2XWMA

Crystal structure of ispd from mycobacterium smegmatis in complex with cmp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
ATVAVVPAAGSGERLRAGRPKAFVTLGGTPLLEHALSGLRASGVIDRIVIAVPPALTDESKLVFGGEDSVIVSGGVDRTESVALALEAAGDAEFVLVHDAARALTPPALIARVVAALKEGHSAVVPGLAPADTIKAVDANGAVLGTPERAGLRAVQTPQGFHADVLRRAYARATAGGVTDDASLVEQLGTPVQIVDGDPLAFKITTPLDLVLAEAVLAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRANSFERASE
publication title Structural and Functional Studies on Mycobacterial Ispd Enzymes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2010-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2xwmA00
3T7MA 1V84A 1FO8A 2RJ4A 4HCQA 5HS2A 5AJPA 2XMEA 1FR8A 1ZCTA 2VFZA 4AAWA 5CQPA 3U2VA 1IINA 1TVYA 5FTSA 3USRA 4FRQA 1ZJPA 1MP3A 1Z90A 1ZI5A 4KNXA 1W57A 2ZU7A 1INJA 4IRPA 2RIXA 3I0IX 3U2TA 2AE7A 4D11A 1ZCUA 2D0JA 5FUHA 2VS4A 3POLA 1ZJ1A 5C47A 3USQA 4KNRA 1PZYB 1V82A 1VM8A 2JCOA 4BQHA 3IOJA 1PZTA 4G87A 3SXEA 1ZI1A 1JV3A 3V91A 1KWSA 2FYCB 3K8EA 2AM4A 5IDSA 1OMZA 1MC3A 2YQSA 1R7XA 1R82A 5CQOA 2GGOA 1FXJA 1H5RB 1JVDA 2RJ0A 3SXBA 1VGWA 3RMVA 2YC5A 2OI6A 3DUVA 1VZUA 5JQQA 1H4CA 1E5KA 4D48A 5C1GA 3OH4A 4EEAA 5CQLX 2AGDA 2YESA 1R80A 2JCLA 1R7UA 4MNDA 4P02A 2AM5A 4Y6UA 1INIA 3V8ZA 1HM8A 2OEGA 1K4VA 1TW1A 2XMHA 4JISA 4DDZA 2W0VA 2RJ9A 4EE5A 3R2WA 1ZCYA 5IFYA 3OH0A 5CMIA 3OH1A 1EYRA 1ZJ2A 5C48A 1JYLA 4ECMA 2FYDB 2OI5A 4FROA 2P73A 2QKXA 1VZXA 2FYBA 4EEMA 1VICA 3U0XA 3TQDA 1G2VA 5L6VA 1GX0A 1ZI4A 3OKRA 1ZI3A 2WAWA 1G97A 4FRMA 2D7IA 3I0LA 2E3DA 4FCEA 4FCUA 3U2UA 1NF5B 2WVKA 3U2WA 1TW5A 4R7PA 3CU0A 1NMMB 1JVGA 3SX5A 2RJ8A 1HV9A 1FR9A 1LZ7A 2QH5A 3Q4SA 1H5TB 1VGZA 1FO9A 1O7OA 2Y4MA 1FRWA 2WVLA 3IOIA 1H7TA 4Y7VA 5C8RA 1H5SB 3V0QA 4KXOA 5CMFX 2I5KA 2VS3A 3DJ4A 2D7RA 1R7TA 4G3QA 4KC2A 2XWMA 1WT3A 4IRQA 1TZFA 4Y63A 1H7LA 2VS5A 2WE9A 2PGVA 3CKNA 3IOHA 1ON8A 4HO3A 4C2SA 4KT7A 3LW6A 4M4KA 5C3AA 3ZGFA 4NALA 2APCA 1LL0A 2GGQA 1HJLA 5DDTA 5C4CA 1ZJOA 2AM3A 2VXLA 5CMHA 4FRDA 5EJ1A 1G0RA 4B4GA 3N9WA 1ZDFA 4CVHA 2V0IA 5FV9A 4EEOA 1ON6A 1O7QA 4Y7TA 3I0KA 1W77A 2YQHA 5CQNX 1H4DA 1MP4A 4G3SA 2E8BA 2Q4JA 1R81A 3K8DA 3T7OA 1HM9A 2ZU8A 4LW3A 1ZJ3A 2RITA 3I0HA 3D98A 3ZLLA 1HJJA 5C4FA 2ICYA 2W0WA 2VXMA 3E25A 3JUJA 2X5SA 3ZF8A 4D11C 3GUEA 2FYAA 2A8WA 1ZJ0A 1S4NA 2BO6A 2YCMA 4B3UA 1YP2A 4EE3A 3CGXA 5DDVA 2X60A 4YS8A 2AESA 2Z87A 3I0CA 1HM0A 3CKVA 2I5EA 5C4EA 4B2WA 2RIZA 3Q80A 2PGYA 3I0GA 4HO4A 1WT1A 3DK5A 4GBPA 4ASYA 4EEGA 3D8VA 1QGSA 3V0PA 5FTVA 1QGQA 2YQCA 3PNNA 1QG8A 1ZCVA 1O23B 2OI7A 3D5NA 2WGZA 1NHEB 4Y6NA 4HG6A 3TZTA 2WEEA 4B4MA 2A8UA 1YP4A 3RSBA 4HO9A 2X5ZA 2QGIA 3I0JA 4MYBA 1O0RA 5C38A 2Z86A 3BCVA 5I1FA 5C3DA 4J18A 4E1KA 3V0OA 4M28A 4FRBA 1VH1A 5BXCA 2YC3A 2P72A 1ZIZA 4Y64A 3SXAA 1H5RA 3F1CA 4D0ZA 1ZDGA 4KPXA 2MZBA 5FYEA 3Q7UA 4NANA 3I0FA 3BRKX 1GX4A 3V90A 4FRAA 5IDTA 1G95A 1H7EA 1GWVA 2NXVA 1H7QA 4NAKA 1EZIA 3HL3A 3JUKA 2AH9A 5C4BA 1LL3A 4NAIA 3OC9A 3ZLKA 1H7FA 4KPZA 2RJ6A 3OAMA 3SXCA 2Y7AA 5L6SA 5C1LA 4ARWA 4Y7FA 3V0NA 4AC3A 2BO8A 1WVCA 2JCJA 2ZU9A 3CKOA 3V0MA 2FFUA 1XHBA 4M2AA 4B2XA 4Y9XA 4CJ8A 1FXOA 1V83A 5AJOA 3T7NA 3ST8A 3QVBA 3R3IA 1SS9A 4P00A 3I0DA 1W55A 2YQJA 3JTJA 4FRHA 4HO2A 2RJ1A 2VD4A 5J49A 2XWNA 3U2XA 4M2BA 1IIMA 4Y7UA 4KRVA 3SPTA 4XWIA 1G9RA 5FU8A 4B4BA 4JD0A 2FFVA 1LZJA 2UX8A 3V0LA 3OH3A 2Y4JA 1LZ0A 1FWYA 1NKHB 5C3BA 5AJNA 4FQWA 1NQIB 1FGXA 1GQCA 1FOAA 5FU0A 2FY7A 1H5TA 1GA8A 5CQMX 2V0KA 1WT0A 4FRLA 4HO6A 1H7GA 1LZIA 4DECA 1WSZA 5EIYA 5C1HA 1H5SA 3FWWA 1FG5N 2Y4LA 1G93A 5CMJA 2RIYA 2RJ5A 4ZDQA 1GWWA 4HO8A 3SX3A 1WT2A 2BO4A 3SXGA 4DE7A 