTA 4KC1A 1VZUA 3SXEA 2ZU7A 1WT1A 5CQOA 2APCA 5FU8A 1TZFA 1IINA 3OC9A 4FCUA 4G3QA 5C48A 1JVDA 1WVCA 4FREA 2XWNA 1GX0A 1JYKA 1FWYA 2RJ9A 1VZTA 2AM4A 3TQDA 2A8WA 3FWWA 2O1GA 1V84A 1HM0A 5IDSA 5FYEA 1O7QA 3CGXA 1H5RA 1O23B 2OI5A 1NKHB 1O7OA 1JVGA 3QVBA 4EEGA 2RJ6A 2VSIA 5JQQA 3TZTA 3RMWA 1LL3A 3SX3A 4BQHA 5AJOA 4HO6A 4HO9A 3DK5A 3T7MA 1VGWA 1G2VA 4FRPA 1XHBA 4HO3A 3F1CA 4FRLA 3HL3A 2ICXA 5CMJA 2YCMA 2WVKA 1WT3A 1YP2A 3ZGGA 1QWJA 2OEFA 2QGIA 4FCEA 1PZYB 1S4PA 1ZCTA 2D7RA 2Z87A 5DDVA 1V83A 1ZCUA 2JCOA 3Q4SA 1MP3A 3N9WA 1FO9A 1LL0A 3JUJA 4M28A 4ASYA 4Y62A 1R80A 3K8EA 3RSBA 4Y6UA 1HJJA 1ZI5A 1LVWA 2VXLA 4G3PA 1W55A 3LW6A 2VXMA 1H5SD 4UEGA 1FRWA 1VZXA 5BXCA 5CMFX 4R7PA 4B5BA 1LL2A 1H7TA 2UX8A 5C3BA 2FYCB 3E25A 4KPXA 1FG5N 4Y7VA 2YQJA 3V0PA 1QG8A 2ZU8A 2VSHA 3I0GA 1NF5B 2OI7A 1H4DA 4Y7FA 4AC3A 1K4VA 1ON8A 5DDTA 4B4GA 1VGTA 3GUEA 4KNRA 2Y4JA 4Y63A 5CQMX 3FOQA 3R2WA 1LZIA 2P73A 2RITA 4HOCA 1YP4A 2WAWA 5AJNA 3I0EA 1VGUA 4EEOA 3F1YA 5FV9A 2I5KA 4ARWA 1INJA 3SPTA 4P02A 2W0VA 3IOJA 5CQNX 4EEAA 2YQHA 4XWIA 2RJ5A 3U2WA 3CKQA 1R7VA 3BRKX 1GA8A 1ZJPA 3CKOA 1TW5A 3I0DA 2ICYA 1EZIA 2Y4MA 4FRBA 3V0NA 2CU2A 1OQMB 1JV3A 2RIXA 2FYBA 1TVYA 1R7YA 2P6WA 1I52A 1R82A 2X65A 4HO0A 4EE5A 4EEMA 3T7OA 5C1GA 3U2TA 2BO4A 3ZLKA 1QGSA 2RJ1A 1NMMB 1XZ6A 1ZJOA
chains in the Genus database with same CATH superfamily
3OAMA 4D0TA 5CMGX 3SXDA 2JCJA 5C4EA 2BO8A 2D7IA 2WGZA 1LZJA 1LZ7A 2GGQA 2RJ4A 2WVLA 4HG6A 5I1FA 1OMZA 1LZ0A 3SX8A 3SXGA 1G0RA 2BO7A 2W0WA 4NAKA 5J49A 1NQIB 4HO4A 1YROB 2AM3A 2RJ0A 3I0IX 2V0HA 2BO6A 1G8OA 2PA4A 3ZF8A 3DJ4A 4DDZA 5L6VA 1R7TA 4D48A 1ZJ2A 1H5TA 4M4KA 4JD0A 1KWSA 4G87A 1VPAA 3Q80A 2J0BA 5C8RA 2Y4KA 4B4BA 4Y9XA 3CKJA 2AESA 2JCKA 1W57A 1O0RA 1HJLA 1ZHJA 5FU0A 2JCLA 2PX7A 2WEEA 1NWGB 2C0NA 2X5SA 3OGZA 1ZJ0A 1R7XA 2OI6A 2WVMA 2VFZA 4MIXA 4NANA 5CMIA 1H5TB 4KRVA 1VICA 1H7LA 5EJZA 1ZI4A 5HS2A 1WSZA 2QH5A 2ZU9A 3E26A 5C36A 5C4FA 1E5KA 2V0JA 4ZDQA 3V0OA 1JV1A 4FRMA 3V0LA 5C4BA 3USRA 5C3DA 2AECA 3SXAA 3D8VA 2RIZA 1JYLA 1TW1A 2GGOA 2Y6PA 2X5ZA 4FRHA 2VS4A 1H5SB 3I0KA 4FRQA 2YQSA 1IIMA 4FIXA 4HO5A 1G9RA 1MP4A 1GQ9A 1FGXA 1H7HA 2I7BA 3O3PA 1YP3A 5FTSA 1FR9A 2A8UA 1HM8A 1VH1A 3R3IA 4KNXA 1H7QA 2O1HA 4K6RA 5EIYA 4Y7TA 2VS5A 4EE3A 5CQPA 2E3DA 3V91A 1H4EA 3JUKA 3D98A 2Y7AA 1NHEB 1FR8A 5FTVA 4CVHA 3I0LA 1G23A 4KT7A 1GWWA 2X60A 3SXCA 4M2BA 1ZI3A 2NXVA 4LW3A 2FFVA 4KQLA 4Y6NA 2FY7A 2Q4JA 3IOIA 2RJ7A 1R81A 1ZCYA 3U2XA 2XMEA 2YQCA 5IDTA 3V8YA 3ZLLA 1OMXA 1FZWA 1ZI1A 1SS9A 3I0HA 2V0LA 1EYRA 3U2VA 3SX7A 1MP5A 3SXBA 4KC4A 3KIAA 4Y64A 2YC3A 3OH3A 1H5SC 3U0XA 3I0CA 5IFYA 4CJ8A 2OEGA 3Q7UA 1H7EA 3T7NA 4FRDA 3SX5A 4C2SA 2V0IA 3V90A 4G3SA 4YS8A 3RMVA 1H3MA 4IRQA 1HV9A 4FQWA 1G97A 3OH2A 1G93A 3EE5A 4CJCA 1ZDGA 4J18A 3CKNA 4CJBA 2YESA 3ZGFA 3OH4A 2FYDB 2RJ8A 2Z86A 3I0FA 4MNDA 3K8DA 1ZIZA 3USQA 3PKQA 1INIA 1WT2A 4HO8A 1H7FA 1GQCA 3NGWA 1R7UA 1H5RB 4LW6A 3OKRA 1FOAA 2AGDA 1G95A 1QGQA 3I0JA 5D91A 1G3LA 4B4MA 4NAIA 5C38A 1VM8A 4HO2A 1MC3A 5CQLX 1GX4A 1W77A 1FXJA 2PGYA 1H5SA 3JTJA 1HM9A 4B42A 3OH1A 5EJ1A 1FO8A 4JISA 2V0KA 2D0JA 3PKPA 2MZBA 4B2XA 4KXOA 1ZJ1A 1ON6A 2VD4A 2Y4LA 3PNNA 4DECA 1G1LA 2AM5A 4D11C 5CMHA 2XWMA 4L41C 2XWLA 4P00A 