1FRWA

Structure of e. coli moba with bound gtp and manganese
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
185
Chain Sequence
NLMTTITGVVLAGGKVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS PROTEIN
publication title The crystal structure of the Escherichia coli MobA protein provides insight into molybdopterin guanine dinucleotide biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 58
structure length 185
sequence length 191
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1frwA00
2JCJA 4M28A 1TVYA 1IIMA 3V0OA 2OI6A 3QVBA 4G87A 5AJOA 4FQWA 3D98A 2Y6PA 1JYKA 1H5RB 1V82A 1H3MA 2ICXA 4NANA 1INIA 1ZDFA 2VS3A 4NAIA 2Y4LA 4HO2A 3SXBA 4DDZA 4IRQA 1R7UA 2DPWA 3SXGA 2Y7AA 3Q4SA 3SX7A 2WAWA 2PGYA 2Q4JA 3I0EA 5CMFX 2YQHA 1H7GA 2OI7A 1H4DA 1ZI4A 3T7NA 2X65A 2MZBA 1FO9A 1QGSA 1INJA 1ZCTA 5FUHA 2X60A 5CQLX 1GWVA 4B2WA 1LZJA 5C4FA 4EE5A 2FYDB 1ZJ3A 1R82A 3HL3A 4B3UA 3V0PA 1NWGB 5L6VA 1YP2A 3SX8A 2E3DA 4HO3A 4AAWA 2AECA 1VGWA 2OI5A 3I0JA 5C49A 4L41C 5CMIA 2BO6A 1O0RA 1ZI3A 2I7BA 3N9WA 4FRQA 2BO7A 3U2UA 1H5RA 1NKHB 1G9RA 4D0ZA 1GX0A 2WVLA 4B4GA 2PX7A 2RJ5A 1FR9A 2GGOA 3IOHA 5C38A 1FZWA 1H5SC 2A8UA 1H7HA 4EE3A 3U2VA 1ZI5A 2RJ9A 5C48A 1OMZA 2BO4A 1NHEB 2QGIA 3PKQA 5DDTA 5EJ1A 1LL0A 2VXLA 3K8DA 5CQMX 2AM4A 3V0MA 4DECA 5C4EA 4D11A 1XZ6A 2RIYA 2WEEA 3E25A 4FRPA 2YQSA 1YP4A 2D7IA 3OAMA 4G3SA 4B4BA 3OH1A 4Y63A 1QWJA 1WT0A 4EVWA 3OH3A 2I5EA 2QKXA 5IDSA 1H7LA 3I0HA 1LZ0A 5C4BA 1LZIA 4HO8A 1TW1A 5J49A 2ZU7A 4G3PA 5HS2A 1ZJPA 3K8EA 1MC3A 2AM3A 3JTJA 1GWWA 1ZJ2A 2E8BA 5JQQA 2A8WA 4K6RA 4M2AA 2XMHA 4FRDA 4Y6NA 1NF5B 1O7OA 4HO5A 4MNDA 3RSBA 2VS5A 2YC3A 1H5TB 1V84A 1VGZA 2Z86A 1NQIB 4G3QA 2PA4A 4AC3A 3IOIA 5DDVA 2RJ8A 1ZI1A 2V0HA 2Z87A 2ZU8A 2ICYA 3ZGGA 1K4VA 1LL3A 2VSIA 3I0CA 3I0KA 3I0DA 4FRAA 2P72A 4HO6A 1LVWA 2VFZA 1VH3A 1GQCA 2Y4KA 3U2TA 3V8ZA 1GX4A 1W57A 2V0JA 2W0WA 1VM8A 2FYBA 2QH5A 1VICA 4Y62A 3DUVA 3ZGFA 1ZCVA 1ON6A 4HG6A 1G23A 1WSZA 2GGQA 5C4DA 4KNXA 3OC9A 4KPXA 3OH4A 1JYLA 1ZJ0A 1WVCA 3OH2A 1H5TA 1Z90A 5I1FA 1WT3A 4UEGA 2NXVA 4FREA 1H7QA 