2CU2A 1G8OA 4FREA 4AYLA 4KC1A 2DPWA 3OH2A 2P6WA 4Y62A 5CMGX 1GQ9A 3KIAA 4G3PA 3I0EA 3NGWA 4FRPA 3SX7A 4BMAA 1H4EA 1S4OA 2V0LA 2O1GA 4CJBA 4CJCA 3FOQA 1H5SC 1OMXA 2RJ7A 2O1FA 4LW6A 1JV1A 2AECA 1LL2A 1FZWA 3O3PA 1OQMB 2WVMA 4KQLA 2O1HA 1VH3A 1S4PA 1ZHJA 2I7BA 1VZTA 2OEFA 1YROB 3F1YA 3PKQA 1G1LA 2Y4KA 4D0TA 1VGTA 3V8YA 4B42A 2BO7A 3EE5A 3OGZA 4AYJA 4HOCA 1H5SD 3SX8A 2X65A 1YP3A 2VSIA 2Y6PA 2JCKA 4KC4A 3SXDA 1VPAA 2V0HA 5EJZA 2PX7A 1R7VA 3CKJA 1JYKA 2VSHA 1H7HA 2V0JA 1G3LA 2PA4A 3E26A 3U0YA 4UEGA 4B5BA 1QWJA 4L41C 2XWLA 3ZGGA 1FGGA 4ASJA 5C4DA 5C36A 3PKPA 3CKQA 4EE4A 1R7YA 1H3MA 1XZ6A 4HO0A 3RMWA 1VGUA 4EVWA 1G23A 1I52A 1NWGB 4K6RA 4Y7GA 2ICXA 1LVWA 5C49A 4HO5A 1MP5A
chains in the Genus database with same CATH superfamily
3T7MA 1V84A 1FO8A 2RJ4A 4HCQA 5HS2A 5AJPA 2XMEA 1FR8A 1ZCTA 2VFZA 4AAWA 2J0BA 5CQPA 3U2VA 1IINA 1TVYA 5FTSA 3USRA 4FRQA 1ZJPA 1MP3A 1Z90A 1ZI5A 4KNXA 1W57A 2ZU7A 1INJA 4IRPA 2RIXA 3I0IX 3U2TA 2AE7A 4D11A 1ZCUA 2D0JA 5FUHA 2VS4A 2C0NA 3POLA 1ZJ1A 5C47A 3USQA 4KNRA 1PZYB 1V82A 1VM8A 2JCOA 4BQHA 3IOJA 1PZTA 4G87A 3SXEA 1ZI1A 1JV3A 3V91A 1KWSA 2FYCB 3K8EA 2AM4A 5IDSA 1OMZA 1MC3A 2YQSA 1R7XA 1R82A 5CQOA 2GGOA 1FXJA 1H5RB 1JVDA 2J0AA 2RJ0A 3SXBA 1VGWA 3RMVA 2YC5A 2OI6A 3DUVA 1VZUA 5JQQA 1H4CA 1E5KA 4O6NA 4D48A 5C1GA 3OH4A 4EEAA 5CQLX 2AGDA 2YESA 1R80A 2JCLA 1R7UA 4MNDA 4P02A 2AM5A 4Y6UA 1INIA 3V8ZA 1HM8A 2OEGA 1K4VA 1TW1A 2XMHA 4JISA 4DDZA 2W0VA 2RJ9A 4EE5A 3R2WA 1ZCYA 5IFYA 3OH0A 5CMIA 3OH1A 1EYRA 1ZJ2A 5C48A 1JYLA 4ECMA 2FYDB 2OI5A 4FROA 2P73A 2QKXA 1VZXA 2FYBA 4EEMA 1VICA 3U0XA 3TQDA 1G2VA 5L6VA 1GX0A 1ZI4A 3OKRA 1ZI3A 2WAWA 1G97A 4FRMA 2D7IA 3I0LA 2E3DA 4FCEA 4FCUA 3U2UA 1NF5B 2WVKA 3U2WA 1TW5A 4R7PA 3CU0A 1NMMB 1JVGA 3SX5A 2RJ8A 1HV9A 1FR9A 1LZ7A 2QH5A 3Q4SA 1H5TB 1VGZA 1FO9A 1O7OA 2Y4MA 1FRWA 2WVLA 3IOIA 2VK9A 1H7TA 4Y7VA 5C8RA 1H5SB 3V0QA 4KXOA 5CMFX 2I5KA 2VS3A 3DJ4A 2D7RA 1R7TA 4G3QA 4KC2A 2XWMA 1WT3A 4IRQA 1TZFA 4Y63A 1H7LA 2VS5A 2WE9A 2PGVA 3CKNA 3IOHA 1ON8A 4HO3A 4C2SA 4KT7A 3LW6A 4M4KA 5C3AA 3ZGFA 4NALA 2APCA 1LL0A 2GGQA 1HJLA 5DDTA 5C4CA 1ZJOA 2AM3A 2VXLA 5CMHA 4FRDA 5EJ1A 1G0RA 4B4GA 3N9WA 1ZDFA 4CVHA 2V0IA 5FV9A 4EEOA 1ON6A 1O7QA 4Y7TA 3I0KA 1W77A 2YQHA 5CQNX 1H4DA 1MP4A 4G3SA 2E8BA 2Q4JA 1R81A 3K8DA 3T7OA 1HM9A 2ZU8A 4LW3A 1ZJ3A 2RITA 3I0HA 3D98A 3ZLLA 1HJJA 5C4FA 2ICYA 2W0WA 2VXMA 3E25A 3JUJA 2X5SA 3ZF8A 4D11C 3GUEA 2FYAA 2A8WA 1ZJ0A 1S4NA 2BO6A 2YCMA 4B3UA 1YP2A 4EE3A 3CGXA 5DDVA 2X60A 4YS8A 2AESA 2Z87A 3I0CA 1HM0A 3CKVA 2I5EA 5C4EA 4B2WA 2RIZA 3Q80A 2PGYA 3I0GA 4HO4A 1WT1A 3DK5A 4GBPA 4ASYA 4EEGA 3D8VA 1QGSA 3V0PA 5FTVA 1QGQA 2YQCA 3PNNA 1QG8A 1ZCVA 1O23B 2OI7A 3D5NA 2WGZA 4O6MA 1NHEB 4Y6NA 4HG6A 3TZTA 2WEEA 4B4MA 2A8UA 1YP4A 3RSBA 4HO9A 2X5ZA 2QGIA 3I0JA 4MYBA 1O0RA 5C38A 2Z86A 3BCVA 5I1FA 5C3DA 4J18A 4E1KA 3V0OA 4M28A 4FRBA 5D91A 1VH1A 5BXCA 2YC3A 2P72A 1ZIZA 4Y64A 3SXAA 1H5RA 3F1CA 4D0ZA 1ZDGA 4KPXA 2MZBA 5FYEA 3Q7UA 4NANA 3I0FA 3BRKX 1GX4A 3V90A 4FRAA 5IDTA 1G95A 1H7EA 1GWVA 5D92A 2NXVA 1H7QA 4NAKA 1EZIA 3HL3A 3JUKA 2AH9A 5C4BA 1LL3A 4NAIA 3OC9A 3ZLKA 1H7FA 4KPZA 2RJ6A 3OAMA 3SXCA 2Y7AA 5L6SA 5C1LA 4ARWA 4Y7FA 3V0NA 4AC3A 2BO8A 1WVCA 2JCJA 2ZU9A 3CKOA 3V0MA 2FFUA 1XHBA 4M2AA 4B2XA 4Y9XA 4CJ8A 1FXOA 1V83A 5AJOA 3T7NA 3ST8A 3QVBA 3R3IA 1SS9A 4P00A 3I0DA 1W55A 2YQJA 3JTJA 4FRHA 4HO2A 2RJ1A 2VD4A 5J49A 2XWNA 3U2XA 4M2BA 1IIMA 4Y7UA 4KRVA 3SPTA 4XWIA 1G9RA 5FU8A 4FIYA 4B4BA 4JD0A 2FFVA 1LZJA 2UX8A 3V0LA 3OH3A 2Y4JA 1LZ0A 1FWYA 1NKHB 5C3BA 5AJNA 4FQWA 1NQIB 1FGXA 1GQCA 1FOAA 5FU0A 2FY7A 1H5TA 1GA8A 