5C4DA 5C47A 2YC5A 2AH9A 3U2UA 2WE9A 4MYBA 4D0ZA 2E8BA 1VH3A 4GBPA 4NALA 2FYAA 3OH0A 4EVWA 1S4OA 2I5EA 1H7GA 4AYLA 4KC2A 3POLA 5D92A 2VS3A 1WT0A 2RIYA 4M2AA 3BCVA 5C1HA 1GWVA 1V82A 1FXOA 5C1LA 1ZDFA 1Z90A 4Y7UA 2XMHA 5AJPA 3DUVA 4DE7A 1H4CA 2O1FA 4HCQA 4EE4A 4KPZA 1VGZA 3V0MA 4ECMA 3V8ZA 1ZJ3A 5L6SA 3CU0A 1S4NA 3ST8A 2P72A 4E1KA 2QKXA 4FRAA 2FFUA 4D11A 4FROA 1ZCVA 4Q7CA 3IOHA 4B3UA 4AAWA 5C49A 4BMAA 2PGVA 2DPWA 4AYJA 2AE7A 4B2WA 3V0QA 3CKVA 5C3AA 5FUHA 5C4CA 3D5NA 4Y7GA 1FGGA 4ASJA 4IRPA 3U0YA 1PZTA 4KC1A 1VZUA 4O6NA 3SXEA 2ZU7A 1WT1A 5CQOA 2APCA 2J0AA 1TZFA 1IINA 3OC9A 4FCUA 5FU8A 4G3QA 5C48A 1JVDA 1WVCA 4FREA 2XWNA 1GX0A 1JYKA 1FWYA 2RJ9A 1VZTA 2AM4A 3TQDA 2A8WA 3FWWA 2O1GA 1V84A 1HM0A 5IDSA 5FYEA 1O7QA 3CGXA 1H5RA 1O23B 2OI5A 1NKHB 1O7OA 1JVGA 3QVBA 4EEGA 2RJ6A 2VK9A 2VSIA 5JQQA 3TZTA 3RMWA 1LL3A 3SX3A 4BQHA 5AJOA 4HO6A 4HO9A 3DK5A 3T7MA 1VGWA 4O6MA 1G2VA 4FRPA 1XHBA 4HO3A 3F1CA 4FRLA 3HL3A 2ICXA 5CMJA 2YCMA 2WVKA 1WT3A 1YP2A 3ZGGA 1QWJA 2OEFA 2QGIA 4FCEA 1PZYB 1S4PA 1ZCTA 2D7RA 2Z87A 5DDVA 1V83A 1ZCUA 2JCOA 3Q4SA 1MP3A 3N9WA 1FO9A 1LL0A 3JUJA 4M28A 4ASYA 4Y62A 1R80A 3K8EA 3RSBA 4Y6UA 1HJJA 1ZI5A 1LVWA 2VXLA 4G3PA 1W55A 3LW6A 2VXMA 1H5SD 4UEGA 1FRWA 1VZXA 5BXCA 5CMFX 4R7PA 4B5BA 1LL2A 1H7TA 2UX8A 5C3BA 2FYCB 3E25A 4KPXA 1FG5N 4Y7VA 2YQJA 3V0PA 1QG8A 2ZU8A 2VSHA 3I0GA 1NF5B 2OI7A 1H4DA 4Y7FA 4AC3A 1K4VA 1ON8A 5DDTA 4B4GA 1VGTA 3GUEA 4KNRA 2Y4JA 4Y63A 5CQMX 3FOQA 3R2WA 1LZIA 2P73A 2RITA 4HOCA 1YP4A 2WAWA 5AJNA 3I0EA 1VGUA 4EEOA 3F1YA 5FV9A 2I5KA 4ARWA 1INJA 3SPTA 4P02A 2W0VA 3IOJA 5CQNX 4EEAA 2YQHA 4XWIA 2RJ5A 3U2WA 3CKQA 1R7VA 3BRKX 1GA8A 1ZJPA 3CKOA 1TW5A 3I0DA 2ICYA 1EZIA 2Y4MA 4FRBA 3V0NA 2CU2A 1OQMB 1JV3A 2RIXA 2FYBA 4FIYA 1TVYA 1R7YA 2P6WA 1I52A 1R82A 2X65A 4HO0A 4EE5A 4EEMA 3T7OA 5C1GA 3U2TA 2BO4A 3ZLKA 1QGSA 2RJ1A 1NMMB 1XZ6A 1ZJOA
chains in the Genus database with same CATH topology
3OAMA 4D0TA 5CMGX 3SXDA 2JCJA 5C4EA 2BO8A 2D7IA 2WGZA 1LZJA 1LZ7A 2GGQA 2RJ4A 2WVLA 4HG6A 5I1FA 1OMZA 1LZ0A 3SX8A 3SXGA 1G0RA 2BO7A 2W0WA 4NAKA 5J49A 1NQIB 4HO4A 1YROB 2AM3A 2RJ0A 3I0IX 2V0HA 2BO6A 1G8OA 2PA4A 3ZF8A 3DJ4A 4DDZA 5L6VA 1R7TA 4D48A 1ZJ2A 1H5TA 4M4KA 4JD0A 1KWSA 4G87A 1VPAA 3Q80A 2J0BA 5C8RA 2Y4KA 4B4BA 4Y9XA 3CKJA 2AESA 2JCKA 1W57A 1O0RA 1HJLA 1ZHJA 5FU0A 2JCLA 2PX7A 2WEEA 1NWGB 2C0NA 2X5SA 3OGZA 1ZJ0A 1R7XA 2OI6A 2WVMA 2VFZA 4MIXA 4NANA 5CMIA 1H5TB 4KRVA 1VICA 1H7LA 5EJZA 1ZI4A 5HS2A 1WSZA 2QH5A 2ZU9A 3E26A 5C36A 5C4FA 1E5KA 2V0JA 4ZDQA 3V0OA 1JV1A 4FRMA 3V0LA 5C4BA 3USRA 5C3DA 2AECA 3SXAA 3D8VA 2RIZA 1JYLA 1TW1A 2GGOA 2Y6PA 2X5ZA 4FRHA 2VS4A 1H5SB 3I0KA 4FRQA 2YQSA 1IIMA 4FIXA 4HO5A 1G9RA 1MP4A 1GQ9A 1FGXA 1H7HA 2I7BA 3O3PA 1YP3A 5FTSA 1FR9A 2A8UA 1HM8A 1VH1A 3R3IA 4KNXA 1H7QA 2O1HA 4K6RA 5EIYA 4Y7TA 2VS5A 4EE3A 5CQPA 2E3DA 3V91A 1H4EA 3JUKA 3D98A 2Y7AA 1NHEB 1FR8A 5FTVA 4CVHA 3I0LA 1G23A 4KT7A 1GWWA 2X60A 3SXCA 4M2BA 1ZI3A 2NXVA 4LW3A 2FFVA 4KQLA 4Y6NA 2FY7A 2Q4JA 3IOIA 2RJ7A 1R81A 1ZCYA 3U2XA 2XMEA 2YQCA 5IDTA 3V8YA 3ZLLA 1OMXA 1FZWA 1ZI1A 1SS9A 3I0HA 2V0LA 1EYRA 3U2VA 3SX7A 1MP5A 3SXBA 4KC4A 3KIAA 4Y64A 2YC3A 3OH3A 1H5SC 3U0XA 3I0CA 5IFYA 4CJ8A 2OEGA 3Q7UA 1H7EA 3T7NA 