5CQPA 1O23B 2YCMA 1VPAA 1S4NA 2YESA 4CJCA 3U2WA 3F1YA 1FO8A 5FU8A 1H7FA 3TZTA 4KXOA 1NMMB 2RIZA 2V0IA 5EIYA 2P73A 5BXCA 1JVDA 3USQA 4B5BA 4P00A 1JV3A 4AYLA 1W77A 1ZJOA 3D5NA 5FV9A 1EZIA 1FXJA 4Y7TA 4HOCA 1PZYB 1OQMB 2OEGA 4LW3A 4EEMA 5AJPA 5CMGX 5C47A 2RIXA 1R7XA 4FRLA 1TZFA 1ZDGA 1HJJA 4DE7A 1ZCUA 4CJ8A 4KRVA 3LW6A 1YP3A 4D48A 1G2VA 2RJ1A 2XMEA 1E5KA 3SXEA 1MP4A 4HCQA 1R81A 4LW6A 4HO0A 4KC2A 1H5SB 5C8RA 2FY7A 1JVGA 3KIAA 2FYCB 2VXMA 1PZTA 4Y7FA 4FCEA 4Y7GA 1VGTA 4Y6UA 1G1LA 5CQNX 2FFUA 1LZ7A 4JD0A 2PGVA 2P6WA 5FTVA 3I0FA 1KWSA 4HO4A 1H4CA 4FRMA 1VZUA 3I0IX 3T7MA 2WGZA 3FWWA 3SXAA 3SXCA 3JUKA 3NGWA 1FR8A 1W55A 3U0YA 1FOAA 2XWNA 4B42A 3CGXA 3IOJA 4EEAA 1HM9A 2YQCA 3OGZA 1FWYA 1YROB 1XHBA 1ZJ1A 3ZLKA 1R7VA 4MYBA 3TQDA 5CMHA 3O3PA 1R80A 4KC1A 4JISA 3I0LA 2YQJA 4KQLA 5CMJA 1HV9A 1FGGA 1LL2A 2JCLA 1FRWA 3E26A 1MP5A 5CQOA 4IRPA 3USRA 4B2XA 4FRHA 4KC4A 3RMWA 4D0TA 3F1CA 2VSHA 1HJLA 1H5SA 2ZU9A 4NAKA 5EJZA 2X5SA 3DK5A 4GBPA 1HM0A 4B4MA 2AESA 4EEOA 2RJ0A 1VZTA 3V0NA 5C4CA 1FG5N 4ZDQA 2APCA 4CJBA 1G0RA 3Q7UA 3V91A 3PNNA 1O7QA 4EE4A 2V0LA 3CKNA 4Y7VA 4ARWA 4C2SA 4D11C 1ZIZA 3I0GA 4XWIA 2AH9A 3BCVA 3U0XA 1EYRA 3R3IA 1SS9A 2CU2A 2O1GA 4M4KA 2AE7A 1WT1A 5FYEA 1I52A 3OKRA 1V83A 2YC5A 3SX5A 2OEFA 1VZXA 3V90A 5C36A 3EE5A 1ZHJA 2O1HA 2W0VA 4M2BA 3D8VA 2I5KA 2WVMA 3SPTA 1R7YA 4Y9XA 3CKQA 3ST8A 4Y7UA 2Y4JA 4FROA 3RMVA 2V0KA 1H7TA 3CU0A 2Y4MA 1H4EA 3CKOA 4BQHA 2AM5A 1H7EA 3SX3A 1G93A 4ASYA 2D0JA 3V0QA 4YS8A 1WT2A 4FCUA 5AJNA 3U2XA 3CKVA 1TW5A 4CVHA 4R7PA 5C3AA 2BO8A 3V0LA 4EEGA 3FOQA 4HO9A 1QGQA 2RJ4A 2XWLA 2VS4A 4FRBA 2JCOA 3PKPA 4KT7A 5C1HA 3SXDA 1GA8A 1GQ9A 1FGXA 1FXOA 3CKJA 4J18A 2JCKA 2XWMA 1G3LA 4NALA 1G97A 5IFYA 2RJ7A 3DJ4A 1ZCYA 1IINA 5C3DA 1VGUA 5L6SA 1MP3A 2RJ6A 3OH0A 1JV1A 5C1LA 2D7RA 1R7TA 1S4PA 2WE9A 1G95A 5IDTA 1HM8A 4BMAA 3V8YA 2UX8A 1G8OA 4ASJA 3BRKX 4Y64A 4KPZA 3R2WA 4E1KA 1H5SD 4KNRA 3POLA 1VH1A 3Q80A 2FYAA 3ZLLA 3GUEA 2O1FA 2WVKA 1QG8A 5C1GA 3T7OA 1OMXA 4AYJA 2VD4A 4ECMA 1ON8A 2AGDA 5FTSA 3ZF8A 3JUJA 4P02A 2X5ZA 5C3BA 1S4OA 2RITA 5FU0A 2FFVA