5CQMX 2V0KA 1WT0A 4FRLA 4HO6A 1H7GA 1LZIA 4DECA 1WSZA 5EIYA 5C1HA 1H5SA 3FWWA 1FG5N 2Y4LA 1G93A 5CMJA 2RIYA 2RJ5A 4ZDQA 1GWWA 4HO8A 3SX3A 1WT2A 2BO4A 3SXGA 4DE7A 4Q7CA 2CU2A 1G8OA 4FREA 4AYLA 4KC1A 2DPWA 3OH2A 2P6WA 4Y62A 5CMGX 1GQ9A 3KIAA 4G3PA 3I0EA 4FIXA 3NGWA 4FRPA 3SX7A 4BMAA 1H4EA 1S4OA 2V0LA 2O1GA 4CJBA 4CJCA 3FOQA 1H5SC 1OMXA 2RJ7A 2O1FA 4LW6A 1JV1A 2AECA 1LL2A 1FZWA 3O3PA 1OQMB 2WVMA 4KQLA 2O1HA 1VH3A 1S4PA 1ZHJA 2I7BA 1VZTA 2OEFA 1YROB 3F1YA 3PKQA 1G1LA 2Y4KA 4D0TA 1VGTA 3V8YA 4B42A 2BO7A 3EE5A 3OGZA 4AYJA 4MIXA 4HOCA 1H5SD 3SX8A 2X65A 1YP3A 2VSIA 2Y6PA 2JCKA 4KC4A 3SXDA 1VPAA 2V0HA 5EJZA 2PX7A 1R7VA 3CKJA 1JYKA 2VSHA 1H7HA 2V0JA 1G3LA 2PA4A 3E26A 3U0YA 4UEGA 4B5BA 1QWJA 4L41C 2XWLA 3ZGGA 1FGGA 4ASJA 5C4DA 5C36A 3PKPA 3CKQA 4EE4A 1R7YA 1H3MA 1XZ6A 4HO0A 3RMWA 1VGUA 4EVWA 1G23A 1I52A 1NWGB 4K6RA 4Y7GA 2ICXA 1LVWA 5C49A 4HO5A 1MP5A
chains in the Genus database with same CATH topology
3T7MA 1V84A 1FO8A 2RJ4A 4HCQA 5HS2A 5AJPA 2XMEA 1FR8A 1ZCTA 2VFZA 4AAWA 2J0BA 5CQPA 3U2VA 1IINA 1TVYA 5FTSA 3USRA 4FRQA 1ZJPA 1MP3A 1Z90A 1ZI5A 4KNXA 1W57A 2ZU7A 1INJA 4IRPA 2RIXA 3I0IX 3U2TA 2AE7A 4D11A 1ZCUA 2D0JA 5FUHA 2VS4A 2C0NA 3POLA 1ZJ1A 5C47A 3USQA 4KNRA 1PZYB 1V82A 1VM8A 2JCOA 4BQHA 3IOJA 1PZTA 4G87A 3SXEA 1ZI1A 1JV3A 3V91A 1KWSA 2FYCB 3K8EA 2AM4A 5IDSA 1OMZA 1MC3A 2YQSA 1R7XA 1R82A 5CQOA 2GGOA 1FXJA 1H5RB 1JVDA 2J0AA 2RJ0A 3SXBA 1VGWA 3RMVA 2YC5A 2OI6A 3DUVA 1VZUA 5JQQA 1H4CA 1E5KA 4O6NA 4D48A 5C1GA 3OH4A 4EEAA 5CQLX 2AGDA 2YESA 1R80A 2JCLA 1R7UA 4MNDA 4P02A 2AM5A 4Y6UA 1INIA 3V8ZA 1HM8A 2OEGA 1K4VA 1TW1A 2XMHA 4JISA 4DDZA 2W0VA 2RJ9A 4EE5A 3R2WA 1ZCYA 5IFYA 3OH0A 5CMIA 3OH1A 1EYRA 1ZJ2A 5C48A 1JYLA 4ECMA 2FYDB 2OI5A 4FROA 2P73A 2QKXA 1VZXA 2FYBA 4EEMA 1VICA 3U0XA 3TQDA 1G2VA 5L6VA 1GX0A 1ZI4A 3OKRA 1ZI3A 2WAWA 1G97A 4FRMA 2D7IA 3I0LA 2E3DA 4FCEA 4FCUA 3U2UA 1NF5B 2WVKA 3U2WA 1TW5A 4R7PA 3CU0A 1NMMB 1JVGA 3SX5A 2RJ8A 1HV9A 1FR9A 1LZ7A 2QH5A 3Q4SA 1H5TB 1VGZA 1FO9A 1O7OA 2Y4MA 1FRWA 2WVLA 3IOIA 2VK9A 1H7TA 4Y7VA 5C8RA 1H5SB 3V0QA 4KXOA 5CMFX 2I5KA 2VS3A 3DJ4A 2D7RA 1R7TA 4G3QA 4KC2A 2XWMA 1WT3A 4IRQA 1TZFA 4Y63A 1H7LA 2VS5A 2WE9A 2PGVA 3CKNA 3IOHA 1ON8A 4HO3A 4C2SA 4KT7A 3LW6A 4M4KA 5C3AA 3ZGFA 4NALA 2APCA 1LL0A 2GGQA 1HJLA 5DDTA 5C4CA 1ZJOA 2AM3A 2VXLA 5CMHA 4FRDA 5EJ1A 1G0RA 4B4GA 3N9WA 1ZDFA 4CVHA 2V0IA 5FV9A 4EEOA 1ON6A 1O7QA 4Y7TA 3I0KA 1W77A 2YQHA 5CQNX 1H4DA 1MP4A 4G3SA 2E8BA 2Q4JA 1R81A 3K8DA 3T7OA 1HM9A 2ZU8A 4LW3A 1ZJ3A 2RITA 3I0HA 3D98A 3ZLLA 1HJJA 5C4FA 2ICYA 2W0WA 2VXMA 3E25A 3JUJA 2X5SA 3ZF8A 4D11C 3GUEA 2FYAA 2A8WA 1ZJ0A 1S4NA 2BO6A 2YCMA 4B3UA 1YP2A 4EE3A 3CGXA 5DDVA 2X60A 4YS8A 2AESA 2Z87A 3I0CA 1HM0A 3CKVA 2I5EA 5C4EA 4B2WA 2RIZA 3Q80A 2PGYA 3I0GA 4HO4A 1WT1A 3DK5A 4GBPA 4ASYA 4EEGA 3D8VA 1QGSA 3V0PA 5FTVA 1QGQA 2YQCA 3PNNA 1QG8A 1ZCVA 1O23B 2OI7A 3D5NA 2WGZA 4O6MA 1NHEB 4Y6NA 4HG6A 3TZTA 2WEEA 4B4MA 2A8UA 1YP4A 3RSBA 4HO9A 2X5ZA 2QGIA 3I0JA 4MYBA 1O0RA 5C38A 2Z86A 3BCVA 5I1FA 5C3DA 4J18A 4E1KA 3V0OA 4M28A 4FRBA 5D91A 1VH1A 5BXCA 2YC3A 2P72A 1ZIZA 4Y64A 3SXAA 1H5RA 3F1CA 4D0ZA 1ZDGA 4KPXA 2MZBA 5FYEA 3Q7UA 4NANA 3I0FA 3BRKX 1GX4A 3V90A 4FRAA 5IDTA 1G95A 1H7EA 1GWVA 5D92A 2NXVA 1H7QA 4NAKA 1EZIA 3HL3A 3JUKA 2AH9A 5C4BA 1LL3A 4NAIA 3OC9A 3ZLKA 1H7FA 4KPZA 2RJ6A 3OAMA 3SXCA 2Y7AA 5L6SA 5C1LA 4ARWA 4Y7FA 3V0NA 4AC3A 2BO8A 1WVCA 2JCJA 2ZU9A 3CKOA 3V0MA 2FFUA 1XHBA 4M2AA 4B2XA 4Y9XA 4CJ8A 1FXOA 1V83A 5AJOA 3T7NA 3ST8A 3QVBA 3R3IA 1SS9A 4P00A 3I0DA 1W55A 2YQJA 3JTJA 4FRHA 4HO2A 2RJ1A 2VD4A 5J49A 2XWNA 3U2XA 4M2BA 