2XWMA

Crystal structure of ispd from mycobacterium smegmatis in complex with cmp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
ATVAVVPAAGSGERLRAGRPKAFVTLGGTPLLEHALSGLRASGVIDRIVIAVPPALTDESKLVFGGEDSVIVSGGVDRTESVALALEAAGDAEFVLVHDAARALTPPALIARVVAALKEGHSAVVPGLAPADTIKAVDANGAVLGTPERAGLRAVQTPQGFHADVLRRAYARATAGGVTDDASLVEQLGTPVQIVDGDPLAFKITTPLDLVLAEAVLAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRANSFERASE
publication title Structural and Functional Studies on Mycobacterial Ispd Enzymes
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2010-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2xwmA00
1QGQA 3PNNA 4HOCA 4FRDA 2JCOA 4G3QA 4D0ZA 2Y4JA 3CKOA 1H7GA 3PKQA 4KXOA 2JCJA 5C48A 3SPTA 4J18A 4YS8A 5C4BA 1VGUA 2ZU7A 5EIYA 3R3IA 1WT0A 3USRA 2V0HA 4HO8A 1LZ0A 1QGSA 3RMVA 3OGZA 5BXCA 1LVWA 5C1LA 2RIXA 1JV3A 3Q7UA 2XMHA 5EJZA 2Y4LA 1VZXA 2WAWA 5FTVA 1G2VA 3FOQA 1G3LA 1GA8A 2YQJA 4KC4A 2VS4A 3QVBA 3JUJA 5DDVA 5FUHA 5EJ1A 1GWWA 3V0OA 2V0LA 1NKHB 1G93A 4MNDA 1KWSA 4D11A 4EEAA 2I5KA 1G9RA 4AYLA 1I52A 4EE3A 5AJPA 2VXLA 2BO8A 3ZLKA 1FXJA 1ZJ1A 3V0QA 1VZUA 3E26A 1HJLA 4HO4A 2QKXA 3OH1A 2VS5A 1O23B 1VM8A 1V84A 1H5RB 1S4NA 2RJ0A 1WT3A 2P73A 3D5NA 5IDSA 4G87A 2GGOA 1NF5B 2DPWA 4ECMA 1SS9A 2OI6A 2WGZA 5FU0A 3TZTA 1H7LA 2AM3A 1H5SB 1LZ7A 5I1FA 3IOHA 3TQDA 1S4OA 3RSBA 5DDTA 4CJCA 3V0NA 1GWVA 1S4PA 4B42A 1FO8A 2D0JA 1ON6A 1ZJ2A 4JISA 2V0KA 2W0WA 1FWYA 1TW1A 3PKPA 1YROB 1VH1A 5CMGX 3SXGA 4HO9A 2FYCB 4EEOA 5JQQA 4UEGA 1ZCYA 4EVWA 2Q4JA 5C38A 4CVHA 5C1HA 3HL3A 1H5SC 1QG8A 2BO4A 3U2XA 2AGDA 4M4KA 1W55A 4Y9XA 2BO6A 1O7QA 1GQ9A 5C3AA 1WVCA 1VICA 1YP4A 3I0FA 4ASJA 3CKJA 2X5SA 2AE7A 1ZDGA 3V8YA 2ICYA 1FGGA 4XWIA 1XZ6A 1NQIB 3Q4SA 1XHBA 2VFZA 3LW6A 3V0LA 2ZU8A 4FRHA 1HJJA 4R7PA 3OKRA 4FRBA 3SXDA 2RJ7A 5J49A 4CJBA 3F1CA 3ZF8A 3SX3A 3U0XA 5IDTA 2OI7A 1TW5A 2JCKA 3RMWA 1G97A 1VGTA 1R82A 5CMHA 1IINA 4M2BA 4Y6NA 1H4EA 4AAWA 1G1LA 1ZI4A 3I0KA 3U2VA 3U2UA 1R80A 3IOJA 4KPZA 4MYBA 4FREA 5C1GA 4KC1A 1HM9A 3SXBA 1FRWA 2Z87A 3N9WA 3T7OA 3ST8A 1OMXA 4P02A 2FY7A 1GX4A 3CU0A 2FYAA 1V82A 2YQHA 2AH9A 1R7TA 4FROA 1FR8A 2PGVA 5L6SA 1ZCUA 1VZTA 1INIA 4Y7VA 4AYJA 4HO2A 4NANA 4FRPA 1FOAA 1JYLA 2V0IA 1VPAA 2ICXA 4KNRA 4KRVA 1E5KA 4FQWA 4JD0A 4M2AA 2O1GA 2P6WA 3K8EA 2Y6PA 2OEGA 1WT2A 3V8ZA 2PX7A 4LW3A 3SX7A 3CKNA 5C47A 1W77A 2A8WA 3CKVA 1ZHJA 2FFVA 2ZU9A 1WSZA 2VXMA 3BCVA 3OH3A 4Y63A 1H7QA 1H7HA 1EYRA 4FRLA 1WT1A 3T7NA 4ASYA 2E8BA 5C4EA 3SXAA 1ZJOA 1YP2A 2X65A 2XWMA 1R7XA 3DK5A 4G3PA 4B2XA 1G8OA 2X5ZA 4B2WA 1H3MA 1FXOA 5CQLX 2AECA 2QH5A 1VGZA 4HO3A 1G23A 2QGIA 3SXCA 1ZI5A 2YC3A 1ZI1A 1INJA 3T7MA 2FYDB 1HM0A 3OC9A 1OMZA 1G0RA 2RJ1A 3V91A 2V0JA 2YESA 4GBPA 2RIYA 5C36A 5IFYA 4D0TA 4Y6UA 3E25A 5C8RA 2FFUA 1O7OA 2X60A 3R2WA 1R7VA 1EZIA 2Y4MA 4FRAA 4E1KA 2RJ5A 4EE4A 1R7YA 4IRQA 1H5TA 3O3PA 3USQA 4B4BA 4Y64A 1YP3A 1LZIA 1R81A 1NHEB 4BMAA 4Y7UA 4LW6A 4ARWA 5CMJA 1VH3A 4KPXA 4DE7A 1JVGA 1QWJA 4DDZA 2E3DA 1FO9A 4B4MA 4NAKA 4FRMA 4DECA 2RIZA 4FCEA 3SX8A 1FGXA 1K4VA 1LZJA 1MP4A 1FG5N 3ZLLA 3V0PA 2GGQA 1GQCA 1H7FA 1OQMB 3OH4A 4KNXA 5FYEA 4G3SA 1ZCVA 3I0LA 1TVYA 5CQOA 1JYKA 3CKQA 4ZDQA 1HV9A 2APCA 4FCUA 1H7EA 5CQNX 2O1HA 1H4CA 3ZGFA 5C3BA 1MC3A 3NGWA 2XWLA 3OH0A 3I0JA 5C4FA 3U2WA 1MP5A 3DUVA 3KIAA 2JCLA 3BRKX 2A8UA 1ZDFA 5C49A 3ZGGA 5AJOA 2FYBA 4KQLA 2UX8A 2O1FA 4L41C 4KC2A 2YCMA 3I0GA 4EEGA 1ZCTA 1ZIZA 2P72A 2WE9A 4HO5A 4Y7TA 2RJ9A 3I0DA 4D11C 3POLA 1Z90A 1H5SD 3SX5A 2WVMA 5CMIA 2AESA 1LL3A 3DJ4A 5CQPA 1G95A 5C3DA 3F1YA 4B3UA 1JVDA 2Z86A 1FZWA 2WVKA 3JTJA 3JUKA 4EEMA 4EE5A 