4FRDA 3SX5A 4C2SA 2V0IA 3V90A 4G3SA 4YS8A 3RMVA 1H3MA 4IRQA 1HV9A 4FQWA 1G97A 3OH2A 1G93A 3EE5A 4CJCA 1ZDGA 4J18A 3CKNA 4CJBA 2YESA 3ZGFA 3OH4A 2FYDB 2RJ8A 2Z86A 3I0FA 4MNDA 3K8DA 1ZIZA 3USQA 3PKQA 1INIA 1WT2A 4HO8A 1H7FA 1GQCA 3NGWA 1R7UA 1H5RB 4LW6A 3OKRA 1FOAA 2AGDA 1G95A 1QGQA 3I0JA 5D91A 1G3LA 4B4MA 4NAIA 5C38A 1VM8A 4HO2A 1MC3A 5CQLX 1GX4A 1W77A 1FXJA 2PGYA 1H5SA 3JTJA 1HM9A 4B42A 3OH1A 5EJ1A 1FO8A 4JISA 2V0KA 2D0JA 3PKPA 2MZBA 4B2XA 4KXOA 1ZJ1A 1ON6A 2VD4A 2Y4LA 3PNNA 4DECA 1G1LA 2AM5A 4D11C 5CMHA 2XWMA 4L41C 2XWLA 4P00A 5C4DA 5C47A 2YC5A 2AH9A 3U2UA 2WE9A 4MYBA 4D0ZA 2E8BA 1VH3A 4GBPA 4NALA 2FYAA 3OH0A 4EVWA 1S4OA 2I5EA 1H7GA 4AYLA 4KC2A 3POLA 5D92A 2VS3A 1WT0A 2RIYA 4M2AA 3BCVA 5C1HA 1GWVA 1V82A 1FXOA 5C1LA 1ZDFA 1Z90A 4Y7UA 2XMHA 5AJPA 3DUVA 4DE7A 1H4CA 2O1FA 4HCQA 4EE4A 4KPZA 1VGZA 3V0MA 4ECMA 3V8ZA 1ZJ3A 5L6SA 3CU0A 1S4NA 3ST8A 2P72A 4E1KA 2QKXA 4FRAA 2FFUA 4D11A 4FROA 1ZCVA 4Q7CA 3IOHA 4B3UA 4AAWA 5C49A 4BMAA 2PGVA 2DPWA 4AYJA 2AE7A 4B2WA 3V0QA 3CKVA 5C3AA 5FUHA 5C4CA 3D5NA 4Y7GA 1FGGA 4ASJA 4IRPA 3U0YA 1PZTA 4KC1A 1VZUA 4O6NA 3SXEA 2ZU7A 1WT1A 5CQOA 2APCA 2J0AA 1TZFA 1IINA 3OC9A 4FCUA 5FU8A 4G3QA 5C48A 1JVDA 1WVCA 4FREA 2XWNA 1GX0A 1JYKA 1FWYA 2RJ9A 1VZTA 2AM4A 3TQDA 2A8WA 3FWWA 2O1GA 1V84A 1HM0A 5IDSA 5FYEA 1O7QA 3CGXA 1H5RA 1O23B 2OI5A 1NKHB 1O7OA 1JVGA 3QVBA 4EEGA 2RJ6A 2VK9A 2VSIA 5JQQA 3TZTA 3RMWA 1LL3A 3SX3A 4BQHA 5AJOA 4HO6A 4HO9A 3DK5A 3T7MA 1VGWA 4O6MA 1G2VA 4FRPA 1XHBA 4HO3A 3F1CA 4FRLA 3HL3A 2ICXA 5CMJA 2YCMA 2WVKA 1WT3A 1YP2A 3ZGGA 1QWJA 2OEFA 2QGIA 4FCEA 1PZYB 1S4PA 1ZCTA 2D7RA 2Z87A 5DDVA 1V83A 1ZCUA 2JCOA 3Q4SA 1MP3A 3N9WA 1FO9A 1LL0A 3JUJA 4M28A 4ASYA 4Y62A 1R80A 3K8EA 3RSBA 4Y6UA 1HJJA 1ZI5A 1LVWA 2VXLA 4G3PA 1W55A 3LW6A 2VXMA 1H5SD 4UEGA 1FRWA 1VZXA 5BXCA 5CMFX 4R7PA 4B5BA 1LL2A 1H7TA 2UX8A 5C3BA 2FYCB 3E25A 4KPXA 1FG5N 4Y7VA 2YQJA 3V0PA 1QG8A 2ZU8A 2VSHA 3I0GA 1NF5B 2OI7A 1H4DA 4Y7FA 4AC3A 1K4VA 1ON8A 5DDTA 4B4GA 1VGTA 3GUEA 4KNRA 2Y4JA 4Y63A 5CQMX 3FOQA 3R2WA 1LZIA 2P73A 2RITA 4HOCA 1YP4A 2WAWA 5AJNA 3I0EA 1VGUA 4EEOA 3F1YA 5FV9A 2I5KA 4ARWA 1INJA 3SPTA 4P02A 2W0VA 3IOJA 5CQNX 4EEAA 2YQHA 4XWIA 2RJ5A 3U2WA 3CKQA 1R7VA 3BRKX 1GA8A 1ZJPA 3CKOA 1TW5A 3I0DA 2ICYA 1EZIA 2Y4MA 4FRBA 3V0NA 2CU2A 1OQMB 1JV3A 2RIXA 2FYBA 4FIYA 1TVYA 1R7YA 2P6WA 1I52A 1R82A 2X65A 4HO0A 4EE5A 4EEMA 3T7OA 5C1GA 3U2TA 2BO4A 3ZLKA 1QGSA 2RJ1A 1NMMB 1XZ6A 1ZJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAM A;  4D0T A;  5CMG X;  3SXD A;  2JCJ A;  5C4E A;  2BO8 A;  2D7I A;  2WGZ A;  1LZJ A;  1LZ7 A;  2GGQ A;  2RJ4 A;  2WVL A;  4HG6 A;  5I1F A;  1OMZ A;  1LZ0 A;  3SX8 A;  3SXG A;  1G0R A;  2BO7 A;  2W0W A;  4NAK A;  5J49 A;  1NQI B;  4HO4 A;  1YRO B;  2AM3 A;  2RJ0 A;  3I0I X;  2V0H A;  2BO6 A;  1G8O A;  2PA4 A;  3ZF8 A;  3DJ4 A;  4DDZ A;  5L6V A;  1R7T A;  4D48 A;  1ZJ2 A;  1H5T A;  4M4K A;  4JD0 A;  1KWS A;  4G87 A;  1VPA A;  3Q80 A;  5C8R A;  2Y4K A;  4B4B A;  4Y9X A;  3CKJ A;  2AES A;  2JCK A;  1W57 A;  1O0R A;  1HJL A;  1ZHJ A;  5FU0 A;  2JCL A;  2PX7 A;  2WEE A;  1NWG B;  2X5S A;  3OGZ A;  1ZJ0 A;  1R7X A;  2OI6 A;  2WVM A;  2VFZ A;  4NAN A;  5CMI A;  1H5T B;  4KRV A;  