1IIMA 4Y7UA 4KRVA 3SPTA 4XWIA 1G9RA 5FU8A 4FIYA 4B4BA 4JD0A 2FFVA 1LZJA 2UX8A 3V0LA 3OH3A 2Y4JA 1LZ0A 1FWYA 1NKHB 5C3BA 5AJNA 4FQWA 1NQIB 1FGXA 1GQCA 1FOAA 5FU0A 2FY7A 1H5TA 1GA8A 5CQMX 2V0KA 1WT0A 4FRLA 4HO6A 1H7GA 1LZIA 4DECA 1WSZA 5EIYA 5C1HA 1H5SA 3FWWA 1FG5N 2Y4LA 1G93A 5CMJA 2RIYA 2RJ5A 4ZDQA 1GWWA 4HO8A 3SX3A 1WT2A 2BO4A 3SXGA 4DE7A 4Q7CA 2CU2A 1G8OA 4FREA 4AYLA 4KC1A 2DPWA 3OH2A 2P6WA 4Y62A 5CMGX 1GQ9A 3KIAA 4G3PA 3I0EA 4FIXA 3NGWA 4FRPA 3SX7A 4BMAA 1H4EA 1S4OA 2V0LA 2O1GA 4CJBA 4CJCA 3FOQA 1H5SC 1OMXA 2RJ7A 2O1FA 4LW6A 1JV1A 2AECA 1LL2A 1FZWA 3O3PA 1OQMB 2WVMA 4KQLA 2O1HA 1VH3A 1S4PA 1ZHJA 2I7BA 1VZTA 2OEFA 1YROB 3F1YA 3PKQA 1G1LA 2Y4KA 4D0TA 1VGTA 3V8YA 4B42A 2BO7A 3EE5A 3OGZA 4AYJA 4MIXA 4HOCA 1H5SD 3SX8A 2X65A 1YP3A 2VSIA 2Y6PA 2JCKA 4KC4A 3SXDA 1VPAA 2V0HA 5EJZA 2PX7A 1R7VA 3CKJA 1JYKA 2VSHA 1H7HA 2V0JA 1G3LA 2PA4A 3E26A 3U0YA 4UEGA 4B5BA 1QWJA 4L41C 2XWLA 3ZGGA 1FGGA 4ASJA 5C4DA 5C36A 3PKPA 3CKQA 4EE4A 1R7YA 1H3MA 1XZ6A 4HO0A 3RMWA 1VGUA 4EVWA 1G23A 1I52A 1NWGB 4K6RA 4Y7GA 2ICXA 1LVWA 5C49A 4HO5A 1MP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T7M A;  1V84 A;  1FO8 A;  2RJ4 A;  4HCQ A;  5HS2 A;  5AJP A;  2XME A;  1FR8 A;  1ZCT A;  2VFZ A;  4AAW A;  5CQP A;  3U2V A;  1IIN A;  1TVY A;  5FTS A;  3USR A;  4FRQ A;  1ZJP A;  1MP3 A;  1Z90 A;  1ZI5 A;  4KNX A;  1W57 A;  2ZU7 A;  1INJ A;  4IRP A;  2RIX A;  3I0I X;  3U2T A;  2AE7 A;  4D11 A;  1ZCU A;  2D0J A;  5FUH A;  2VS4 A;  3POL A;  1ZJ1 A;  5C47 A;  3USQ A;  4KNR A;  1PZY B;  1V82 A;  1VM8 A;  2JCO A;  4BQH A;  3IOJ A;  1PZT A;  4G87 A;  3SXE A;  1ZI1 A;  1JV3 A;  3V91 A;  1KWS A;  2FYC B;  3K8E A;  2AM4 A;  5IDS A;  1OMZ A;  1MC3 A;  2YQS A;  1R7X A;  1R82 A;  5CQO A;  2GGO A;  1FXJ A;  1H5R B;  1JVD A;  2RJ0 A;  3SXB A;  1VGW A;  3RMV A;  2YC5 A;  2OI6 A;  3DUV A;  1VZU A;  5JQQ A;  1H4C A;  1E5K A;  4D48 A;  5C1G A;  3OH4 A;  4EEA A;  5CQL X;  2AGD A;  2YES A;  1R80 A;  2JCL A;  1R7U A;  4MND A;  4P02 A;  2AM5 A;  4Y6U A;  1INI A;  3V8Z A;  1HM8 A;  2OEG A;  1K4V A;  1TW1 A;  2XMH A;  4JIS A;  4DDZ A;  2W0V A;  2RJ9 A;  4EE5 A;  3R2W A;  1ZCY A;  5IFY A;  3OH0 A;  5CMI A;  3OH1 A;  1EYR A;  1ZJ2 A;  5C48 A;  1JYL A;  4ECM A;  2FYD B;  2OI5 A;  4FRO A;  2P73 A;  2QKX A;  1VZX A;  2FYB A;  4EEM A;  1VIC A;  3U0X A;  3TQD A;  1G2V A;  5L6V A;  1GX0 A;  1ZI4 A;  3OKR A;  1ZI3 A;  2WAW A;  1G97 A;  4FRM A;  2D7I A;  3I0L A;  2E3D A;  4FCE A;  4FCU A;  3U2U A;  1NF5 B;  2WVK A;  3U2W A;  1TW5 A;  4R7P A;  3CU0 A;  1NMM B;  1JVG A;  3SX5 A;  2RJ8 A;  1HV9 A;  1FR9 A;  1LZ7 A;  2QH5 A;  3Q4S A;  1H5T B;  1VGZ A;  1FO9 A;  1O7O A;  2Y4M A;  1FRW A;  2WVL A;  3IOI A;  1H7T A;  4Y7V A;  5C8R A;  1H5S B;  3V0Q A;  4KXO A;  5CMF X;  2I5K A;  2VS3 A;  3DJ4 A;  2D7R A;  1R7T A;  4G3Q A;  4KC2 A;  2XWM A;  1WT3 A;  4IRQ A;  1TZF A;  4Y63 A;  1H7L A;  2VS5 A;  2WE9 A;  2PGV A;  3CKN A;  3IOH A;  1ON8 A;  4HO3 A;  4C2S A;  4KT7 A;  3LW6 A;  4M4K A;  5C3A A;  3ZGF A;  4NAL A;  2APC A;  1LL0 A;  2GGQ A;  1HJL A;  5DDT A;  5C4C A;  1ZJO A;  2AM3 A;  2VXL A;  5CMH A;  4FRD A;  5EJ1 A;  1G0R A;  4B4G A;  3N9W A;  1ZDF A;  4CVH A;  2V0I A;  5FV9 A;  4EEO A;  1ON6 A;  1O7Q A;  4Y7T A;  3I0K A;  1W77 A;  2YQH A;  5CQN X;  1H4D A;  1MP4 A;  4G3S A;  2E8B A;  2Q4J A;  1R81 A;  3K8D A;  3T7O A;  1HM9 A;  2ZU8 A;  4LW3 A;  1ZJ3 A;  2RIT A;  3I0H A;  3D98 A;  3ZLL A;  1HJJ A;  5C4F A;  2ICY A;  2W0W A;  2VXM A;  3E25 A;  3JUJ A;  2X5S A;  3ZF8 A;  4D11 C;  3GUE A;  2FYA A;  2A8W A;  1ZJ0 