chains in the Genus database with same CATH superfamily
2JCJA 4M28A 1TVYA 1IIMA 3V0OA 2OI6A 3QVBA 4G87A 5AJOA 4FQWA 3D98A 2Y6PA 1JYKA 1H5RB 1V82A 1H3MA 2ICXA 4NANA 1INIA 1ZDFA 2VS3A 4NAIA 2Y4LA 4HO2A 3SXBA 4DDZA 4IRQA 1R7UA 2DPWA 3SXGA 2Y7AA 3Q4SA 3SX7A 2WAWA 2PGYA 2Q4JA 3I0EA 5CMFX 2YQHA 1H7GA 2OI7A 1H4DA 1ZI4A 3T7NA 2X65A 2MZBA 1FO9A 1QGSA 1INJA 1ZCTA 5FUHA 2X60A 5CQLX 1GWVA 4B2WA 1LZJA 5C4FA 4EE5A 2FYDB 1ZJ3A 1R82A 3HL3A 4B3UA 3V0PA 1NWGB 5L6VA 1YP2A 3SX8A 2E3DA 4FIYA 4HO3A 4AAWA 2AECA 1VGWA 2OI5A 3I0JA 5C49A 4L41C 5CMIA 2BO6A 1O0RA 1ZI3A 2I7BA 3N9WA 4FRQA 2BO7A 3U2UA 1H5RA 1NKHB 1G9RA 4D0ZA 1GX0A 2WVLA 4B4GA 2PX7A 2RJ5A 1FR9A 2GGOA 3IOHA 5C38A 4FIXA 1FZWA 1H5SC 2A8UA 1H7HA 4EE3A 3U2VA 1ZI5A 2RJ9A 5C48A 1OMZA 2BO4A 1NHEB 2QGIA 3PKQA 5DDTA 5EJ1A 1LL0A 5D92A 2VXLA 3K8DA 5CQMX 2AM4A 3V0MA 4DECA 5C4EA 4D11A 1XZ6A 2RIYA 2WEEA 3E25A 4FRPA 2YQSA 1YP4A 2D7IA 3OAMA 4G3SA 4B4BA 3OH1A 4Y63A 1QWJA 1WT0A 4EVWA 3OH3A 2I5EA 2QKXA 5IDSA 1H7LA 3I0HA 1LZ0A 5C4BA 1LZIA 4HO8A 1TW1A 5J49A 2ZU7A 4G3PA 5HS2A 1ZJPA 3K8EA 1MC3A 2AM3A 3JTJA 1GWWA 1ZJ2A 2E8BA 5JQQA 2A8WA 4K6RA 4M2AA 2XMHA 4FRDA 4Y6NA 1NF5B 1O7OA 4HO5A 4MNDA 3RSBA 2VS5A 2YC3A 1H5TB 1V84A 1VGZA 2Z86A 1NQIB 4G3QA 2PA4A 4AC3A 3IOIA 5DDVA 2RJ8A 1ZI1A 2V0HA 2Z87A 2ZU8A 2ICYA 3ZGGA 1K4VA 1LL3A 2VSIA 3I0CA 3I0KA 3I0DA 4FRAA 2P72A 4HO6A 1LVWA 2VFZA 1VH3A 1GQCA 2Y4KA 3U2TA 3V8ZA 1GX4A 1W57A 2V0JA 2W0WA 1VM8A 2FYBA 2QH5A 1VICA 4Y62A 3DUVA 3ZGFA 1ZCVA 1ON6A 4HG6A 1G23A 1WSZA 2GGQA 5C4DA 4KNXA 4O6MA 3OC9A 4KPXA 3OH4A 1JYLA 1ZJ0A 1WVCA 3OH2A 1H5TA 1Z90A 5I1FA 1WT3A 4UEGA 2NXVA 4FREA 1H7QA 5CQPA 1O23B 2YCMA 1VPAA 1S4NA 2YESA 4CJCA 3U2WA 3F1YA 1FO8A 5FU8A 1H7FA 3TZTA 4KXOA 1NMMB 2RIZA 2V0IA 5EIYA 2P73A 5BXCA 1JVDA 3USQA 4B5BA 4P00A 1JV3A 4AYLA 1W77A 1ZJOA 3D5NA 5FV9A 1EZIA 1FXJA 4Y7TA 4HOCA 1PZYB 1OQMB 2OEGA 4LW3A 4EEMA 5AJPA 5CMGX 5C47A 2RIXA 1R7XA 4FRLA 1TZFA 1ZDGA 1HJJA 4DE7A 1ZCUA 4CJ8A 4KRVA 3LW6A 1YP3A 4D48A 1G2VA 2RJ1A 2XMEA 1E5KA 3SXEA 1MP4A 2J0AA 4HCQA 1R81A 4LW6A 4HO0A 4KC2A 1H5SB 5C8RA 2FY7A 