4AC3A 4KT7A 3SXEA 3OH2A 3GUEA 2VSHA 3I0HA 2VSIA 1ZJ3A 3K8DA 4Y7FA 4HO0A 3V90A 4HCQA 4M28A 1IIMA 3I0EA 4P00A 5FU8A 2PGYA 2D7RA 2I5EA 2W0VA 4BQHA 2RJ6A 5HS2A 2Y4KA 3I0IX 4NALA 1PZTA 5L6VA 4NAIA 2YQCA 1ZI3A 1ZJ0A 1LL2A 1W57A 5FTSA 2YQSA 1H7TA 1H4DA 2NXVA 5C4DA 2AM5A 1H5TB 4HO6A 2RJ4A 4Y62A 4K6RA 5CMFX 4B5BA 2AM4A 1ZJPA 3EE5A 1HM8A 3D8VA 3FWWA 3OAMA 2OI5A 2XWNA 1JV1A 1O0RA 1H5RA 2OEFA 2VS3A 2CU2A 3IOIA 4IRPA 1NMMB 3U2TA 1FR9A 1VGWA 2YC5A 5AJNA 1NWGB 1R7UA 2WEEA 3CGXA 2D7IA 1TZFA 4CJ8A 1H5SA 4FRQA 4D48A 3I0CA 1PZYB 2RITA 1V83A 2VD4A 3U0YA 2MZBA 4B4GA 5CQMX 2WVLA 2I7BA 2RJ8A 1ON8A 2Y7AA 5C4CA 2BO7A 5FV9A 1LL0A 1MP3A 2PA4A 3Q80A 4C2SA 4HG6A 2XMEA 3D98A 4Y7GA 3V0MA 1GX0A
chains in the Genus database with same CATH superfamily
1QGQA 3PNNA 4HOCA 4FRDA 2JCOA 4G3QA 4D0ZA 2Y4JA 3CKOA 1H7GA 3PKQA 4KXOA 2JCJA 5C48A 3SPTA 4J18A 4MIXA 4YS8A 5C4BA 1VGUA 2ZU7A 4FIYA 4Q7CA 5EIYA 3R3IA 1WT0A 3USRA 2V0HA 4HO8A 1LZ0A 1QGSA 3RMVA 3OGZA 5BXCA 1LVWA 5C1LA 4O6MA 2RIXA 1JV3A 3Q7UA 2XMHA 5EJZA 2Y4LA 1VZXA 2WAWA 5FTVA 1G2VA 3FOQA 1G3LA 1GA8A 2YQJA 4KC4A 2VS4A 3QVBA 3JUJA 5DDVA 5FUHA 5EJ1A 1GWWA 3V0OA 2V0LA 1NKHB 1G93A 4MNDA 1KWSA 4D11A 4EEAA 2I5KA 1G9RA 4AYLA 1I52A 4EE3A 5AJPA 2VXLA 2BO8A 3ZLKA 1FXJA 1ZJ1A 3V0QA 1VZUA 3E26A 1HJLA 4HO4A 2QKXA 3OH1A 2VS5A 1O23B 1VM8A 1V84A 1H5RB 1S4NA 2RJ0A 1WT3A 2P73A 3D5NA 5IDSA 4G87A 2GGOA 1NF5B 2DPWA 4ECMA 1SS9A 2OI6A 2WGZA 5FU0A 3TZTA 1H7LA 2AM3A 1H5SB 1LZ7A 5I1FA 3IOHA 3TQDA 1S4OA 3RSBA 5DDTA 4CJCA 3V0NA 1GWVA 1S4PA 4B42A 1FO8A 2D0JA 1ON6A 1ZJ2A 4JISA 2V0KA 2W0WA 1FWYA 1TW1A 3PKPA 1YROB 1VH1A 5CMGX 3SXGA 4HO9A 2FYCB 4EEOA 5JQQA 4UEGA 1ZCYA 4EVWA 2Q4JA 5C38A 4CVHA 5C1HA 3HL3A 1H5SC 1QG8A 2BO4A 3U2XA 2AGDA 4M4KA 1W55A 4Y9XA 2BO6A 1O7QA 1GQ9A 5C3AA 1WVCA 1VICA 5D91A 1YP4A 3I0FA 4ASJA 3CKJA 2X5SA 2AE7A 1ZDGA 3V8YA 2ICYA 1FGGA 4XWIA 1XZ6A 1NQIB 3Q4SA 1XHBA 2VFZA 3LW6A 3V0LA 2ZU8A 4FRHA 1HJJA 4R7PA 3OKRA 4FRBA 3SXDA 2RJ7A 5J49A 4CJBA 3F1CA 3ZF8A 3SX3A 3U0XA 5IDTA 2OI7A 1TW5A 2JCKA 3RMWA 1G97A 1VGTA 1R82A 5CMHA 1IINA 4M2BA 4Y6NA 1H4EA 4AAWA 1G1LA 1ZI4A 3I0KA 3U2VA 3U2UA 1R80A 3IOJA 4KPZA 4MYBA 4FREA 5C1GA 4KC1A 1HM9A 3SXBA 1FRWA 2Z87A 3N9WA 3T7OA 3ST8A 1OMXA 4P02A 2FY7A 1GX4A 3CU0A 2FYAA 1V82A 2YQHA 2AH9A 1R7TA 4FROA 1FR8A 2PGVA 5L6SA 1ZCUA 1VZTA 1INIA 4Y7VA 4AYJA 4HO2A 4NANA 4FRPA 1FOAA 1JYLA 2V0IA 1VPAA 2ICXA 4KNRA 4KRVA 1E5KA 4FQWA 4JD0A 4M2AA 2O1GA 2P6WA 3K8EA 2Y6PA 2OEGA 1WT2A 3V8ZA 2PX7A 4LW3A 3SX7A 3CKNA 5C47A 1W77A 2A8WA 3CKVA 1ZHJA 2FFVA 2ZU9A 1WSZA 2VXMA 3BCVA 3OH3A 4Y63A 1H7QA 1H7HA 1EYRA 4FRLA 1WT1A 3T7NA 4ASYA 2E8BA 5C4EA 3SXAA 1ZJOA 1YP2A 2X65A 2XWMA 1R7XA 3DK5A 4G3PA 4B2XA 1G8OA 2X5ZA 4B2WA 1H3MA 1FXOA 5CQLX 2AECA 2QH5A 1VGZA 4HO3A 1G23A 2QGIA 3SXCA 1ZI5A 2YC3A 1ZI1A 1INJA 3T7MA 2FYDB 1HM0A 3OC9A 1OMZA 1G0RA 2RJ1A 3V91A 2V0JA 2YESA 4GBPA 2RIYA 5C36A 5IFYA 4D0TA 4Y6UA 3E25A 5C8RA 2FFUA 1O7OA 2X60A 3R2WA 1R7VA 1EZIA 2Y4MA 4FRAA 4E1KA 2RJ5A 4EE4A 1R7YA 4IRQA 1H5TA 3O3PA 3USQA 4B4BA 4Y64A 1YP3A 1LZIA 1R81A 1NHEB 4BMAA 4Y7UA 4LW6A 4ARWA 5CMJA 1VH3A 4KPXA 4DE7A 1JVGA 1QWJA 4DDZA 2E3DA 1FO9A 4B4MA 4NAKA 4FRMA 4DECA 2RIZA 4FCEA 3SX8A 1FGXA 1K4VA 1LZJA 1MP4A 1FG5N 3ZLLA 3V0PA 2GGQA 1GQCA 1H7FA 1OQMB 3OH4A 4KNXA 5FYEA 4G3SA 1ZCVA 3I0LA 1TVYA 5CQOA 1JYKA 3CKQA 4ZDQA 1HV9A 2APCA 4FCUA 1H7EA 5CQNX 2O1HA 1H4CA 3ZGFA 5C3BA 1MC3A 3NGWA 2XWLA 3OH0A 3I0JA 5C4FA 3U2WA 1MP5A 3DUVA 3KIAA 2JCLA 3BRKX 2A8UA 1ZDFA 5C49A 3ZGGA 5AJOA 2FYBA 4KQLA 2UX8A 2O1FA 4L41C 4KC2A 2YCMA 3I0GA 4EEGA 1ZCTA 1ZIZA 2P72A 2WE9A 4HO5A 4Y7TA 5D92A 2RJ9A 