1VIC A;  1H7L A;  5EJZ A;  1ZI4 A;  5HS2 A;  1WSZ A;  2QH5 A;  2ZU9 A;  3E26 A;  5C36 A;  5C4F A;  1E5K A;  2V0J A;  4ZDQ A;  3V0O A;  1JV1 A;  4FRM A;  3V0L A;  5C4B A;  3USR A;  5C3D A;  2AEC A;  3SXA A;  3D8V A;  2RIZ A;  1JYL A;  1TW1 A;  2GGO A;  2Y6P A;  2X5Z A;  4FRH A;  2VS4 A;  1H5S B;  3I0K A;  4FRQ A;  2YQS A;  1IIM A;  4HO5 A;  1G9R A;  1MP4 A;  1GQ9 A;  1FGX A;  1H7H A;  2I7B A;  3O3P A;  1YP3 A;  5FTS A;  1FR9 A;  2A8U A;  1HM8 A;  1VH1 A;  3R3I A;  4KNX A;  1H7Q A;  2O1H A;  4K6R A;  5EIY A;  4Y7T A;  2VS5 A;  4EE3 A;  5CQP A;  2E3D A;  3V91 A;  1H4E A;  3JUK A;  3D98 A;  2Y7A A;  1NHE B;  1FR8 A;  5FTV A;  4CVH A;  3I0L A;  1G23 A;  4KT7 A;  1GWW A;  2X60 A;  3SXC A;  4M2B A;  1ZI3 A;  2NXV A;  4LW3 A;  2FFV A;  4KQL A;  4Y6N A;  2FY7 A;  2Q4J A;  3IOI A;  2RJ7 A;  1R81 A;  1ZCY A;  3U2X A;  2XME A;  2YQC A;  5IDT A;  3V8Y A;  3ZLL A;  1OMX A;  1FZW A;  1ZI1 A;  1SS9 A;  3I0H A;  2V0L A;  1EYR A;  3U2V A;  3SX7 A;  1MP5 A;  3SXB A;  4KC4 A;  3KIA A;  4Y64 A;  2YC3 A;  3OH3 A;  1H5S C;  3U0X A;  3I0C A;  5IFY A;  4CJ8 A;  2OEG A;  3Q7U A;  1H7E A;  3T7N A;  4FRD A;  3SX5 A;  4C2S A;  2V0I A;  3V90 A;  4G3S A;  4YS8 A;  3RMV A;  1H3M A;  4IRQ A;  1HV9 A;  4FQW A;  1G97 A;  3OH2 A;  1G93 A;  3EE5 A;  4CJC A;  1ZDG A;  4J18 A;  3CKN A;  4CJB A;  2YES A;  3ZGF A;  3OH4 A;  2FYD B;  2RJ8 A;  2Z86 A;  3I0F A;  4MND A;  3K8D A;  1ZIZ A;  3USQ A;  3PKQ A;  1INI A;  1WT2 A;  4HO8 A;  1H7F A;  1GQC A;  3NGW A;  1R7U A;  1H5R B;  4LW6 A;  3OKR A;  1FOA A;  2AGD A;  1G95 A;  1QGQ A;  3I0J A;  4B4M A;  1G3L A;  5C38 A;  4NAI A;  1VM8 A;  4HO2 A;  1MC3 A;  5CQL X;  1GX4 A;  1W77 A;  1FXJ A;  2PGY A;  1H5S A;  3JTJ A;  1HM9 A;  4B42 A;  3OH1 A;  5EJ1 A;  1FO8 A;  4JIS A;  2V0K A;  2D0J A;  3PKP A;  2MZB A;  4B2X A;  4KXO A;  1ZJ1 A;  1ON6 A;  2VD4 A;  2Y4L A;  3PNN A;  4DEC A;  1G1L A;  2AM5 A;  4D11 C;  5CMH A;  2XWM A;  4L41 C;  2XWL A;  4P00 A;  5C4D A;  5C47 A;  2YC5 A;  2AH9 A;  3U2U A;  2WE9 A;  4MYB A;  4D0Z A;  2E8B A;  1VH3 A;  4GBP A;  4NAL A;  2FYA A;  3OH0 A;  4EVW A;  1S4O A;  2I5E A;  1H7G A;  4AYL A;  4KC2 A;  3POL A;  2VS3 A;  1WT0 A;  2RIY A;  4M2A A;  3BCV A;  5C1H A;  1GWV A;  1V82 A;  1FXO A;  5C1L A;  1ZDF A;  1Z90 A;  4Y7U A;  2XMH A;  5AJP A;  3DUV A;  4DE7 A;  1H4C A;  2O1F A;  4HCQ A;  4EE4 A;  4KPZ A;  1VGZ A;  3V0M A;  4ECM A;  3V8Z A;  1ZJ3 A;  5L6S A;  3CU0 A;  1S4N A;  3ST8 A;  2P72 A;  4E1K A;  2QKX A;  4FRA A;  2FFU A;  4D11 A;  4FRO A;  1ZCV A;  3IOH A;  4B3U A;  4AAW A;  5C49 A;  4BMA A;  2PGV A;  2DPW A;  4AYJ A;  2AE7 A;  4B2W A;  3V0Q A;  3CKV A;  5C3A A;  5FUH A;  5C4C A;  3D5N A;  4Y7G A;  1FGG A;  4ASJ A;  4IRP A;  3U0Y A;  1PZT A;  4KC1 A;  1VZU A;  3SXE A;  2ZU7 A;  1WT1 A;  5CQO A;  2APC A;  5FU8 A;  1TZF A;  1IIN A;  3OC9 A;  4FCU A;  4G3Q A;  5C48 A;  1JVD A;  1WVC A;  4FRE A;  2XWN A;  1GX0 A;  1JYK A;  1FWY A;  2RJ9 A;  1VZT A;  2AM4 A;  3TQD A;  2A8W A;  3FWW A;  2O1G A;  1V84 A;  1HM0 A;  5IDS A;  5FYE A;  1O7Q A;  3CGX A;  1H5R A;  1O23 B;  2OI5 A;  1NKH B;  1O7O A;  1JVG A;  3QVB A;  4EEG A;  2RJ6 A;  2VSI A;  5JQQ A;  3TZT A;  