1JVGA 3KIAA 2FYCB 2VXMA 1PZTA 4Y7FA 4FCEA 4Y7GA 1VGTA 4Y6UA 1G1LA 5CQNX 2FFUA 1LZ7A 4JD0A 2PGVA 2P6WA 5FTVA 3I0FA 1KWSA 4HO4A 1H4CA 4FRMA 1VZUA 3I0IX 3T7MA 2WGZA 3FWWA 3SXAA 3SXCA 3JUKA 3NGWA 1FR8A 1W55A 3U0YA 1FOAA 2XWNA 4B42A 3CGXA 3IOJA 4EEAA 1HM9A 2YQCA 3OGZA 1FWYA 1YROB 1XHBA 1ZJ1A 3ZLKA 1R7VA 4MYBA 3TQDA 5CMHA 3O3PA 1R80A 4KC1A 4JISA 3I0LA 2YQJA 4KQLA 5CMJA 1HV9A 4MIXA 1FGGA 1LL2A 2JCLA 1FRWA 3E26A 1MP5A 5CQOA 4IRPA 3USRA 4B2XA 4FRHA 4KC4A 3RMWA 4D0TA 3F1CA 2VSHA 1HJLA 1H5SA 2ZU9A 2VK9A 4NAKA 5EJZA 2X5SA 3DK5A 4GBPA 1HM0A 4B4MA 2AESA 4EEOA 2RJ0A 1VZTA 3V0NA 5C4CA 1FG5N 4ZDQA 2APCA 4CJBA 1G0RA 3Q7UA 3V91A 3PNNA 1O7QA 4EE4A 2V0LA 3CKNA 4Y7VA 4ARWA 4C2SA 4D11C 1ZIZA 3I0GA 4XWIA 2AH9A 3BCVA 3U0XA 1EYRA 3R3IA 1SS9A 2CU2A 2O1GA 4M4KA 2AE7A 1WT1A 5FYEA 1I52A 3OKRA 1V83A 2YC5A 3SX5A 2OEFA 1VZXA 3V90A 5C36A 3EE5A 1ZHJA 2O1HA 2W0VA 4M2BA 3D8VA 2I5KA 2WVMA 3SPTA 1R7YA 4Y9XA 3CKQA 3ST8A 4Y7UA 2Y4JA 4FROA 3RMVA 2V0KA 1H7TA 3CU0A 2Y4MA 1H4EA 3CKOA 4BQHA 2AM5A 1H7EA 3SX3A 1G93A 4ASYA 2D0JA 3V0QA 4YS8A 1WT2A 4FCUA 5AJNA 3U2XA 3CKVA 1TW5A 4CVHA 4R7PA 5C3AA 2BO8A 3V0LA 4EEGA 3FOQA 4HO9A 1QGQA 2RJ4A 2XWLA 2VS4A 4FRBA 2JCOA 3PKPA 4KT7A 5C1HA 3SXDA 1GA8A 1GQ9A 1FGXA 1FXOA 3CKJA 4J18A 2JCKA 2XWMA 1G3LA 4NALA 1G97A 5IFYA 2RJ7A 3DJ4A 1ZCYA 1IINA 5C3DA 1VGUA 5L6SA 1MP3A 4Q7CA 2RJ6A 3OH0A 1JV1A 5C1LA 2D7RA 1R7TA 1S4PA 2WE9A 1G95A 5IDTA 1HM8A 4BMAA 3V8YA 2UX8A 5D91A 1G8OA 4ASJA 3BRKX 4Y64A 4KPZA 3R2WA 4E1KA 4O6NA 1H5SD 4KNRA 3POLA 1VH1A 3Q80A 2FYAA 3ZLLA 3GUEA 2O1FA 2WVKA 1QG8A 2J0BA 5C1GA 3T7OA 1OMXA 4AYJA 2C0NA 2VD4A 4ECMA 1ON8A 2AGDA 5FTSA 3ZF8A 3JUJA 4P02A 2X5ZA 5C3BA 1S4OA 2RITA 5FU0A 2FFVA
chains in the Genus database with same CATH topology
2JCJA 4M28A 1TVYA 1IIMA 3V0OA 2OI6A 3QVBA 4G87A 5AJOA 4FQWA 3D98A 2Y6PA 1JYKA 1H5RB 1V82A 1H3MA 2ICXA 4NANA 1INIA 1ZDFA 2VS3A 4NAIA 2Y4LA 4HO2A 3SXBA 4DDZA 4IRQA 1R7UA 2DPWA 3SXGA 2Y7AA 3Q4SA 3SX7A 2WAWA 2PGYA 2Q4JA 3I0EA 5CMFX 2YQHA 1H7GA 2OI7A 1H4DA 1ZI4A 3T7NA 2X65A 2MZBA 1FO9A 1QGSA 1INJA 1ZCTA 5FUHA 2X60A 