3I0DA 4D11C 3POLA 1Z90A 1H5SD 3SX5A 2WVMA 5CMIA 2J0AA 2AESA 1LL3A 3DJ4A 5CQPA 1G95A 4FIXA 5C3DA 3F1YA 4B3UA 1JVDA 2Z86A 1FZWA 2WVKA 3JTJA 3JUKA 4EEMA 4EE5A 4AC3A 4KT7A 3SXEA 3OH2A 3GUEA 2VSHA 3I0HA 2VSIA 1ZJ3A 3K8DA 4Y7FA 4HO0A 3V90A 4HCQA 4M28A 1IIMA 3I0EA 4P00A 5FU8A 2PGYA 2D7RA 2I5EA 2W0VA 4BQHA 2RJ6A 5HS2A 2Y4KA 3I0IX 4NALA 1PZTA 5L6VA 4NAIA 2YQCA 1ZI3A 1ZJ0A 1LL2A 1W57A 2C0NA 5FTSA 2YQSA 1H7TA 1H4DA 2NXVA 5C4DA 2AM5A 1H5TB 4HO6A 2RJ4A 4Y62A 4K6RA 5CMFX 4B5BA 2AM4A 1ZJPA 3EE5A 1HM8A 3D8VA 3FWWA 3OAMA 2OI5A 2XWNA 1JV1A 1O0RA 2J0BA 1H5RA 2OEFA 2VS3A 2CU2A 3IOIA 4IRPA 1NMMB 3U2TA 1FR9A 1VGWA 2YC5A 5AJNA 1NWGB 1R7UA 2WEEA 3CGXA 2D7IA 1TZFA 4CJ8A 2VK9A 1H5SA 4FRQA 4D48A 3I0CA 1PZYB 2RITA 1V83A 2VD4A 4O6NA 3U0YA 2MZBA 4B4GA 5CQMX 2WVLA 2I7BA 2RJ8A 1ON8A 2Y7AA 5C4CA 2BO7A 5FV9A 1LL0A 1MP3A 2PA4A 3Q80A 4C2SA 4HG6A 2XMEA 3D98A 4Y7GA 3V0MA 1GX0A
chains in the Genus database with same CATH topology
1QGQA 3PNNA 4HOCA 4FRDA 2JCOA 4G3QA 4D0ZA 2Y4JA 3CKOA 1H7GA 3PKQA 4KXOA 2JCJA 5C48A 3SPTA 4J18A 4MIXA 4YS8A 5C4BA 1VGUA 2ZU7A 4FIYA 4Q7CA 5EIYA 3R3IA 1WT0A 3USRA 2V0HA 4HO8A 1LZ0A 1QGSA 3RMVA 3OGZA 5BXCA 1LVWA 5C1LA 4O6MA 2RIXA 1JV3A 3Q7UA 2XMHA 5EJZA 2Y4LA 1VZXA 2WAWA 5FTVA 1G2VA 3FOQA 1G3LA 1GA8A 2YQJA 4KC4A 2VS4A 3QVBA 3JUJA 5DDVA 5FUHA 5EJ1A 1GWWA 3V0OA 2V0LA 1NKHB 1G93A 4MNDA 1KWSA 4D11A 4EEAA 2I5KA 1G9RA 4AYLA 1I52A 4EE3A 5AJPA 2VXLA 2BO8A 3ZLKA 1FXJA 1ZJ1A 3V0QA 1VZUA 3E26A 1HJLA 4HO4A 2QKXA 3OH1A 2VS5A 1O23B 1VM8A 1V84A 1H5RB 1S4NA 2RJ0A 1WT3A 2P73A 3D5NA 5IDSA 4G87A 2GGOA 1NF5B 2DPWA 4ECMA 1SS9A 2OI6A 2WGZA 5FU0A 3TZTA 1H7LA 2AM3A 1H5SB 1LZ7A 5I1FA 3IOHA 3TQDA 1S4OA 3RSBA 5DDTA 4CJCA 3V0NA 1GWVA 1S4PA 4B42A 1FO8A 2D0JA 1ON6A 1ZJ2A 4JISA 2V0KA 2W0WA 1FWYA 1TW1A 3PKPA 1YROB 1VH1A 5CMGX 3SXGA 4HO9A 2FYCB 4EEOA 5JQQA 4UEGA 1ZCYA 4EVWA 2Q4JA 5C38A 4CVHA 5C1HA 3HL3A 1H5SC 1QG8A 2BO4A 3U2XA 2AGDA 4M4KA 1W55A 4Y9XA 2BO6A 1O7QA 1GQ9A 5C3AA 1WVCA 1VICA 5D91A 1YP4A 3I0FA 4ASJA 3CKJA 2X5SA 2AE7A 1ZDGA 3V8YA 2ICYA 1FGGA 4XWIA 1XZ6A 1NQIB 3Q4SA 1XHBA 2VFZA 3LW6A 3V0LA 2ZU8A 4FRHA 1HJJA 4R7PA 3OKRA 4FRBA 3SXDA 2RJ7A 5J49A 4CJBA 3F1CA 3ZF8A 3SX3A 3U0XA 5IDTA 2OI7A 1TW5A 2JCKA 3RMWA 1G97A 1VGTA 1R82A 5CMHA 1IINA 4M2BA 4Y6NA 1H4EA 4AAWA 1G1LA 1ZI4A 3I0KA 3U2VA 3U2UA 1R80A 3IOJA 4KPZA 4MYBA 4FREA 5C1GA 4KC1A 1HM9A 3SXBA 1FRWA 2Z87A 3N9WA 3T7OA 3ST8A 1OMXA 4P02A 2FY7A 1GX4A 3CU0A 2FYAA 1V82A 2YQHA 2AH9A 1R7TA 4FROA 1FR8A 2PGVA 5L6SA 1ZCUA 1VZTA 1INIA 4Y7VA 4AYJA 4HO2A 4NANA 4FRPA 1FOAA 1JYLA 2V0IA 1VPAA 2ICXA 4KNRA 4KRVA 1E5KA 4FQWA 4JD0A 4M2AA 2O1GA 2P6WA 3K8EA 2Y6PA 2OEGA 1WT2A 3V8ZA 2PX7A 4LW3A 3SX7A 3CKNA 5C47A 1W77A 2A8WA 3CKVA 1ZHJA 2FFVA 2ZU9A 1WSZA 2VXMA 3BCVA 3OH3A 4Y63A 1H7QA 1H7HA 1EYRA 4FRLA 1WT1A 3T7NA 4ASYA 2E8BA 5C4EA 3SXAA 1ZJOA 1YP2A 2X65A 2XWMA 1R7XA 3DK5A 4G3PA 4B2XA 1G8OA 2X5ZA 4B2WA 1H3MA 1FXOA 5CQLX 2AECA 2QH5A 1VGZA 4HO3A 1G23A 2QGIA 3SXCA 1ZI5A 2YC3A 1ZI1A 1INJA 3T7MA 2FYDB 1HM0A 3OC9A 1OMZA 1G0RA 2RJ1A 3V91A 2V0JA 2YESA 4GBPA 2RIYA 5C36A 5IFYA 4D0TA 4Y6UA 3E25A 5C8RA 2FFUA 1O7OA 2X60A 3R2WA 1R7VA 1EZIA 2Y4MA 4FRAA 4E1KA 2RJ5A 4EE4A 1R7YA 4IRQA 1H5TA 3O3PA 3USQA 4B4BA 4Y64A 1YP3A 1LZIA 1R81A 1NHEB 4BMAA 4Y7UA 4LW6A 4ARWA 5CMJA 1VH3A 4KPXA 4DE7A 1JVGA 1QWJA 4DDZA 2E3DA 1FO9A 4B4MA 4NAKA 4FRMA 4DECA 2RIZA 4FCEA 3SX8A 1FGXA 1K4VA 1LZJA 1MP4A 1FG5N 3ZLLA 3V0PA 2GGQA 1GQCA 1H7FA 1OQMB 3OH4A 4KNXA 5FYEA 4G3SA 1ZCVA 3I0LA 1TVYA 5CQOA 1JYKA 3CKQA 4ZDQA 1HV9A 2APCA 4FCUA 1H7EA 5CQNX 2O1HA 1H4CA 3ZGFA 5C3BA 1MC3A 3NGWA 2XWLA 3OH0A 