3RMW A;  1LL3 A;  3SX3 A;  4BQH A;  5AJO A;  4HO6 A;  4HO9 A;  3DK5 A;  3T7M A;  1VGW A;  1G2V A;  4FRP A;  1XHB A;  4HO3 A;  3F1C A;  4FRL A;  3HL3 A;  2ICX A;  5CMJ A;  2YCM A;  2WVK A;  1WT3 A;  1YP2 A;  3ZGG A;  1QWJ A;  2OEF A;  2QGI A;  4FCE A;  1PZY B;  1S4P A;  1ZCT A;  2D7R A;  2Z87 A;  5DDV A;  1V83 A;  1ZCU A;  2JCO A;  3Q4S A;  1MP3 A;  3N9W A;  1FO9 A;  1LL0 A;  3JUJ A;  4M28 A;  4ASY A;  4Y62 A;  1R80 A;  3K8E A;  3RSB A;  4Y6U A;  1HJJ A;  1ZI5 A;  1LVW A;  2VXL A;  4G3P A;  1W55 A;  3LW6 A;  2VXM A;  1H5S D;  4UEG A;  1FRW A;  1VZX A;  5BXC A;  5CMF X;  4R7P A;  4B5B A;  1LL2 A;  1H7T A;  2UX8 A;  5C3B A;  2FYC B;  3E25 A;  4KPX A;  1FG5 N;  4Y7V A;  2YQJ A;  3V0P A;  1QG8 A;  2ZU8 A;  2VSH A;  3I0G A;  1NF5 B;  2OI7 A;  1H4D A;  4Y7F A;  4AC3 A;  1K4V A;  1ON8 A;  5DDT A;  4B4G A;  1VGT A;  3GUE A;  4KNR A;  2Y4J A;  4Y63 A;  5CQM X;  3FOQ A;  3R2W A;  1LZI A;  2P73 A;  2RIT A;  4HOC A;  1YP4 A;  2WAW A;  5AJN A;  3I0E A;  1VGU A;  4EEO A;  3F1Y A;  5FV9 A;  2I5K A;  4ARW A;  1INJ A;  3SPT A;  4P02 A;  2W0V A;  3IOJ A;  5CQN X;  4EEA A;  2YQH A;  4XWI A;  2RJ5 A;  3U2W A;  3CKQ A;  1R7V A;  3BRK X;  1GA8 A;  1ZJP A;  3CKO A;  1TW5 A;  3I0D A;  2ICY A;  1EZI A;  2Y4M A;  4FRB A;  3V0N A;  2CU2 A;  1OQM B;  1JV3 A;  2RIX A;  2FYB A;  1TVY A;  1R7Y A;  2P6W A;  1I52 A;  1R82 A;  2X65 A;  4HO0 A;  4EE5 A;  4EEM A;  3T7O A;  5C1G A;  3U2T A;  2BO4 A;  3ZLK A;  1QGS A;  2RJ1 A;  1NMM B;  1XZ6 A;  1ZJO A; 
#chains in the Genus database with same CATH topology
 3OAM A;  4D0T A;  5CMG X;  3SXD A;  2JCJ A;  5C4E A;  2BO8 A;  2D7I A;  2WGZ A;  1LZJ A;  1LZ7 A;  2GGQ A;  2RJ4 A;  2WVL A;  4HG6 A;  5I1F A;  1OMZ A;  1LZ0 A;  3SX8 A;  3SXG A;  1G0R A;  2BO7 A;  2W0W A;  4NAK A;  5J49 A;  1NQI B;  4HO4 A;  1YRO B;  2AM3 A;  2RJ0 A;  3I0I X;  2V0H A;  2BO6 A;  1G8O A;  2PA4 A;  3ZF8 A;  3DJ4 A;  4DDZ A;  5L6V A;  1R7T A;  4D48 A;  1ZJ2 A;  1H5T A;  4M4K A;  4JD0 A;  1KWS A;  4G87 A;  1VPA A;  3Q80 A;  2J0B A;  5C8R A;  2Y4K A;  4B4B A;  4Y9X A;  3CKJ A;  2AES A;  2JCK A;  1W57 A;  1O0R A;  1HJL A;  1ZHJ A;  5FU0 A;  2JCL A;  2PX7 A;  2WEE A;  1NWG B;  2C0N A;  2X5S A;  3OGZ A;  1ZJ0 A;  1R7X A;  2OI6 A;  2WVM A;  2VFZ A;  4MIX A;  4NAN A;  5CMI A;  1H5T B;  4KRV A;  1VIC A;  1H7L A;  5EJZ A;  1ZI4 A;  5HS2 A;  1WSZ A;  2QH5 A;  2ZU9 A;  3E26 A;  5C36 A;  5C4F A;  1E5K A;  2V0J A;  4ZDQ A;  3V0O A;  1JV1 A;  4FRM A;  3V0L A;  5C4B A;  3USR A;  5C3D A;  2AEC A;  3SXA A;  3D8V A;  2RIZ A;  1JYL A;  1TW1 A;  2GGO A;  2Y6P A;  2X5Z A;  4FRH A;  2VS4 A;  1H5S B;  3I0K A;  4FRQ A;  2YQS A;  1IIM A;  4FIX A;  4HO5 A;  1G9R A;  1MP4 A;  1GQ9 A;  1FGX A;  1H7H A;  2I7B A;  3O3P A;  1YP3 A;  5FTS A;  1FR9 A;  2A8U A;  1HM8 A;  1VH1 A;  3R3I A;  4KNX A;  1H7Q A;  2O1H A;  4K6R A;  5EIY A;  4Y7T A;  2VS5 A;  4EE3 A;  5CQP A;  2E3D A;  3V91 A;  1H4E A;  3JUK A;  3D98 A;  2Y7A A;  1NHE B;  1FR8 A;  5FTV A;  4CVH A;  3I0L A;  1G23 A;  4KT7 A;  1GWW A;  2X60 A;  3SXC A;  4M2B A;  1ZI3 A;  2NXV A;  4LW3 A;  2FFV A;  4KQL A;  4Y6N A;  2FY7 A;  2Q4J A;  3IOI A;  2RJ7 A;  1R81 A;  1ZCY A;  3U2X