A;  1S4N A;  2BO6 A;  2YCM A;  4B3U A;  1YP2 A;  4EE3 A;  3CGX A;  5DDV A;  2X60 A;  4YS8 A;  2AES A;  2Z87 A;  3I0C A;  1HM0 A;  3CKV A;  2I5E A;  5C4E A;  4B2W A;  2RIZ A;  3Q80 A;  2PGY A;  3I0G A;  4HO4 A;  1WT1 A;  3DK5 A;  4GBP A;  4ASY A;  4EEG A;  3D8V A;  1QGS A;  3V0P A;  5FTV A;  1QGQ A;  2YQC A;  3PNN A;  1QG8 A;  1ZCV A;  1O23 B;  2OI7 A;  3D5N A;  2WGZ A;  1NHE B;  4Y6N A;  4HG6 A;  3TZT A;  2WEE A;  4B4M A;  2A8U A;  1YP4 A;  3RSB A;  4HO9 A;  2X5Z A;  2QGI A;  3I0J A;  4MYB A;  1O0R A;  5C38 A;  2Z86 A;  3BCV A;  5I1F A;  5C3D A;  4J18 A;  4E1K A;  3V0O A;  4M28 A;  4FRB A;  1VH1 A;  5BXC A;  2YC3 A;  2P72 A;  1ZIZ A;  4Y64 A;  3SXA A;  1H5R A;  3F1C A;  4D0Z A;  1ZDG A;  4KPX A;  2MZB A;  5FYE A;  3Q7U A;  4NAN A;  3I0F A;  3BRK X;  1GX4 A;  3V90 A;  4FRA A;  5IDT A;  1G95 A;  1H7E A;  1GWV A;  2NXV A;  1H7Q A;  4NAK A;  1EZI A;  3HL3 A;  3JUK A;  2AH9 A;  5C4B A;  1LL3 A;  4NAI A;  3OC9 A;  3ZLK A;  1H7F A;  4KPZ A;  2RJ6 A;  3OAM A;  3SXC A;  2Y7A A;  5L6S A;  5C1L A;  4ARW A;  4Y7F A;  3V0N A;  4AC3 A;  2BO8 A;  1WVC A;  2JCJ A;  2ZU9 A;  3CKO A;  3V0M A;  2FFU A;  1XHB A;  4M2A A;  4B2X A;  4Y9X A;  4CJ8 A;  1FXO A;  1V83 A;  5AJO A;  3T7N A;  3ST8 A;  3QVB A;  3R3I A;  1SS9 A;  4P00 A;  3I0D A;  1W55 A;  2YQJ A;  3JTJ A;  4FRH A;  4HO2 A;  2RJ1 A;  2VD4 A;  5J49 A;  2XWN A;  3U2X A;  4M2B A;  1IIM A;  4Y7U A;  4KRV A;  3SPT A;  4XWI A;  1G9R A;  5FU8 A;  4B4B A;  4JD0 A;  2FFV A;  1LZJ A;  2UX8 A;  3V0L A;  3OH3 A;  2Y4J A;  1LZ0 A;  1FWY A;  1NKH B;  5C3B A;  5AJN A;  4FQW A;  1NQI B;  1FGX A;  1GQC A;  1FOA A;  5FU0 A;  2FY7 A;  1H5T A;  1GA8 A;  5CQM X;  2V0K A;  1WT0 A;  4FRL A;  4HO6 A;  1H7G A;  1LZI A;  4DEC A;  1WSZ A;  5EIY A;  5C1H A;  1H5S A;  3FWW A;  1FG5 N;  2Y4L A;  1G93 A;  5CMJ A;  2RIY A;  2RJ5 A;  4ZDQ A;  1GWW A;  4HO8 A;  3SX3 A;  1WT2 A;  2BO4 A;  3SXG A;  4DE7 A;  2CU2 A;  1G8O A;  4FRE A;  4AYL A;  4KC1 A;  2DPW A;  3OH2 A;  2P6W A;  4Y62 A;  5CMG X;  1GQ9 A;  3KIA A;  4G3P A;  3I0E A;  3NGW A;  4FRP A;  3SX7 A;  4BMA A;  1H4E A;  1S4O A;  2V0L A;  2O1G A;  4CJB A;  4CJC A;  3FOQ A;  1H5S C;  1OMX A;  2RJ7 A;  2O1F A;  4LW6 A;  1JV1 A;  2AEC A;  1LL2 A;  1FZW A;  3O3P A;  1OQM B;  2WVM A;  4KQL A;  2O1H A;  1VH3 A;  1S4P A;  1ZHJ A;  2I7B A;  1VZT A;  2OEF A;  1YRO B;  3F1Y A;  3PKQ A;  1G1L A;  2Y4K A;  4D0T A;  1VGT A;  3V8Y A;  4B42 A;  2BO7 A;  3EE5 A;  3OGZ A;  4AYJ A;  4HOC A;  1H5S D;  3SX8 A;  2X65 A;  1YP3 A;  2VSI A;  2Y6P A;  2JCK A;  4KC4 A;  3SXD A;  1VPA A;  2V0H A;  5EJZ A;  2PX7 A;  1R7V A;  3CKJ A;  1JYK A;  2VSH A;  1H7H A;  2V0J A;  1G3L A;  2PA4 A;  3E26 A;  3U0Y A;  4UEG A;  4B5B A;  1QWJ A;  4L41 C;  2XWL A;  3ZGG A;  1FGG A;  4ASJ A;  5C4D A;  5C36 A;  3PKP A;  3CKQ A;  4EE4 A;  1R7Y A;  1H3M A;  1XZ6 A;  4HO0 A;  3RMW A;  1VGU A;  4EVW A;  1G23 A;  1I52 A;  1NWG B;  4K6R A;  4Y7G A;  2ICX A;  1LVW A;  5C49 A;  4HO5 A;  1MP5 A; 
#chains in the Genus database with same CATH topology