3I0JA 5C4FA 3U2WA 1MP5A 3DUVA 3KIAA 2JCLA 3BRKX 2A8UA 1ZDFA 5C49A 3ZGGA 5AJOA 2FYBA 4KQLA 2UX8A 2O1FA 4L41C 4KC2A 2YCMA 3I0GA 4EEGA 1ZCTA 1ZIZA 2P72A 2WE9A 4HO5A 4Y7TA 5D92A 2RJ9A 3I0DA 4D11C 3POLA 1Z90A 1H5SD 3SX5A 2WVMA 5CMIA 2J0AA 2AESA 1LL3A 3DJ4A 5CQPA 1G95A 4FIXA 5C3DA 3F1YA 4B3UA 1JVDA 2Z86A 1FZWA 2WVKA 3JTJA 3JUKA 4EEMA 4EE5A 4AC3A 4KT7A 3SXEA 3OH2A 3GUEA 2VSHA 3I0HA 2VSIA 1ZJ3A 3K8DA 4Y7FA 4HO0A 3V90A 4HCQA 4M28A 1IIMA 3I0EA 4P00A 5FU8A 2PGYA 2D7RA 2I5EA 2W0VA 4BQHA 2RJ6A 5HS2A 2Y4KA 3I0IX 4NALA 1PZTA 5L6VA 4NAIA 2YQCA 1ZI3A 1ZJ0A 1LL2A 1W57A 2C0NA 5FTSA 2YQSA 1H7TA 1H4DA 2NXVA 5C4DA 2AM5A 1H5TB 4HO6A 2RJ4A 4Y62A 4K6RA 5CMFX 4B5BA 2AM4A 1ZJPA 3EE5A 1HM8A 3D8VA 3FWWA 3OAMA 2OI5A 2XWNA 1JV1A 1O0RA 2J0BA 1H5RA 2OEFA 2VS3A 2CU2A 3IOIA 4IRPA 1NMMB 3U2TA 1FR9A 1VGWA 2YC5A 5AJNA 1NWGB 1R7UA 2WEEA 3CGXA 2D7IA 1TZFA 4CJ8A 2VK9A 1H5SA 4FRQA 4D48A 3I0CA 1PZYB 2RITA 1V83A 2VD4A 4O6NA 3U0YA 2MZBA 4B4GA 5CQMX 2WVLA 2I7BA 2RJ8A 1ON8A 2Y7AA 5C4CA 2BO7A 5FV9A 1LL0A 1MP3A 2PA4A 3Q80A 4C2SA 4HG6A 2XMEA 3D98A 4Y7GA 3V0MA 1GX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGQ A;  3PNN A;  4HOC A;  4FRD A;  2JCO A;  4G3Q A;  4D0Z A;  2Y4J A;  3CKO A;  1H7G A;  3PKQ A;  4KXO A;  2JCJ A;  5C48 A;  3SPT A;  4J18 A;  4YS8 A;  5C4B A;  1VGU A;  2ZU7 A;  5EIY A;  3R3I A;  1WT0 A;  3USR A;  2V0H A;  4HO8 A;  1LZ0 A;  1QGS A;  3RMV A;  3OGZ A;  5BXC A;  1LVW A;  5C1L A;  2RIX A;  1JV3 A;  3Q7U A;  2XMH A;  5EJZ A;  2Y4L A;  1VZX A;  2WAW A;  5FTV A;  1G2V A;  3FOQ A;  1G3L A;  1GA8 A;  2YQJ A;  4KC4 A;  2VS4 A;  3QVB A;  3JUJ A;  5DDV A;  5FUH A;  5EJ1 A;  1GWW A;  3V0O A;  2V0L A;  1NKH B;  1G93 A;  4MND A;  1KWS A;  4D11 A;  4EEA A;  2I5K A;  1G9R A;  4AYL A;  1I52 A;  4EE3 A;  5AJP A;  2VXL A;  2BO8 A;  3ZLK A;  1FXJ A;  1ZJ1 A;  3V0Q A;  1VZU A;  3E26 A;  1HJL A;  4HO4 A;  2QKX A;  3OH1 A;  2VS5 A;  1O23 B;  1VM8 A;  1V84 A;  1H5R B;  1S4N A;  2RJ0 A;  1WT3 A;  2P73 A;  3D5N A;  5IDS A;  4G87 A;  2GGO A;  1NF5 B;  2DPW A;  4ECM A;  1SS9 A;  2OI6 A;  2WGZ A;  5FU0 A;  3TZT A;  1H7L A;  2AM3 A;  1H5S B;  1LZ7 A;  5I1F A;  3IOH A;  3TQD A;  1S4O A;  3RSB A;  5DDT A;  4CJC A;  3V0N A;  1GWV A;  1S4P A;  4B42 A;  1FO8 A;  2D0J A;  1ON6 A;  1ZJ2 A;  4JIS A;  2V0K A;  2W0W A;  1FWY A;  1TW1 A;  3PKP A;  1YRO B;  1VH1 A;  5CMG X;  3SXG A;  4HO9 A;  2FYC B;  4EEO A;  5JQQ A;  4UEG A;  1ZCY A;  4EVW A;  2Q4J A;  5C38 A;  4CVH A;  5C1H A;  3HL3 A;  1H5S C;  1QG8 A;  2BO4 A;  3U2X A;  2AGD A;  4M4K A;  1W55 A;  4Y9X A;  2BO6 A;  1O7Q A;  1GQ9 A;  5C3A A;  1WVC A;  1VIC A;  1YP4 A;  3I0F A;  4ASJ A;  3CKJ A;  2X5S A;  2AE7 A;  1ZDG A;  3V8Y A;  2ICY A;  1FGG A;  4XWI A;  1XZ6 A;  1NQI B;  3Q4S A;  1XHB A;  2VFZ A;  3LW6 A;  3V0L A;  2ZU8 A;  4FRH A;  1HJJ A;  4R7P A;  3OKR A;  4FRB A;  3SXD A;  2RJ7 A;  5J49 A;  4CJB A;  3F1C A;  3ZF8 A;  3SX3 A;  3U0X A;  5IDT A;  2OI7 A;  1TW5 A;  2JCK A;  3RMW A;  1G97 A;  1VGT A;  1R82 A;  5CMH A;  1IIN A;  4M2B A;  4Y6N A;  1H4E A;  4AAW A;  1G1L A;  1ZI4 A;  3I0K A;  3U2V A;  3U2U A;  1R80 A;  3IOJ A;  4KPZ A;  4MYB A;  4FRE A;  5C1G A;  4KC1 A;  1HM9 A;  3SXB A;  1FRW A;  2Z87 A;  3N9W A;  3T7O A;  3ST8 A;  1OMX A;  4P02 A;  2FY7 A;  1GX4 A;  3CU0 A;  2FYA A;  1V82 A;  2YQH A;  2AH9 A;  1R7T A;  4FRO A;  1FR8 A;  2PGV A;  5L6S A;  1ZCU A;  1VZT A;  1INI A;  4Y7V A;  4AYJ A;  4HO2 A;  4NAN A;  4FRP A;  1FOA A;  1JYL A;  2V0I A;  1VPA A;  2ICX A;  4KNR A;  4KRV A;  1E5K A;  4FQW A;  4JD0 A;  4M2A A;  2O1G A;  2P6W