A;  2XME A;  2YQC A;  5IDT A;  3V8Y A;  3ZLL A;  1OMX A;  1FZW A;  1ZI1 A;  1SS9 A;  3I0H A;  2V0L A;  1EYR A;  3U2V A;  3SX7 A;  1MP5 A;  3SXB A;  4KC4 A;  3KIA A;  4Y64 A;  2YC3 A;  3OH3 A;  1H5S C;  3U0X A;  3I0C A;  5IFY A;  4CJ8 A;  2OEG A;  3Q7U A;  1H7E A;  3T7N A;  4FRD A;  3SX5 A;  4C2S A;  2V0I A;  3V90 A;  4G3S A;  4YS8 A;  3RMV A;  1H3M A;  4IRQ A;  1HV9 A;  4FQW A;  1G97 A;  3OH2 A;  1G93 A;  3EE5 A;  4CJC A;  1ZDG A;  4J18 A;  3CKN A;  4CJB A;  2YES A;  3ZGF A;  3OH4 A;  2FYD B;  2RJ8 A;  2Z86 A;  3I0F A;  4MND A;  3K8D A;  1ZIZ A;  3USQ A;  3PKQ A;  1INI A;  1WT2 A;  4HO8 A;  1H7F A;  1GQC A;  3NGW A;  1R7U A;  1H5R B;  4LW6 A;  3OKR A;  1FOA A;  2AGD A;  1G95 A;  1QGQ A;  3I0J A;  5D91 A;  1G3L A;  4B4M A;  4NAI A;  5C38 A;  1VM8 A;  4HO2 A;  1MC3 A;  5CQL X;  1GX4 A;  1W77 A;  1FXJ A;  2PGY A;  1H5S A;  3JTJ A;  1HM9 A;  4B42 A;  3OH1 A;  5EJ1 A;  1FO8 A;  4JIS A;  2V0K A;  2D0J A;  3PKP A;  2MZB A;  4B2X A;  4KXO A;  1ZJ1 A;  1ON6 A;  2VD4 A;  2Y4L A;  3PNN A;  4DEC A;  1G1L A;  2AM5 A;  4D11 C;  5CMH A;  2XWM A;  4L41 C;  2XWL A;  4P00 A;  5C4D A;  5C47 A;  2YC5 A;  2AH9 A;  3U2U A;  2WE9 A;  4MYB A;  4D0Z A;  2E8B A;  1VH3 A;  4GBP A;  4NAL A;  2FYA A;  3OH0 A;  4EVW A;  1S4O A;  2I5E A;  1H7G A;  4AYL A;  4KC2 A;  3POL A;  5D92 A;  2VS3 A;  1WT0 A;  2RIY A;  4M2A A;  3BCV A;  5C1H A;  1GWV A;  1V82 A;  1FXO A;  5C1L A;  1ZDF A;  1Z90 A;  4Y7U A;  2XMH A;  5AJP A;  3DUV A;  4DE7 A;  1H4C A;  2O1F A;  4HCQ A;  4EE4 A;  4KPZ A;  1VGZ A;  3V0M A;  4ECM A;  3V8Z A;  1ZJ3 A;  5L6S A;  3CU0 A;  1S4N A;  3ST8 A;  2P72 A;  4E1K A;  2QKX A;  4FRA A;  2FFU A;  4D11 A;  4FRO A;  1ZCV A;  4Q7C A;  3IOH A;  4B3U A;  4AAW A;  5C49 A;  4BMA A;  2PGV A;  2DPW A;  4AYJ A;  2AE7 A;  4B2W A;  3V0Q A;  3CKV A;  5C3A A;  5FUH A;  5C4C A;  3D5N A;  4Y7G A;  1FGG A;  4ASJ A;  4IRP A;  3U0Y A;  1PZT A;  4KC1 A;  1VZU A;  4O6N A;  3SXE A;  2ZU7 A;  1WT1 A;  5CQO A;  2APC A;  2J0A A;  1TZF A;  1IIN A;  3OC9 A;  4FCU A;  5FU8 A;  4G3Q A;  5C48 A;  1JVD A;  1WVC A;  4FRE A;  2XWN A;  1GX0 A;  1JYK A;  1FWY A;  2RJ9 A;  1VZT A;  2AM4 A;  3TQD A;  2A8W A;  3FWW A;  2O1G A;  1V84 A;  1HM0 A;  5IDS A;  5FYE A;  1O7Q A;  3CGX A;  1H5R A;  1O23 B;  2OI5 A;  1NKH B;  1O7O A;  1JVG A;  3QVB A;  4EEG A;  2RJ6 A;  2VK9 A;  2VSI A;  5JQQ A;  3TZT A;  3RMW A;  1LL3 A;  3SX3 A;  4BQH A;  5AJO A;  4HO6 A;  4HO9 A;  3DK5 A;  3T7M A;  1VGW A;  4O6M A;  1G2V A;  4FRP A;  1XHB A;  4HO3 A;  3F1C A;  4FRL A;  3HL3 A;  2ICX A;  5CMJ A;  2YCM A;  2WVK A;  1WT3 A;  1YP2 A;  3ZGG A;  1QWJ A;  2OEF A;  2QGI A;  4FCE A;  1PZY B;  1S4P A;  1ZCT A;  2D7R A;  2Z87 A;  5DDV A;  1V83 A;  1ZCU A;  2JCO A;  3Q4S A;  1MP3 A;  3N9W A;  1FO9 A;  1LL0 A;  3JUJ A;  4M28 A;  4ASY A;  4Y62 A;  1R80 A;  3K8E A;  3RSB A;  4Y6U A;  1HJJ A;  1ZI5 A;  1LVW A;  2VXL A;  4G3P A;  1W55 A;  3LW6 A;  2VXM A;  1H5S D;  4UEG A;  1FRW A;  1VZX A;  5BXC A;  5CMF X;  4R7P A;  4B5B A;  1LL2 A;  1H7T A;  2UX8 A;  5C3B A;  2FYC B;  3E25 A;  4KPX A;  1FG5 N;  4Y7V A;  2YQJ A;  3V0P A;  1QG8 A;  2ZU8 A;  2VSH A;  3I0G A;  1NF5 B;  2OI7 A;  1H4D