5CQLX 1GWVA 4B2WA 1LZJA 5C4FA 4EE5A 2FYDB 1ZJ3A 1R82A 3HL3A 4B3UA 3V0PA 1NWGB 5L6VA 1YP2A 3SX8A 2E3DA 4FIYA 4HO3A 4AAWA 2AECA 1VGWA 2OI5A 3I0JA 5C49A 4L41C 5CMIA 2BO6A 1O0RA 1ZI3A 2I7BA 3N9WA 4FRQA 2BO7A 3U2UA 1H5RA 1NKHB 1G9RA 4D0ZA 1GX0A 2WVLA 4B4GA 2PX7A 2RJ5A 1FR9A 2GGOA 3IOHA 5C38A 4FIXA 1FZWA 1H5SC 2A8UA 1H7HA 4EE3A 3U2VA 1ZI5A 2RJ9A 5C48A 1OMZA 2BO4A 1NHEB 2QGIA 3PKQA 5DDTA 5EJ1A 1LL0A 5D92A 2VXLA 3K8DA 5CQMX 2AM4A 3V0MA 4DECA 5C4EA 4D11A 1XZ6A 2RIYA 2WEEA 3E25A 4FRPA 2YQSA 1YP4A 2D7IA 3OAMA 4G3SA 4B4BA 3OH1A 4Y63A 1QWJA 1WT0A 4EVWA 3OH3A 2I5EA 2QKXA 5IDSA 1H7LA 3I0HA 1LZ0A 5C4BA 1LZIA 4HO8A 1TW1A 5J49A 2ZU7A 4G3PA 5HS2A 1ZJPA 3K8EA 1MC3A 2AM3A 3JTJA 1GWWA 1ZJ2A 2E8BA 5JQQA 2A8WA 4K6RA 4M2AA 2XMHA 4FRDA 4Y6NA 1NF5B 1O7OA 4HO5A 4MNDA 3RSBA 2VS5A 2YC3A 1H5TB 1V84A 1VGZA 2Z86A 1NQIB 4G3QA 2PA4A 4AC3A 3IOIA 5DDVA 2RJ8A 1ZI1A 2V0HA 2Z87A 2ZU8A 2ICYA 3ZGGA 1K4VA 1LL3A 2VSIA 3I0CA 3I0KA 3I0DA 4FRAA 2P72A 4HO6A 1LVWA 2VFZA 1VH3A 1GQCA 2Y4KA 3U2TA 3V8ZA 1GX4A 1W57A 2V0JA 2W0WA 1VM8A 2FYBA 2QH5A 1VICA 4Y62A 3DUVA 3ZGFA 1ZCVA 1ON6A 4HG6A 1G23A 1WSZA 2GGQA 5C4DA 4KNXA 4O6MA 3OC9A 4KPXA 3OH4A 1JYLA 1ZJ0A 1WVCA 3OH2A 1H5TA 1Z90A 5I1FA 1WT3A 4UEGA 2NXVA 4FREA 1H7QA 5CQPA 1O23B 2YCMA 1VPAA 1S4NA 2YESA 4CJCA 3U2WA 3F1YA 1FO8A 5FU8A 1H7FA 3TZTA 4KXOA 1NMMB 2RIZA 2V0IA 5EIYA 2P73A 5BXCA 1JVDA 3USQA 4B5BA 4P00A 1JV3A 4AYLA 1W77A 1ZJOA 3D5NA 5FV9A 1EZIA 1FXJA 4Y7TA 4HOCA 1PZYB 1OQMB 2OEGA 4LW3A 4EEMA 5AJPA 5CMGX 5C47A 2RIXA 1R7XA 4FRLA 1TZFA 1ZDGA 1HJJA 4DE7A 1ZCUA 4CJ8A 4KRVA 3LW6A 1YP3A 4D48A 1G2VA 2RJ1A 2XMEA 1E5KA 3SXEA 1MP4A 2J0AA 4HCQA 1R81A 4LW6A 4HO0A 4KC2A 1H5SB 5C8RA 2FY7A 1JVGA 3KIAA 2FYCB 2VXMA 1PZTA 4Y7FA 4FCEA 4Y7GA 1VGTA 4Y6UA 1G1LA 5CQNX 2FFUA 1LZ7A 4JD0A 2PGVA 2P6WA 5FTVA 3I0FA 1KWSA 4HO4A 1H4CA 4FRMA 1VZUA 3I0IX 3T7MA 2WGZA 3FWWA 3SXAA 3SXCA 3JUKA 3NGWA 1FR8A 1W55A 3U0YA 1FOAA 2XWNA 4B42A 3CGXA 3IOJA 4EEAA 1HM9A 2YQCA 3OGZA 1FWYA 1YROB 1XHBA 1ZJ1A 3ZLKA 1R7VA 4MYBA 3TQDA 5CMHA 3O3PA 1R80A 4KC1A 4JISA 3I0LA 2YQJA 4KQLA 5CMJA 1HV9A 4MIXA 