A;  3K8E A;  2Y6P A;  2OEG A;  1WT2 A;  3V8Z A;  2PX7 A;  4LW3 A;  3SX7 A;  3CKN A;  5C47 A;  1W77 A;  2A8W A;  3CKV A;  1ZHJ A;  2FFV A;  2ZU9 A;  1WSZ A;  2VXM A;  3BCV A;  3OH3 A;  4Y63 A;  1H7Q A;  1H7H A;  1EYR A;  4FRL A;  1WT1 A;  3T7N A;  4ASY A;  2E8B A;  5C4E A;  3SXA A;  1ZJO A;  1YP2 A;  2X65 A;  2XWM A;  1R7X A;  3DK5 A;  4G3P A;  4B2X A;  1G8O A;  2X5Z A;  4B2W A;  1H3M A;  1FXO A;  5CQL X;  2AEC A;  2QH5 A;  1VGZ A;  4HO3 A;  1G23 A;  2QGI A;  3SXC A;  1ZI5 A;  2YC3 A;  1ZI1 A;  1INJ A;  3T7M A;  2FYD B;  1HM0 A;  3OC9 A;  1OMZ A;  1G0R A;  2RJ1 A;  3V91 A;  2V0J A;  2YES A;  4GBP A;  2RIY A;  5C36 A;  5IFY A;  4D0T A;  4Y6U A;  3E25 A;  5C8R A;  2FFU A;  1O7O A;  2X60 A;  3R2W A;  1R7V A;  1EZI A;  2Y4M A;  4FRA A;  4E1K A;  2RJ5 A;  4EE4 A;  1R7Y A;  4IRQ A;  1H5T A;  3O3P A;  3USQ A;  4B4B A;  4Y64 A;  1YP3 A;  1LZI A;  1R81 A;  1NHE B;  4BMA A;  4Y7U A;  4LW6 A;  4ARW A;  5CMJ A;  1VH3 A;  4KPX A;  4DE7 A;  1JVG A;  1QWJ A;  4DDZ A;  2E3D A;  1FO9 A;  4B4M A;  4NAK A;  4FRM A;  4DEC A;  2RIZ A;  4FCE A;  3SX8 A;  1FGX A;  1K4V A;  1LZJ A;  1MP4 A;  1FG5 N;  3ZLL A;  3V0P A;  2GGQ A;  1GQC A;  1H7F A;  1OQM B;  3OH4 A;  4KNX A;  5FYE A;  4G3S A;  1ZCV A;  3I0L A;  1TVY A;  5CQO A;  1JYK A;  3CKQ A;  4ZDQ A;  1HV9 A;  2APC A;  4FCU A;  1H7E A;  5CQN X;  2O1H A;  1H4C A;  3ZGF A;  5C3B A;  1MC3 A;  3NGW A;  2XWL A;  3OH0 A;  3I0J A;  5C4F A;  3U2W A;  1MP5 A;  3DUV A;  3KIA A;  2JCL A;  3BRK X;  2A8U A;  1ZDF A;  5C49 A;  3ZGG A;  5AJO A;  2FYB A;  4KQL A;  2UX8 A;  2O1F A;  4L41 C;  4KC2 A;  2YCM A;  3I0G A;  4EEG A;  1ZCT A;  1ZIZ A;  2P72 A;  2WE9 A;  4HO5 A;  4Y7T A;  2RJ9 A;  3I0D A;  4D11 C;  3POL A;  1Z90 A;  1H5S D;  3SX5 A;  2WVM A;  5CMI A;  2AES A;  1LL3 A;  3DJ4 A;  5CQP A;  1G95 A;  5C3D A;  3F1Y A;  4B3U A;  1JVD A;  2Z86 A;  1FZW A;  2WVK A;  3JTJ A;  3JUK A;  4EEM A;  4EE5 A;  4AC3 A;  4KT7 A;  3SXE A;  3OH2 A;  3GUE A;  2VSH A;  3I0H A;  2VSI A;  1ZJ3 A;  3K8D A;  4Y7F A;  4HO0 A;  3V90 A;  4HCQ A;  4M28 A;  1IIM A;  3I0E A;  4P00 A;  5FU8 A;  2PGY A;  2D7R A;  2I5E A;  2W0V A;  4BQH A;  2RJ6 A;  5HS2 A;  2Y4K A;  3I0I X;  4NAL A;  1PZT A;  5L6V A;  4NAI A;  2YQC A;  1ZI3 A;  1ZJ0 A;  1LL2 A;  1W57 A;  5FTS A;  2YQS A;  1H7T A;  1H4D A;  2NXV A;  5C4D A;  2AM5 A;  1H5T B;  4HO6 A;  2RJ4 A;  4Y62 A;  4K6R A;  5CMF X;  4B5B A;  2AM4 A;  1ZJP A;  3EE5 A;  1HM8 A;  3D8V A;  3FWW A;  3OAM A;  2OI5 A;  2XWN A;  1JV1 A;  1O0R A;  1H5R A;  2OEF A;  2VS3 A;  2CU2 A;  3IOI A;  4IRP A;  1NMM B;  3U2T A;  1FR9 A;  1VGW A;  2YC5 A;  5AJN A;  1NWG B;  1R7U A;  2WEE A;  3CGX A;  2D7I A;  1TZF A;  4CJ8 A;  1H5S A;  4FRQ A;  4D48 A;  3I0C A;  1PZY B;  2RIT A;  1V83 A;  2VD4 A;  3U0Y A;  2MZB A;  4B4G A;  5CQM X;  2WVL A;  2I7B A;  2RJ8 A;  1ON8 A;  2Y7A A;  5C4C A;  2BO7 A;  5FV9 A;  1LL0 A;  1MP3 A;  2PA4 A;  3Q80 A;  4C2S A;  4HG6 A;  2XME A;  3D98 A;  4Y7G A;  3V0M A;  1GX0 A; 
#chains in the Genus database with same CATH topology