A;  4Y7F A;  4AC3 A;  1K4V A;  1ON8 A;  5DDT A;  4B4G A;  1VGT A;  3GUE A;  4KNR A;  2Y4J A;  4Y63 A;  5CQM X;  3FOQ A;  3R2W A;  1LZI A;  2P73 A;  2RIT A;  4HOC A;  1YP4 A;  2WAW A;  5AJN A;  3I0E A;  1VGU A;  4EEO A;  3F1Y A;  5FV9 A;  2I5K A;  4ARW A;  1INJ A;  3SPT A;  4P02 A;  2W0V A;  3IOJ A;  5CQN X;  4EEA A;  2YQH A;  4XWI A;  2RJ5 A;  3U2W A;  3CKQ A;  1R7V A;  3BRK X;  1GA8 A;  1ZJP A;  3CKO A;  1TW5 A;  3I0D A;  2ICY A;  1EZI A;  2Y4M A;  4FRB A;  3V0N A;  2CU2 A;  1OQM B;  1JV3 A;  2RIX A;  2FYB A;  4FIY A;  1TVY A;  1R7Y A;  2P6W A;  1I52 A;  1R82 A;  2X65 A;  4HO0 A;  4EE5 A;  4EEM A;  3T7O A;  5C1G A;  3U2T A;  2BO4 A;  3ZLK A;  1QGS A;  2RJ1 A;  1NMM B;  1XZ6 A;  1ZJO A; 
#chains in the Genus database with same CATH homology
 3OAM A;  4D0T A;  5CMG X;  3SXD A;  2JCJ A;  5C4E A;  2BO8 A;  2D7I A;  2WGZ A;  1LZJ A;  1LZ7 A;  2GGQ A;  2RJ4 A;  2WVL A;  4HG6 A;  5I1F A;  1OMZ A;  1LZ0 A;  3SX8 A;  3SXG A;  1G0R A;  2BO7 A;  2W0W A;  4NAK A;  5J49 A;  1NQI B;  4HO4 A;  1YRO B;  2AM3 A;  2RJ0 A;  3I0I X;  2V0H A;  2BO6 A;  1G8O A;  2PA4 A;  3ZF8 A;  3DJ4 A;  4DDZ A;  5L6V A;  1R7T A;  4D48 A;  1ZJ2 A;  1H5T A;  4M4K A;  4JD0 A;  1KWS A;  4G87 A;  1VPA A;  3Q80 A;  2J0B A;  5C8R A;  2Y4K A;  4B4B A;  4Y9X A;  3CKJ A;  2AES A;  2JCK A;  1W57 A;  1O0R A;  1HJL A;  1ZHJ A;  5FU0 A;  2JCL A;  2PX7 A;  2WEE A;  1NWG B;  2C0N A;  2X5S A;  3OGZ A;  1ZJ0 A;  1R7X A;  2OI6 A;  2WVM A;  2VFZ A;  4MIX A;  4NAN A;  5CMI A;  1H5T B;  4KRV A;  1VIC A;  1H7L A;  5EJZ A;  1ZI4 A;  5HS2 A;  1WSZ A;  2QH5 A;  2ZU9 A;  3E26 A;  5C36 A;  5C4F A;  1E5K A;  2V0J A;  4ZDQ A;  3V0O A;  1JV1 A;  4FRM A;  3V0L A;  5C4B A;  3USR A;  5C3D A;  2AEC A;  3SXA A;  3D8V A;  2RIZ A;  1JYL A;  1TW1 A;  2GGO A;  2Y6P A;  2X5Z A;  4FRH A;  2VS4 A;  1H5S B;  3I0K A;  4FRQ A;  2YQS A;  1IIM A;  4FIX A;  4HO5 A;  1G9R A;  1MP4 A;  1GQ9 A;  1FGX A;  1H7H A;  2I7B A;  3O3P A;  1YP3 A;  5FTS A;  1FR9 A;  2A8U A;  1HM8 A;  1VH1 A;  3R3I A;  4KNX A;  1H7Q A;  2O1H A;  4K6R A;  5EIY A;  4Y7T A;  2VS5 A;  4EE3 A;  5CQP A;  2E3D A;  3V91 A;  1H4E A;  3JUK A;  3D98 A;  2Y7A A;  1NHE B;  1FR8 A;  5FTV A;  4CVH A;  3I0L A;  1G23 A;  4KT7 A;  1GWW A;  2X60 A;  3SXC A;  4M2B A;  1ZI3 A;  2NXV A;  4LW3 A;  2FFV A;  4KQL A;  4Y6N A;  2FY7 A;  2Q4J A;  3IOI A;  2RJ7 A;  1R81 A;  1ZCY A;  3U2X A;  2XME A;  2YQC A;  5IDT A;  3V8Y A;  3ZLL A;  1OMX A;  1FZW A;  1ZI1 A;  1SS9 A;  3I0H A;  2V0L A;  1EYR A;  3U2V A;  3SX7 A;  1MP5 A;  3SXB A;  4KC4 A;  3KIA A;  4Y64 A;  2YC3 A;  3OH3 A;  1H5S C;  3U0X A;  3I0C A;  5IFY A;  4CJ8 A;  2OEG A;  3Q7U A;  1H7E A;  3T7N A;  4FRD A;  3SX5 A;  4C2S A;  2V0I A;  3V90 A;  4G3S A;  4YS8 A;  3RMV A;  1H3M A;  4IRQ A;  1HV9 A;  4FQW A;  1G97 A;  3OH2 A;  1G93 A;  3EE5 A;  4CJC A;  1ZDG A;  4J18 A;  3CKN A;  4CJB A;  2YES A;  3ZGF A;  3OH4 A;  2FYD B;  2RJ8 A;  2Z86 A;  3I0F A;  4MND A;  3K8D A;  1ZIZ A;  3USQ A;  3PKQ A;  1INI A;  1WT2 A;  4HO8 A;  1H7F A;  1GQC A;  3NGW A;  1R7U A;  1H5R B;  4LW6 A;  3OKR A;  1FOA A;  2AGD A;  1G95 A;  1QGQ A;  3I0J A;  5D91 A;  1G3L A;  4B4M A;  4NAI A;  5C38 