 3T7M A;  1V84 A;  1FO8 A;  2RJ4 A;  4HCQ A;  5HS2 A;  5AJP A;  2XME A;  1FR8 A;  1ZCT A;  2VFZ A;  4AAW A;  2J0B A;  5CQP A;  3U2V A;  1IIN A;  1TVY A;  5FTS A;  3USR A;  4FRQ A;  1ZJP A;  1MP3 A;  1Z90 A;  1ZI5 A;  4KNX A;  1W57 A;  2ZU7 A;  1INJ A;  4IRP A;  2RIX A;  3I0I X;  3U2T A;  2AE7 A;  4D11 A;  1ZCU A;  2D0J A;  5FUH A;  2VS4 A;  2C0N A;  3POL A;  1ZJ1 A;  5C47 A;  3USQ A;  4KNR A;  1PZY B;  1V82 A;  1VM8 A;  2JCO A;  4BQH A;  3IOJ A;  1PZT A;  4G87 A;  3SXE A;  1ZI1 A;  1JV3 A;  3V91 A;  1KWS A;  2FYC B;  3K8E A;  2AM4 A;  5IDS A;  1OMZ A;  1MC3 A;  2YQS A;  1R7X A;  1R82 A;  5CQO A;  2GGO A;  1FXJ A;  1H5R B;  1JVD A;  2J0A A;  2RJ0 A;  3SXB A;  1VGW A;  3RMV A;  2YC5 A;  2OI6 A;  3DUV A;  1VZU A;  5JQQ A;  1H4C A;  1E5K A;  4O6N A;  4D48 A;  5C1G A;  3OH4 A;  4EEA A;  5CQL X;  2AGD A;  2YES A;  1R80 A;  2JCL A;  1R7U A;  4MND A;  4P02 A;  2AM5 A;  4Y6U A;  1INI A;  3V8Z A;  1HM8 A;  2OEG A;  1K4V A;  1TW1 A;  2XMH A;  4JIS A;  4DDZ A;  2W0V A;  2RJ9 A;  4EE5 A;  3R2W A;  1ZCY A;  5IFY A;  3OH0 A;  5CMI A;  3OH1 A;  1EYR A;  1ZJ2 A;  5C48 A;  1JYL A;  4ECM A;  2FYD B;  2OI5 A;  4FRO A;  2P73 A;  2QKX A;  1VZX A;  2FYB A;  4EEM A;  1VIC A;  3U0X A;  3TQD A;  1G2V A;  5L6V A;  1GX0 A;  1ZI4 A;  3OKR A;  1ZI3 A;  2WAW A;  1G97 A;  4FRM A;  2D7I A;  3I0L A;  2E3D A;  4FCE A;  4FCU A;  3U2U A;  1NF5 B;  2WVK A;  3U2W A;  1TW5 A;  4R7P A;  3CU0 A;  1NMM B;  1JVG A;  3SX5 A;  2RJ8 A;  1HV9 A;  1FR9 A;  1LZ7 A;  2QH5 A;  3Q4S A;  1H5T B;  1VGZ A;  1FO9 A;  1O7O A;  2Y4M A;  1FRW A;  2WVL A;  3IOI A;  2VK9 A;  1H7T A;  4Y7V A;  5C8R A;  1H5S B;  3V0Q A;  4KXO A;  5CMF X;  2I5K A;  2VS3 A;  3DJ4 A;  2D7R A;  1R7T A;  4G3Q A;  4KC2 A;  2XWM A;  1WT3 A;  4IRQ A;  1TZF A;  4Y63 A;  1H7L A;  2VS5 A;  2WE9 A;  2PGV A;  3CKN A;  3IOH A;  1ON8 A;  4HO3 A;  4C2S A;  4KT7 A;  3LW6 A;  4M4K A;  5C3A A;  3ZGF A;  4NAL A;  2APC A;  1LL0 A;  2GGQ A;  1HJL A;  5DDT A;  5C4C A;  1ZJO A;  2AM3 A;  2VXL A;  5CMH A;  4FRD A;  5EJ1 A;  1G0R A;  4B4G A;  3N9W A;  1ZDF A;  4CVH A;  2V0I A;  5FV9 A;  4EEO A;  1ON6 A;  1O7Q A;  4Y7T A;  3I0K A;  1W77 A;  2YQH A;  5CQN X;  1H4D A;  1MP4 A;  4G3S A;  2E8B A;  2Q4J A;  1R81 A;  3K8D A;  3T7O A;  1HM9 A;  2ZU8 A;  4LW3 A;  1ZJ3 A;  2RIT A;  3I0H A;  3D98 A;  3ZLL A;  1HJJ A;  5C4F A;  2ICY A;  2W0W A;  2VXM A;  3E25 A;  3JUJ A;  2X5S A;  3ZF8 A;  4D11 C;  3GUE A;  2FYA A;  2A8W A;  1ZJ0 A;  1S4N A;  2BO6 A;  2YCM A;  4B3U A;  1YP2 A;  4EE3 A;  3CGX A;  5DDV A;  2X60 A;  4YS8 A;  2AES A;  2Z87 A;  3I0C A;  1HM0 A;  3CKV A;  2I5E A;  5C4E A;  4B2W A;  2RIZ A;  3Q80 A;  2PGY A;  3I0G A;  4HO4 A;  1WT1 A;  3DK5 A;  4GBP A;  4ASY A;  4EEG A;  3D8V A;  1QGS A;  3V0P A;  5FTV A;  1QGQ A;  2YQC A;  3PNN A;  1QG8 A;  1ZCV A;  1O23 B;  2OI7 A;  3D5N A;  2WGZ A;  4O6M A;  1NHE B;  4Y6N A;  4HG6 A;  3TZT A;  2WEE A;  4B4M A;  2A8U A;  1YP4 A;  3RSB A;  4HO9 A;  2X5Z A;  2QGI A;  3I0J A;  4MYB A;  1O0R A;  5C38 A;  2Z86 A;  3BCV A;  5I1F A;  5C3D A;  4J18 A;  4E1K A;  3V0O A;  4M28 A;  4FRB A;  5D91 A;  1VH1 A;  5BXC A;  2YC3 A;  2P72 A;  1ZIZ A;  4Y64 A;  3SXA A;  1H5R A;  3F1C A;  4D0Z A;  1ZDG A;  4KPX A;  2MZB A;  5FYE A;  3Q7U A;  4NAN A;  3I0F A;  3BRK X;  1GX4 A;  3V90 A;  4FRA A;  5IDT A;  1G95 A;  1H7E A;  1GWV A;  5D92 A;  2NXV A;  1H7Q A;  4NAK A;  1EZI A;  3HL3 A;  3JUK A;  2AH9 A;  5C4B A;  1LL3 A;  4NAI A;  3OC9 A;  3ZLK A;  1H7F A;  4KPZ A;  2RJ6 A;  3OAM A;  3SXC A;  2Y7A A;  5L6S A;  5C1L A;  4ARW A;  4Y7F A;  3V0N A;  4AC3 A;  2BO8 A;  1WVC A;  2JCJ A;  2ZU9 A;  3CKO A;  3V0M A;  2FFU A;  1XHB A;  4M2A A;  4B2X A;  4Y9X A;  4CJ8 A;  1FXO A;  1V83 A;  5AJO A;  3T7N A;  3ST8 A;  3QVB A;  3R3I A;  1SS9 A;  4P00 A;  3I0D A;  1W55 A;  2YQJ A;  3JTJ A;  4FRH A;  4HO2 A;  2RJ1 A;  2VD4 A;  5J49 A;  2XWN A;  3U2X A;  4M2B A;  1IIM A;  4Y7U A;  4KRV A;  3SPT A;  4XWI A;  1G9R A;  5FU8 A;  4FIY A;  4B4B A;  4JD0 A;  2FFV A;  1LZJ A;  2UX8 A;  3V0L A;  3OH3 A;  2Y4J A;  1LZ0 