1FGGA 1LL2A 2JCLA 1FRWA 3E26A 1MP5A 5CQOA 4IRPA 3USRA 4B2XA 4FRHA 4KC4A 3RMWA 4D0TA 3F1CA 2VSHA 1HJLA 1H5SA 2ZU9A 2VK9A 4NAKA 5EJZA 2X5SA 3DK5A 4GBPA 1HM0A 4B4MA 2AESA 4EEOA 2RJ0A 1VZTA 3V0NA 5C4CA 1FG5N 4ZDQA 2APCA 4CJBA 1G0RA 3Q7UA 3V91A 3PNNA 1O7QA 4EE4A 2V0LA 3CKNA 4Y7VA 4ARWA 4C2SA 4D11C 1ZIZA 3I0GA 4XWIA 2AH9A 3BCVA 3U0XA 1EYRA 3R3IA 1SS9A 2CU2A 2O1GA 4M4KA 2AE7A 1WT1A 5FYEA 1I52A 3OKRA 1V83A 2YC5A 3SX5A 2OEFA 1VZXA 3V90A 5C36A 3EE5A 1ZHJA 2O1HA 2W0VA 4M2BA 3D8VA 2I5KA 2WVMA 3SPTA 1R7YA 4Y9XA 3CKQA 3ST8A 4Y7UA 2Y4JA 4FROA 3RMVA 2V0KA 1H7TA 3CU0A 2Y4MA 1H4EA 3CKOA 4BQHA 2AM5A 1H7EA 3SX3A 1G93A 4ASYA 2D0JA 3V0QA 4YS8A 1WT2A 4FCUA 5AJNA 3U2XA 3CKVA 1TW5A 4CVHA 4R7PA 5C3AA 2BO8A 3V0LA 4EEGA 3FOQA 4HO9A 1QGQA 2RJ4A 2XWLA 2VS4A 4FRBA 2JCOA 3PKPA 4KT7A 5C1HA 3SXDA 1GA8A 1GQ9A 1FGXA 1FXOA 3CKJA 4J18A 2JCKA 2XWMA 1G3LA 4NALA 1G97A 5IFYA 2RJ7A 3DJ4A 1ZCYA 1IINA 5C3DA 1VGUA 5L6SA 1MP3A 4Q7CA 2RJ6A 3OH0A 1JV1A 5C1LA 2D7RA 1R7TA 1S4PA 2WE9A 1G95A 5IDTA 1HM8A 4BMAA 3V8YA 2UX8A 5D91A 1G8OA 4ASJA 3BRKX 4Y64A 4KPZA 3R2WA 4E1KA 4O6NA 1H5SD 4KNRA 3POLA 1VH1A 3Q80A 2FYAA 3ZLLA 3GUEA 2O1FA 2WVKA 1QG8A 2J0BA 5C1GA 3T7OA 1OMXA 4AYJA 2C0NA 2VD4A 4ECMA 1ON8A 2AGDA 5FTSA 3ZF8A 3JUJA 4P02A 2X5ZA 5C3BA 1S4OA 2RITA 5FU0A 2FFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JCJ A;  4M28 A;  1TVY A;  1IIM A;  3V0O A;  2OI6 A;  3QVB A;  4G87 A;  5AJO A;  4FQW A;  3D98 A;  2Y6P A;  1JYK A;  1H5R B;  1V82 A;  1H3M A;  2ICX A;  4NAN A;  1INI A;  1ZDF A;  2VS3 A;  4NAI A;  2Y4L A;  4HO2 A;  3SXB A;  4DDZ A;  4IRQ A;  1R7U A;  2DPW A;  3SXG A;  2Y7A A;  3Q4S A;  3SX7 A;  2WAW A;  2PGY A;  2Q4J A;  3I0E A;  5CMF X;  2YQH A;  1H7G A;  2OI7 A;  1H4D A;  1ZI4 A;  3T7N A;  2X65 A;  2MZB A;  1FO9 A;  1QGS A;  1INJ A;  1ZCT A;  5FUH A;  2X60 A;  5CQL X;  1GWV A;  4B2W A;  1LZJ A;  5C4F A;  4EE5 A;  2FYD B;  1ZJ3 A;  1R82 A;  3HL3 A;  4B3U A;  3V0P A;  1NWG B;  5L6V A;  1YP2 A;  3SX8 A;  2E3D A;  4HO3 A;  4AAW A;  2AEC A;  1VGW A;  2OI5 A;  3I0J A;  5C49 A;  4L41 C;  5CMI