A;  1VM8 A;  4HO2 A;  1MC3 A;  5CQL X;  1GX4 A;  1W77 A;  1FXJ A;  2PGY A;  1H5S A;  3JTJ A;  1HM9 A;  4B42 A;  3OH1 A;  5EJ1 A;  1FO8 A;  4JIS A;  2V0K A;  2D0J A;  3PKP A;  2MZB A;  4B2X A;  4KXO A;  1ZJ1 A;  1ON6 A;  2VD4 A;  2Y4L A;  3PNN A;  4DEC A;  1G1L A;  2AM5 A;  4D11 C;  5CMH A;  2XWM A;  4L41 C;  2XWL A;  4P00 A;  5C4D A;  5C47 A;  2YC5 A;  2AH9 A;  3U2U A;  2WE9 A;  4MYB A;  4D0Z A;  2E8B A;  1VH3 A;  4GBP A;  4NAL A;  2FYA A;  3OH0 A;  4EVW A;  1S4O A;  2I5E A;  1H7G A;  4AYL A;  4KC2 A;  3POL A;  5D92 A;  2VS3 A;  1WT0 A;  2RIY A;  4M2A A;  3BCV A;  5C1H A;  1GWV A;  1V82 A;  1FXO A;  5C1L A;  1ZDF A;  1Z90 A;  4Y7U A;  2XMH A;  5AJP A;  3DUV A;  4DE7 A;  1H4C A;  2O1F A;  4HCQ A;  4EE4 A;  4KPZ A;  1VGZ A;  3V0M A;  4ECM A;  3V8Z A;  1ZJ3 A;  5L6S A;  3CU0 A;  1S4N A;  3ST8 A;  2P72 A;  4E1K A;  2QKX A;  4FRA A;  2FFU A;  4D11 A;  4FRO A;  1ZCV A;  4Q7C A;  3IOH A;  4B3U A;  4AAW A;  5C49 A;  4BMA A;  2PGV A;  2DPW A;  4AYJ A;  2AE7 A;  4B2W A;  3V0Q A;  3CKV A;  5C3A A;  5FUH A;  5C4C A;  3D5N A;  4Y7G A;  1FGG A;  4ASJ A;  4IRP A;  3U0Y A;  1PZT A;  4KC1 A;  1VZU A;  4O6N A;  3SXE A;  2ZU7 A;  1WT1 A;  5CQO A;  2APC A;  2J0A A;  1TZF A;  1IIN A;  3OC9 A;  4FCU A;  5FU8 A;  4G3Q A;  5C48 A;  1JVD A;  1WVC A;  4FRE A;  2XWN A;  1GX0 A;  1JYK A;  1FWY A;  2RJ9 A;  1VZT A;  2AM4 A;  3TQD A;  2A8W A;  3FWW A;  2O1G A;  1V84 A;  1HM0 A;  5IDS A;  5FYE A;  1O7Q A;  3CGX A;  1H5R A;  1O23 B;  2OI5 A;  1NKH B;  1O7O A;  1JVG A;  3QVB A;  4EEG A;  2RJ6 A;  2VK9 A;  2VSI A;  5JQQ A;  3TZT A;  3RMW A;  1LL3 A;  3SX3 A;  4BQH A;  5AJO A;  4HO6 A;  4HO9 A;  3DK5 A;  3T7M A;  1VGW A;  4O6M A;  1G2V A;  4FRP A;  1XHB A;  4HO3 A;  3F1C A;  4FRL A;  3HL3 A;  2ICX A;  5CMJ A;  2YCM A;  2WVK A;  1WT3 A;  1YP2 A;  3ZGG A;  1QWJ A;  2OEF A;  2QGI A;  4FCE A;  1PZY B;  1S4P A;  1ZCT A;  2D7R A;  2Z87 A;  5DDV A;  1V83 A;  1ZCU A;  2JCO A;  3Q4S A;  1MP3 A;  3N9W A;  1FO9 A;  1LL0 A;  3JUJ A;  4M28 A;  4ASY A;  4Y62 A;  1R80 A;  3K8E A;  3RSB A;  4Y6U A;  1HJJ A;  1ZI5 A;  1LVW A;  2VXL A;  4G3P A;  1W55 A;  3LW6 A;  2VXM A;  1H5S D;  4UEG A;  1FRW A;  1VZX A;  5BXC A;  5CMF X;  4R7P A;  4B5B A;  1LL2 A;  1H7T A;  2UX8 A;  5C3B A;  2FYC B;  3E25 A;  4KPX A;  1FG5 N;  4Y7V A;  2YQJ A;  3V0P A;  1QG8 A;  2ZU8 A;  2VSH A;  3I0G A;  1NF5 B;  2OI7 A;  1H4D A;  4Y7F A;  4AC3 A;  1K4V A;  1ON8 A;  5DDT A;  4B4G A;  1VGT A;  3GUE A;  4KNR A;  2Y4J A;  4Y63 A;  5CQM X;  3FOQ A;  3R2W A;  1LZI A;  2P73 A;  2RIT A;  4HOC A;  1YP4 A;  2WAW A;  5AJN A;  3I0E A;  1VGU A;  4EEO A;  3F1Y A;  5FV9 A;  2I5K A;  4ARW A;  1INJ A;  3SPT A;  4P02 A;  2W0V A;  3IOJ A;  5CQN X;  4EEA A;  2YQH A;  4XWI A;  2RJ5 A;  3U2W A;  3CKQ A;  1R7V A;  3BRK X;  1GA8 A;  1ZJP A;  3CKO A;  1TW5 A;  3I0D A;  2ICY A;  1EZI A;  2Y4M A;  4FRB A;  3V0N A;  2CU2 A;  1OQM B;  1JV3 A;  2RIX A;  2FYB A;  4FIY A;  1TVY A;  1R7Y A;  2P6W A;  1I52 A;  1R82 A;  2X65 A;  4HO0 A;  4EE5 A;  4EEM A;  3T7O A;  5C1G A;  3U2T A;  2BO4 A;  3ZLK A;  1QGS A;  2RJ1 A;  1NMM B;  1XZ6 A;  1ZJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...