 1QGQ A;  3PNN A;  4HOC A;  4FRD A;  2JCO A;  4G3Q A;  4D0Z A;  2Y4J A;  3CKO A;  1H7G A;  3PKQ A;  4KXO A;  2JCJ A;  5C48 A;  3SPT A;  4J18 A;  4MIX A;  4YS8 A;  5C4B A;  1VGU A;  2ZU7 A;  4FIY A;  4Q7C A;  5EIY A;  3R3I A;  1WT0 A;  3USR A;  2V0H A;  4HO8 A;  1LZ0 A;  1QGS A;  3RMV A;  3OGZ A;  5BXC A;  1LVW A;  5C1L A;  4O6M A;  2RIX A;  1JV3 A;  3Q7U A;  2XMH A;  5EJZ A;  2Y4L A;  1VZX A;  2WAW A;  5FTV A;  1G2V A;  3FOQ A;  1G3L A;  1GA8 A;  2YQJ A;  4KC4 A;  2VS4 A;  3QVB A;  3JUJ A;  5DDV A;  5FUH A;  5EJ1 A;  1GWW A;  3V0O A;  2V0L A;  1NKH B;  1G93 A;  4MND A;  1KWS A;  4D11 A;  4EEA A;  2I5K A;  1G9R A;  4AYL A;  1I52 A;  4EE3 A;  5AJP A;  2VXL A;  2BO8 A;  3ZLK A;  1FXJ A;  1ZJ1 A;  3V0Q A;  1VZU A;  3E26 A;  1HJL A;  4HO4 A;  2QKX A;  3OH1 A;  2VS5 A;  1O23 B;  1VM8 A;  1V84 A;  1H5R B;  1S4N A;  2RJ0 A;  1WT3 A;  2P73 A;  3D5N A;  5IDS A;  4G87 A;  2GGO A;  1NF5 B;  2DPW A;  4ECM A;  1SS9 A;  2OI6 A;  2WGZ A;  5FU0 A;  3TZT A;  1H7L A;  2AM3 A;  1H5S B;  1LZ7 A;  5I1F A;  3IOH A;  3TQD A;  1S4O A;  3RSB A;  5DDT A;  4CJC A;  3V0N A;  1GWV A;  1S4P A;  4B42 A;  1FO8 A;  2D0J A;  1ON6 A;  1ZJ2 A;  4JIS A;  2V0K A;  2W0W A;  1FWY A;  1TW1 A;  3PKP A;  1YRO B;  1VH1 A;  5CMG X;  3SXG A;  4HO9 A;  2FYC B;  4EEO A;  5JQQ A;  4UEG A;  1ZCY A;  4EVW A;  2Q4J A;  5C38 A;  4CVH A;  5C1H A;  3HL3 A;  1H5S C;  1QG8 A;  2BO4 A;  3U2X A;  2AGD A;  4M4K A;  1W55 A;  4Y9X A;  2BO6 A;  1O7Q A;  1GQ9 A;  5C3A A;  1WVC A;  1VIC A;  5D91 A;  1YP4 A;  3I0F A;  4ASJ A;  3CKJ A;  2X5S A;  2AE7 A;  1ZDG A;  3V8Y A;  2ICY A;  1FGG A;  4XWI A;  1XZ6 A;  1NQI B;  3Q4S A;  1XHB A;  2VFZ A;  3LW6 A;  3V0L A;  2ZU8 A;  4FRH A;  1HJJ A;  4R7P A;  3OKR A;  4FRB A;  3SXD A;  2RJ7 A;  5J49 A;  4CJB A;  3F1C A;  3ZF8 A;  3SX3 A;  3U0X A;  5IDT A;  2OI7 A;  1TW5 A;  2JCK A;  3RMW A;  1G97 A;  1VGT A;  1R82 A;  5CMH A;  1IIN A;  4M2B A;  4Y6N A;  1H4E A;  4AAW A;  1G1L A;  1ZI4 A;  3I0K A;  3U2V A;  3U2U A;  1R80 A;  3IOJ A;  4KPZ A;  4MYB A;  4FRE A;  5C1G A;  4KC1 A;  1HM9 A;  3SXB A;  1FRW A;  2Z87 A;  3N9W A;  3T7O A;  3ST8 A;  1OMX A;  4P02 A;  2FY7 A;  1GX4 A;  3CU0 A;  2FYA A;  1V82 A;  2YQH A;  2AH9 A;  1R7T A;  4FRO A;  1FR8 A;  2PGV A;  5L6S A;  1ZCU A;  1VZT A;  1INI A;  4Y7V A;  4AYJ A;  4HO2 A;  4NAN A;  4FRP A;  1FOA A;  1JYL A;  2V0I A;  1VPA A;  2ICX A;  4KNR A;  4KRV A;  1E5K A;  4FQW A;  4JD0 A;  4M2A A;  2O1G A;  2P6W A;  3K8E A;  2Y6P A;  2OEG A;  1WT2 A;  3V8Z A;  2PX7 A;  4LW3 A;  3SX7 A;  3CKN A;  5C47 A;  1W77 A;  2A8W A;  3CKV A;  1ZHJ A;  2FFV A;  2ZU9 A;  1WSZ A;  2VXM A;  3BCV A;  3OH3 A;  4Y63 A;  1H7Q A;  1H7H A;  1EYR A;  4FRL A;  1WT1 A;  3T7N A;  4ASY A;  2E8B A;  5C4E A;  3SXA A;  1ZJO A;  1YP2 A;  2X65 A;  2XWM A;  1R7X A;  3DK5 A;  4G3P A;  4B2X A;  1G8O A;  2X5Z A;  4B2W A;  1H3M A;  1FXO A;  5CQL X;  2AEC A;  2QH5 A;  1VGZ A;  4HO3 A;  1G23 A;  2QGI A;  3SXC A;  1ZI5 A;  2YC3 A;  1ZI1 A;  1INJ A;  3T7M A;  2FYD B;  1HM0 A;  3OC9 A;  1OMZ A;  1G0R A;  2RJ1 A;  3V91 A;  2V0J A;  2YES A;  4GBP A;  2RIY A;  5C36 A;  5IFY A;  4D0T A;  4Y6U A;  3E25 A;  5C8R A;  2FFU A;  1O7O A;  2X60 A;  3R2W A;  1R7V A;  1EZI A;  2Y4M A;  4FRA A;  4E1K A;  2RJ5 A;  4EE4 A;  1R7Y A;  4IRQ A;  1H5T A;  3O3P A;  3USQ A;  4B4B A;  4Y64 A;  1YP3 A;  1LZI A;  1R81 A;  1NHE B;  4BMA A;  4Y7U A;  4LW6 A;  4ARW A;  5CMJ A;  1VH3 A;  4KPX A;  4DE7 A;  1JVG A;  1QWJ A;  4DDZ A;  2E3D A;  1FO9 A;  4B4M A;  4NAK A;  4FRM A;  4DEC A;  2RIZ A;  4FCE A;  3SX8 A;  1FGX A;  1K4V A;  1LZJ A;  1MP4 A;  1FG5 N;  3ZLL A;  3V0P A;  2GGQ A;  1GQC A;  1H7F A;  1OQM B;  3OH4 A;  4KNX A;  5FYE A;  4G3S A;  1ZCV A;  3I0L A;  1TVY A;  5CQO A;  1JYK A;  3CKQ A;  4ZDQ A;  1HV9 A;  2APC A;  4FCU A;  1H7E A;  5CQN X;  2O1H A;  1H4C A;  3ZGF A;  5C3B A;  1MC3 A;  3NGW A;  2XWL A;  3OH0 A;  3I0J A;  5C4F A;  3U2W A;  1MP5 A;  3DUV A;  3KIA A;  2JCL A;  3BRK X;  2A8U A;  1ZDF A;  5C49 A;  3ZGG A;  5AJO A;  2FYB A;  4KQL A;  2UX8 A;  2O1F