A;  2BO6 A;  1O0R A;  1ZI3 A;  2I7B A;  3N9W A;  4FRQ A;  2BO7 A;  3U2U A;  1H5R A;  1NKH B;  1G9R A;  4D0Z A;  1GX0 A;  2WVL A;  4B4G A;  2PX7 A;  2RJ5 A;  1FR9 A;  2GGO A;  3IOH A;  5C38 A;  1FZW A;  1H5S C;  2A8U A;  1H7H A;  4EE3 A;  3U2V A;  1ZI5 A;  2RJ9 A;  5C48 A;  1OMZ A;  2BO4 A;  1NHE B;  2QGI A;  3PKQ A;  5DDT A;  5EJ1 A;  1LL0 A;  2VXL A;  3K8D A;  5CQM X;  2AM4 A;  3V0M A;  4DEC A;  5C4E A;  4D11 A;  1XZ6 A;  2RIY A;  2WEE A;  3E25 A;  4FRP A;  2YQS A;  1YP4 A;  2D7I A;  3OAM A;  4G3S A;  4B4B A;  3OH1 A;  4Y63 A;  1QWJ A;  1WT0 A;  4EVW A;  3OH3 A;  2I5E A;  2QKX A;  5IDS A;  1H7L A;  3I0H A;  1LZ0 A;  5C4B A;  1LZI A;  4HO8 A;  1TW1 A;  5J49 A;  2ZU7 A;  4G3P A;  5HS2 A;  1ZJP A;  3K8E A;  1MC3 A;  2AM3 A;  3JTJ A;  1GWW A;  1ZJ2 A;  2E8B A;  5JQQ A;  2A8W A;  4K6R A;  4M2A A;  2XMH A;  4FRD A;  4Y6N A;  1NF5 B;  1O7O A;  4HO5 A;  4MND A;  3RSB A;  2VS5 A;  2YC3 A;  1H5T B;  1V84 A;  1VGZ A;  2Z86 A;  1NQI B;  4G3Q A;  2PA4 A;  4AC3 A;  3IOI A;  5DDV A;  2RJ8 A;  1ZI1 A;  2V0H A;  2Z87 A;  2ZU8 A;  2ICY A;  3ZGG A;  1K4V A;  1LL3 A;  2VSI A;  3I0C A;  3I0K A;  3I0D A;  4FRA A;  2P72 A;  4HO6 A;  1LVW A;  2VFZ A;  1VH3 A;  1GQC A;  2Y4K A;  3U2T A;  3V8Z A;  1GX4 A;  1W57 A;  2V0J A;  2W0W A;  1VM8 A;  2FYB A;  2QH5 A;  1VIC A;  4Y62 A;  3DUV A;  3ZGF A;  1ZCV A;  1ON6 A;  4HG6 A;  1G23 A;  1WSZ A;  2GGQ A;  5C4D A;  4KNX A;  3OC9 A;  4KPX A;  3OH4 A;  1JYL A;  1ZJ0 A;  1WVC A;  3OH2 A;  1H5T A;  1Z90 A;  5I1F A;  1WT3 A;  4UEG A;  2NXV A;  4FRE A;  1H7Q A;  5CQP A;  1O23 B;  2YCM A;  1VPA A;  1S4N A;  2YES A;  4CJC A;  3U2W A;  3F1Y A;  1FO8 A;  5FU8 A;  1H7F A;  3TZT A;  4KXO A;  1NMM B;  2RIZ A;  2V0I A;  5EIY A;  2P73 A;  5BXC A;  1JVD A;  3USQ A;  4B5B A;  4P00 A;  1JV3 A;  4AYL A;  1W77 A;  1ZJO A;  3D5N A;  5FV9 A;  1EZI A;  1FXJ A;  4Y7T A;  4HOC A;  1PZY B;  1OQM B;  2OEG A;  4LW3 A;  4EEM A;  5AJP A;  5CMG X;  5C47 A;  2RIX A;  1R7X A;  4FRL A;  1TZF A;  1ZDG A;  1HJJ A;  4DE7 A;  1ZCU A;  4CJ8 A;  4KRV A;  3LW6 