A;  1FWY A;  1NKH B;  5C3B A;  5AJN A;  4FQW A;  1NQI B;  1FGX A;  1GQC A;  1FOA A;  5FU0 A;  2FY7 A;  1H5T A;  1GA8 A;  5CQM X;  2V0K A;  1WT0 A;  4FRL A;  4HO6 A;  1H7G A;  1LZI A;  4DEC A;  1WSZ A;  5EIY A;  5C1H A;  1H5S A;  3FWW A;  1FG5 N;  2Y4L A;  1G93 A;  5CMJ A;  2RIY A;  2RJ5 A;  4ZDQ A;  1GWW A;  4HO8 A;  3SX3 A;  1WT2 A;  2BO4 A;  3SXG A;  4DE7 A;  4Q7C A;  2CU2 A;  1G8O A;  4FRE A;  4AYL A;  4KC1 A;  2DPW A;  3OH2 A;  2P6W A;  4Y62 A;  5CMG X;  1GQ9 A;  3KIA A;  4G3P A;  3I0E A;  4FIX A;  3NGW A;  4FRP A;  3SX7 A;  4BMA A;  1H4E A;  1S4O A;  2V0L A;  2O1G A;  4CJB A;  4CJC A;  3FOQ A;  1H5S C;  1OMX A;  2RJ7 A;  2O1F A;  4LW6 A;  1JV1 A;  2AEC A;  1LL2 A;  1FZW A;  3O3P A;  1OQM B;  2WVM A;  4KQL A;  2O1H A;  1VH3 A;  1S4P A;  1ZHJ A;  2I7B A;  1VZT A;  2OEF A;  1YRO B;  3F1Y A;  3PKQ A;  1G1L A;  2Y4K A;  4D0T A;  1VGT A;  3V8Y A;  4B42 A;  2BO7 A;  3EE5 A;  3OGZ A;  4AYJ A;  4MIX A;  4HOC A;  1H5S D;  3SX8 A;  2X65 A;  1YP3 A;  2VSI A;  2Y6P A;  2JCK A;  4KC4 A;  3SXD A;  1VPA A;  2V0H A;  5EJZ A;  2PX7 A;  1R7V A;  3CKJ A;  1JYK A;  2VSH A;  1H7H A;  2V0J A;  1G3L A;  2PA4 A;  3E26 A;  3U0Y A;  4UEG A;  4B5B A;  1QWJ A;  4L41 C;  2XWL A;  3ZGG A;  1FGG A;  4ASJ A;  5C4D A;  5C36 A;  3PKP A;  3CKQ A;  4EE4 A;  1R7Y A;  1H3M A;  1XZ6 A;  4HO0 A;  3RMW A;  1VGU A;  4EVW A;  1G23 A;  1I52 A;  1NWG B;  4K6R A;  4Y7G A;  2ICX A;  1LVW A;  5C49 A;  4HO5 A;  1MP5 A; 
#chains in the Genus database with same CATH homology
 3T7M A;  1V84 A;  1FO8 A;  2RJ4 A;  4HCQ A;  5HS2 A;  5AJP A;  2XME A;  1FR8 A;  1ZCT A;  2VFZ A;  4AAW A;  2J0B A;  5CQP A;  3U2V A;  1IIN A;  1TVY A;  5FTS A;  3USR A;  4FRQ A;  1ZJP A;  1MP3 A;  1Z90 A;  1ZI5 A;  4KNX A;  1W57 A;  2ZU7 A;  1INJ A;  4IRP A;  2RIX A;  3I0I X;  3U2T A;  2AE7 A;  4D11 A;  1ZCU A;  2D0J A;  5FUH A;  2VS4 A;  2C0N A;  3POL A;  1ZJ1 A;  5C47 A;  3USQ A;  4KNR A;  1PZY B;  1V82 A;  1VM8 A;  2JCO A;  4BQH A;  3IOJ A;  1PZT A;  4G87 A;  3SXE A;  1ZI1 A;  1JV3 A;  3V91 A;  1KWS A;  2FYC B;  3K8E A;  2AM4 A;  5IDS A;  1OMZ A;  1MC3 A;  2YQS A;  1R7X A;  1R82 A;  5CQO A;  2GGO A;  1FXJ A;  1H5R B;  1JVD A;  2J0A A;  2RJ0 A;  3SXB A;  1VGW A;  3RMV A;  2YC5 A;  2OI6 A;  3DUV A;  1VZU A;  5JQQ A;  1H4C A;  1E5K A;  4O6N A;  4D48 A;  5C1G A;  3OH4 A;  4EEA A;  5CQL X;  2AGD A;  2YES A;  1R80 A;  2JCL A;  1R7U A;  4MND A;  4P02 A;  2AM5 A;  4Y6U A;  1INI A;  3V8Z A;  1HM8 A;  2OEG A;  1K4V A;  1TW1 A;  2XMH A;  4JIS A;  4DDZ A;  2W0V A;  2RJ9 A;  4EE5 A;  3R2W A;  1ZCY A;  5IFY A;  3OH0 A;  5CMI A;  3OH1 A;  1EYR A;  1ZJ2 A;  5C48 A;  1JYL A;  4ECM A;  2FYD B;  2OI5 A;  4FRO A;  2P73 A;  2QKX A;  1VZX A;  2FYB A;  4EEM A;  1VIC A;  3U0X A;  3TQD A;  1G2V A;  5L6V A;  1GX0 A;  1ZI4 A;  3OKR A;  1ZI3 A;  2WAW A;  1G97 A;  4FRM A;  2D7I A;  3I0L A;  2E3D A;  4FCE A;  4FCU A;  3U2U A;  1NF5 B;  2WVK A;  3U2W A;  1TW5 A;  4R7P A;  3CU0 A;  1NMM B;  1JVG A;  3SX5 A;  2RJ8 A;  1HV9 A;  1FR9 A;  1LZ7 A;  2QH5 A;  3Q4S A;  1H5T B;  1VGZ A;  1FO9 A;  1O7O A;  2Y4M A;  1FRW A;  2WVL A;  3IOI A;  2VK9 A;  1H7T A;  4Y7V A;  5C8R A;  1H5S B;  3V0Q A;  4KXO A;  5CMF X;  2I5K A;  2VS3 A;  3DJ4 A;  2D7R A;  1R7T A;  4G3Q A;  4KC2 A;  2XWM A;  1WT3 A;  4IRQ A;  1TZF A;  4Y63 A;  1H7L A;  2VS5 A;  2WE9 A;  2PGV A;  3CKN A;  3IOH A;  1ON8 A;  4HO3 A;  4C2S A;  4KT7 A;  3LW6 A;  4M4K A;  5C3A A;  3ZGF A;  4NAL A;  2APC A;  1LL0 A;  2GGQ A;  1HJL A;  5DDT A;  5C4C A;  1ZJO A;  2AM3 A;  2VXL A;  5CMH