A;  4L41 C;  4KC2 A;  2YCM A;  3I0G A;  4EEG A;  1ZCT A;  1ZIZ A;  2P72 A;  2WE9 A;  4HO5 A;  4Y7T A;  5D92 A;  2RJ9 A;  3I0D A;  4D11 C;  3POL A;  1Z90 A;  1H5S D;  3SX5 A;  2WVM A;  5CMI A;  2J0A A;  2AES A;  1LL3 A;  3DJ4 A;  5CQP A;  1G95 A;  4FIX A;  5C3D A;  3F1Y A;  4B3U A;  1JVD A;  2Z86 A;  1FZW A;  2WVK A;  3JTJ A;  3JUK A;  4EEM A;  4EE5 A;  4AC3 A;  4KT7 A;  3SXE A;  3OH2 A;  3GUE A;  2VSH A;  3I0H A;  2VSI A;  1ZJ3 A;  3K8D A;  4Y7F A;  4HO0 A;  3V90 A;  4HCQ A;  4M28 A;  1IIM A;  3I0E A;  4P00 A;  5FU8 A;  2PGY A;  2D7R A;  2I5E A;  2W0V A;  4BQH A;  2RJ6 A;  5HS2 A;  2Y4K A;  3I0I X;  4NAL A;  1PZT A;  5L6V A;  4NAI A;  2YQC A;  1ZI3 A;  1ZJ0 A;  1LL2 A;  1W57 A;  2C0N A;  5FTS A;  2YQS A;  1H7T A;  1H4D A;  2NXV A;  5C4D A;  2AM5 A;  1H5T B;  4HO6 A;  2RJ4 A;  4Y62 A;  4K6R A;  5CMF X;  4B5B A;  2AM4 A;  1ZJP A;  3EE5 A;  1HM8 A;  3D8V A;  3FWW A;  3OAM A;  2OI5 A;  2XWN A;  1JV1 A;  1O0R A;  2J0B A;  1H5R A;  2OEF A;  2VS3 A;  2CU2 A;  3IOI A;  4IRP A;  1NMM B;  3U2T A;  1FR9 A;  1VGW A;  2YC5 A;  5AJN A;  1NWG B;  1R7U A;  2WEE A;  3CGX A;  2D7I A;  1TZF A;  4CJ8 A;  2VK9 A;  1H5S A;  4FRQ A;  4D48 A;  3I0C A;  1PZY B;  2RIT A;  1V83 A;  2VD4 A;  4O6N A;  3U0Y A;  2MZB A;  4B4G A;  5CQM X;  2WVL A;  2I7B A;  2RJ8 A;  1ON8 A;  2Y7A A;  5C4C A;  2BO7 A;  5FV9 A;  1LL0 A;  1MP3 A;  2PA4 A;  3Q80 A;  4C2S A;  4HG6 A;  2XME A;  3D98 A;  4Y7G A;  3V0M A;  1GX0 A; 
#chains in the Genus database with same CATH homology
 1QGQ A;  3PNN A;  4HOC A;  4FRD A;  2JCO A;  4G3Q A;  4D0Z A;  2Y4J A;  3CKO A;  1H7G A;  3PKQ A;  4KXO A;  2JCJ A;  5C48 A;  3SPT A;  4J18 A;  4MIX A;  4YS8 A;  5C4B A;  1VGU A;  2ZU7 A;  4FIY A;  4Q7C A;  5EIY A;  3R3I A;  1WT0 A;  3USR A;  2V0H A;  4HO8 A;  1LZ0 A;  1QGS A;  3RMV A;  3OGZ A;  5BXC A;  1LVW A;  5C1L A;  4O6M A;  2RIX A;  1JV3 A;  3Q7U A;  2XMH A;  5EJZ A;  2Y4L A;  1VZX A;  2WAW A;  5FTV A;  1G2V A;  3FOQ A;  1G3L A;  1GA8 A;  2YQJ A;  4KC4 A;  2VS4 A;  3QVB A;  3JUJ A;  5DDV A;  5FUH A;  5EJ1 A;  1GWW A;  3V0O A;  2V0L A;  1NKH B;  1G93 A;  4MND A;  1KWS A;  4D11 A;  4EEA A;  2I5K A;  1G9R A;  4AYL A;  1I52 A;  4EE3 A;  5AJP A;  2VXL A;  2BO8 A;  3ZLK A;  1FXJ A;  1ZJ1 A;  3V0Q A;  1VZU A;  3E26 A;  1HJL A;  4HO4 A;  2QKX A;  3OH1 A;  2VS5 A;  1O23 B;  1VM8 A;  1V84 A;  1H5R B;  1S4N A;  2RJ0 A;  1WT3 A;  2P73 A;  3D5N A;  5IDS A;  4G87 A;  2GGO A;  1NF5 B;  2DPW A;  4ECM A;  1SS9 A;  2OI6 A;  2WGZ A;  5FU0 A;  3TZT A;  1H7L A;  2AM3 A;  1H5S B;  1LZ7 A;  5I1F A;  3IOH A;  3TQD A;  1S4O A;  3RSB A;  5DDT A;  4CJC A;  3V0N A;  1GWV A;  1S4P A;  4B42 A;  1FO8 A;  2D0J A;  1ON6 A;  1ZJ2 A;  4JIS A;  2V0K A;  2W0W A;  1FWY A;  1TW1 A;  3PKP A;  1YRO B;  1VH1 A;  5CMG X;  3SXG A;  4HO9 A;  2FYC B;  4EEO A;  5JQQ A;  4UEG A;  1ZCY A;  4EVW A;  2Q4J A;  5C38 A;  4CVH A;  5C1H A;  3HL3 A;  1H5S C;  1QG8 A;  2BO4 A;  3U2X A;  2AGD A;  4M4K A;  1W55 A;  4Y9X A;  2BO6 A;  1O7Q A;  1GQ9 A;  5C3A A;  1WVC A;  1VIC A;  5D91 A;  1YP4 A;  3I0F A;  4ASJ A;  3CKJ A;  2X5S A;  2AE7 A;  1ZDG A;  3V8Y A;  2ICY A;  1FGG A;  4XWI A;  1XZ6 A;  1NQI B;  3Q4S A;  1XHB A;  2VFZ A;  3LW6 A;  3V0L A;  2ZU8 A;  4FRH A;  1HJJ A;  4R7P A;  3OKR A;  4FRB A;  3SXD A;  2RJ7 A;  5J49 A;  4CJB A;  3F1C A;  3ZF8 A;  3SX3 A;  3U0X A;  5IDT A;  2OI7 A;  1TW5 A;  2JCK A;  3RMW A;  1G97 A;  1VGT A;  1R82 A;  5CMH A;  1IIN A;  4M2B A;  4Y6N A;  1H4E A;  4AAW A;  1G1L A;  1ZI4 A;  3I0K A;  3U2V A;  3U2U A;  1R80 A;  3IOJ A;  4KPZ A;  4MYB A;  4FRE A;  5C1G A;  4KC1 A;  1HM9 A;  3SXB A;  1FRW A;  2Z87 A;  3N9W A;  3T7O A;  3ST8 A;  1OMX A;  4P02 A;  2FY7 A;  1GX4 A;  3CU0 A;  2FYA A;  1V82 A;  2YQH A;  2AH9 A;  1R7T A;  4FRO A;  1FR8 A;  2PGV A;  5L6S A;  1ZCU A;  1VZT A;  1INI A;  4Y7V A;  4AYJ A;  4HO2 A;  4NAN A;  4FRP A;  1FOA A;  1JYL A;  2V0I A;  1VPA A;  2ICX A;  4KNR A;  4KRV A;  1E5K A;  4FQW A;  4JD0 A;  4M2A A;  2O1G A;  2P6W A;  3K8E A;  2Y6P A;  2OEG A;  1WT2 A;  3V8Z A;  2PX7 A;  4LW3 A;  3SX7 A;  3CKN A;  5C47 A;  1W77 A;  2A8W A;  3CKV A;  1ZHJ A;  2FFV A;  2ZU9 A;  1WSZ A;  2VXM A;  3BCV A;  3OH3 A;  4Y63 A;  1H7Q A;  1H7H A;  1EYR A;  4FRL A;  1WT1 A;  3T7N A;  4ASY A;  2E8B A;  5C4E A;  3SXA A;  1ZJO A;  1YP2 A;  2X65 A;  2XWM A;  1R7X A;  3DK5 A;  4G3P A;  4B2X A;  1G8O A;  2X5Z A;  4B2W A;  1H3M A;  1FXO A;  5CQL X;  2AEC A;  2QH5 A;  1VGZ A;  4HO3 A;  1G23 A;  2QGI A;  3SXC A;  1ZI5 A;  2YC3 A;  1ZI1 A;  1INJ A;  3T7M A;  2FYD B;  1HM0 A;  3OC9 A;  1OMZ A;  1G0R A;  2RJ1 A;  3V91 A;  2V0J A;  2YES A;  4GBP A;  2RIY A;  5C36 A;  5IFY A;  4D0T A;  4Y6U A;  3E25 A;  5C8R A;  2FFU A;  1O7O A;  2X60 A;  3R2W A;  1R7V A;  1EZI A;  2Y4M A;  4FRA A;  4E1K A;  2RJ5 A;  4EE4 A;  1R7Y A;  4IRQ A;  1H5T A;  3O3P A;  3USQ A;  4B4B A;  4Y64 A;  1YP3 A;  1LZI A;  1R81 A;  1NHE B;  4BMA A;  4Y7U A;  4LW6 A;  4ARW A;  5CMJ A;  1VH3 A;  4KPX A;  4DE7 A;  1JVG A;  1QWJ A;  4DDZ A;  2E3D A;  1FO9 A;  4B4M A;  4NAK A;  4FRM A;  4DEC A;  2RIZ A;  4FCE A;  3SX8 A;  1FGX A;  1K4V A;  1LZJ A;  1MP4 A;  1FG5 N;  3ZLL A;  3V0P A;  2GGQ A;  1GQC A;  1H7F A;  1OQM B;  3OH4 A;  4KNX A;  5FYE A;  4G3S A;  1ZCV A;  3I0L A;  1TVY A;  5CQO A;  1JYK A;  3CKQ A;  4ZDQ A;  1HV9 A;  2APC A;  4FCU A;  1H7E A;  5CQN X;  2O1H A;  1H4C A;  3ZGF A;  5C3B A;  1MC3 A;  3NGW A;  2XWL A;  3OH0 A;  3I0J A;  5C4F A;  3U2W A;  1MP5 A;  3DUV A;  3KIA A;  2JCL A;  3BRK X;  2A8U A;  1ZDF A;  5C49 A;  3ZGG A;  5AJO A;  2FYB A;  4KQL A;  2UX8 A;  2O1F A;  4L41 C;  4KC2 A;  2YCM A;  3I0G A;  4EEG A;  1ZCT A;  1ZIZ A;  2P72 A;  2WE9 A;  4HO5 A;  4Y7T A;  5D92 A;  2RJ9 A;  3I0D A;  4D11 C;  3POL A;  1Z90 A;  1H5S D;  3SX5 A;  2WVM A;  5CMI A;  2J0A A;  2AES A;  1LL3 A;  3DJ4 A;  5CQP A;  1G95 A;  4FIX A;  5C3D A;  3F1Y A;  4B3U A;  1JVD A;  2Z86 A;  1FZW A;  2WVK A;  3JTJ A;  3JUK A;  4EEM A;  4EE5 A;  4AC3 A;  4KT7 A;  3SXE A;  3OH2 A;  3GUE A;  2VSH A;  3I0H A;  2VSI A;  1ZJ3 A;  3K8D A;  4Y7F A;  4HO0 A;  3V90 A;  4HCQ A;  4M28 A;  1IIM A;  3I0E A;  4P00 A;  5FU8 A;  2PGY A;  2D7R A;  2I5E A;  2W0V A;  4BQH A;  2RJ6 A;  5HS2 A;  2Y4K A;  3I0I X;  4NAL A;  1PZT A;  5L6V A;  4NAI A;  2YQC A;  1ZI3 A;  1ZJ0 A;  1LL2 A;  1W57 A;  2C0N A;  5FTS A;  2YQS A;  1H7T A;  1H4D A;  2NXV A;  5C4D A;  2AM5 A;  1H5T B;  4HO6 A;  2RJ4 A;  4Y62 A;  4K6R A;  5CMF X;  4B5B A;  2AM4 A;  1ZJP A;  3EE5 A;  1HM8 A;  3D8V A;  3FWW A;  3OAM A;  2OI5 A;  2XWN A;  1JV1 A;  1O0R A;  2J0B A;  1H5R A;  2OEF A;  2VS3 A;  2CU2 A;  3IOI A;  4IRP A;  1NMM B;  3U2T A;  1FR9 A;  1VGW A;  2YC5 A;  5AJN A;  1NWG B;  1R7U A;  2WEE A;  3CGX A;  2D7I A;  1TZF A;  4CJ8 A;  2VK9 A;  1H5S A;  4FRQ A;  4D48 A;  3I0C A;  1PZY B;  2RIT A;  1V83 A;  2VD4 A;  4O6N A;  3U0Y A;  2MZB A;  4B4G A;  5CQM X;  2WVL A;  2I7B A;  2RJ8 A;  1ON8 A;  2Y7A A;  5C4C A;  2BO7 A;  5FV9 A;  1LL0 A;  1MP3 A;  2PA4 A;  3Q80 A;  4C2S A;  4HG6 A;  2XME A;  3D98 A;  4Y7G A;  3V0M A;  1GX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...