A;  4FRD A;  5EJ1 A;  1G0R A;  4B4G A;  3N9W A;  1ZDF A;  4CVH A;  2V0I A;  5FV9 A;  4EEO A;  1ON6 A;  1O7Q A;  4Y7T A;  3I0K A;  1W77 A;  2YQH A;  5CQN X;  1H4D A;  1MP4 A;  4G3S A;  2E8B A;  2Q4J A;  1R81 A;  3K8D A;  3T7O A;  1HM9 A;  2ZU8 A;  4LW3 A;  1ZJ3 A;  2RIT A;  3I0H A;  3D98 A;  3ZLL A;  1HJJ A;  5C4F A;  2ICY A;  2W0W A;  2VXM A;  3E25 A;  3JUJ A;  2X5S A;  3ZF8 A;  4D11 C;  3GUE A;  2FYA A;  2A8W A;  1ZJ0 A;  1S4N A;  2BO6 A;  2YCM A;  4B3U A;  1YP2 A;  4EE3 A;  3CGX A;  5DDV A;  2X60 A;  4YS8 A;  2AES A;  2Z87 A;  3I0C A;  1HM0 A;  3CKV A;  2I5E A;  5C4E A;  4B2W A;  2RIZ A;  3Q80 A;  2PGY A;  3I0G A;  4HO4 A;  1WT1 A;  3DK5 A;  4GBP A;  4ASY A;  4EEG A;  3D8V A;  1QGS A;  3V0P A;  5FTV A;  1QGQ A;  2YQC A;  3PNN A;  1QG8 A;  1ZCV A;  1O23 B;  2OI7 A;  3D5N A;  2WGZ A;  4O6M A;  1NHE B;  4Y6N A;  4HG6 A;  3TZT A;  2WEE A;  4B4M A;  2A8U A;  1YP4 A;  3RSB A;  4HO9 A;  2X5Z A;  2QGI A;  3I0J A;  4MYB A;  1O0R A;  5C38 A;  2Z86 A;  3BCV A;  5I1F A;  5C3D A;  4J18 A;  4E1K A;  3V0O A;  4M28 A;  4FRB A;  5D91 A;  1VH1 A;  5BXC A;  2YC3 A;  2P72 A;  1ZIZ A;  4Y64 A;  3SXA A;  1H5R A;  3F1C A;  4D0Z A;  1ZDG A;  4KPX A;  2MZB A;  5FYE A;  3Q7U A;  4NAN A;  3I0F A;  3BRK X;  1GX4 A;  3V90 A;  4FRA A;  5IDT A;  1G95 A;  1H7E A;  1GWV A;  5D92 A;  2NXV A;  1H7Q A;  4NAK A;  1EZI A;  3HL3 A;  3JUK A;  2AH9 A;  5C4B A;  1LL3 A;  4NAI A;  3OC9 A;  3ZLK A;  1H7F A;  4KPZ A;  2RJ6 A;  3OAM A;  3SXC A;  2Y7A A;  5L6S A;  5C1L A;  4ARW A;  4Y7F A;  3V0N A;  4AC3 A;  2BO8 A;  1WVC A;  2JCJ A;  2ZU9 A;  3CKO A;  3V0M A;  2FFU A;  1XHB A;  4M2A A;  4B2X A;  4Y9X A;  4CJ8 A;  1FXO A;  1V83 A;  5AJO A;  3T7N A;  3ST8 A;  3QVB A;  3R3I A;  1SS9 A;  4P00 A;  3I0D A;  1W55 A;  2YQJ A;  3JTJ A;  4FRH A;  4HO2 A;  2RJ1 A;  2VD4 A;  5J49 A;  2XWN A;  3U2X A;  4M2B A;  1IIM A;  4Y7U A;  4KRV A;  3SPT A;  4XWI A;  1G9R A;  5FU8 A;  4FIY A;  4B4B A;  4JD0 A;  2FFV A;  1LZJ A;  2UX8 A;  3V0L A;  3OH3 A;  2Y4J A;  1LZ0 A;  1FWY A;  1NKH B;  5C3B A;  5AJN A;  4FQW A;  1NQI B;  1FGX A;  1GQC A;  1FOA A;  5FU0 A;  2FY7 A;  1H5T A;  1GA8 A;  5CQM X;  2V0K A;  1WT0 A;  4FRL A;  4HO6 A;  1H7G A;  1LZI A;  4DEC A;  1WSZ A;  5EIY A;  5C1H A;  1H5S A;  3FWW A;  1FG5 N;  2Y4L A;  1G93 A;  5CMJ A;  2RIY A;  2RJ5 A;  4ZDQ A;  1GWW A;  4HO8 A;  3SX3 A;  1WT2 A;  2BO4 A;  3SXG A;  4DE7 A;  4Q7C A;  2CU2 A;  1G8O A;  4FRE A;  4AYL A;  4KC1 A;  2DPW A;  3OH2 A;  2P6W A;  4Y62 A;  5CMG X;  1GQ9 A;  3KIA A;  4G3P A;  3I0E A;  4FIX A;  3NGW A;  4FRP A;  3SX7 A;  4BMA A;  1H4E A;  1S4O A;  2V0L A;  2O1G A;  4CJB A;  4CJC A;  3FOQ A;  1H5S C;  1OMX A;  2RJ7 A;  2O1F A;  4LW6 A;  1JV1 A;  2AEC A;  1LL2 A;  1FZW A;  3O3P A;  1OQM B;  2WVM A;  4KQL A;  2O1H A;  1VH3 A;  1S4P A;  1ZHJ A;  2I7B A;  1VZT A;  2OEF A;  1YRO B;  3F1Y A;  3PKQ A;  1G1L A;  2Y4K A;  4D0T A;  1VGT A;  3V8Y A;  4B42 A;  2BO7 A;  3EE5 A;  3OGZ A;  4AYJ A;  4MIX A;  4HOC A;  1H5S D;  3SX8 A;  2X65 A;  1YP3 A;  2VSI A;  2Y6P A;  2JCK A;  4KC4 A;  3SXD A;  1VPA A;  2V0H A;  5EJZ A;  2PX7 A;  1R7V A;  3CKJ A;  1JYK A;  2VSH A;  1H7H A;  2V0J A;  1G3L A;  2PA4 A;  3E26 A;  3U0Y A;  4UEG A;  4B5B A;  1QWJ A;  4L41 C;  2XWL A;  3ZGG A;  1FGG A;  4ASJ A;  5C4D A;  5C36 A;  3PKP A;  3CKQ A;  4EE4 A;  1R7Y A;  1H3M A;  1XZ6 A;  4HO0 A;  3RMW A;  1VGU A;  4EVW A;  1G23 A;  1I52 A;  1NWG B;  4K6R A;  4Y7G A;  2ICX A;  1LVW A;  5C49 A;  4HO5 A;  1MP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...