A;  1YP3 A;  4D48 A;  1G2V A;  2RJ1 A;  2XME A;  1E5K A;  3SXE A;  1MP4 A;  4HCQ A;  1R81 A;  4LW6 A;  4HO0 A;  4KC2 A;  1H5S B;  5C8R A;  2FY7 A;  1JVG A;  3KIA A;  2FYC B;  2VXM A;  1PZT A;  4Y7F A;  4FCE A;  4Y7G A;  1VGT A;  4Y6U A;  1G1L A;  5CQN X;  2FFU A;  1LZ7 A;  4JD0 A;  2PGV A;  2P6W A;  5FTV A;  3I0F A;  1KWS A;  4HO4 A;  1H4C A;  4FRM A;  1VZU A;  3I0I X;  3T7M A;  2WGZ A;  3FWW A;  3SXA A;  3SXC A;  3JUK A;  3NGW A;  1FR8 A;  1W55 A;  3U0Y A;  1FOA A;  2XWN A;  4B42 A;  3CGX A;  3IOJ A;  4EEA A;  1HM9 A;  2YQC A;  3OGZ A;  1FWY A;  1YRO B;  1XHB A;  1ZJ1 A;  3ZLK A;  1R7V A;  4MYB A;  3TQD A;  5CMH A;  3O3P A;  1R80 A;  4KC1 A;  4JIS A;  3I0L A;  2YQJ A;  4KQL A;  5CMJ A;  1HV9 A;  1FGG A;  1LL2 A;  2JCL A;  1FRW A;  3E26 A;  1MP5 A;  5CQO A;  4IRP A;  3USR A;  4B2X A;  4FRH A;  4KC4 A;  3RMW A;  4D0T A;  3F1C A;  2VSH A;  1HJL A;  1H5S A;  2ZU9 A;  4NAK A;  5EJZ A;  2X5S A;  3DK5 A;  4GBP A;  1HM0 A;  4B4M A;  2AES A;  4EEO A;  2RJ0 A;  1VZT A;  3V0N A;  5C4C A;  1FG5 N;  4ZDQ A;  2APC A;  4CJB A;  1G0R A;  3Q7U A;  3V91 A;  3PNN A;  1O7Q A;  4EE4 A;  2V0L A;  3CKN A;  4Y7V A;  4ARW A;  4C2S A;  4D11 C;  1ZIZ A;  3I0G A;  4XWI A;  2AH9 A;  3BCV A;  3U0X A;  1EYR A;  3R3I A;  1SS9 A;  2CU2 A;  2O1G A;  4M4K A;  2AE7 A;  1WT1 A;  5FYE A;  1I52 A;  3OKR A;  1V83 A;  2YC5 A;  3SX5 A;  2OEF A;  1VZX A;  3V90 A;  5C36 A;  3EE5 A;  1ZHJ A;  2O1H A;  2W0V A;  4M2B A;  3D8V A;  2I5K A;  2WVM A;  3SPT A;  1R7Y A;  4Y9X A;  3CKQ A;  3ST8 A;  4Y7U A;  2Y4J A;  4FRO A;  3RMV A;  2V0K A;  1H7T A;  3CU0 A;  2Y4M A;  1H4E A;  3CKO A;  4BQH A;  2AM5 A;  1H7E A;  3SX3 A;  1G93 A;  4ASY A;  2D0J A;  3V0Q A;  4YS8 A;  1WT2 A;  4FCU A;  5AJN A;  3U2X A;  3CKV A;  1TW5 A;  4CVH A;  4R7P A;  5C3A A;  2BO8 A;  3V0L A;  4EEG A;  3FOQ A;  4HO9 A;  1QGQ A;  2RJ4 A;  2XWL A;  2VS4 A;  4FRB A;  2JCO A;  3PKP A;  4KT7 A;  5C1H A;  3SXD A;  1GA8 A;  1GQ9 A;  1FGX A;  1FXO A;  3CKJ A;  4J18 A;  2JCK A;  2XWM A;  1G3L A;  4NAL A;  1G97 A;  5IFY A;  2RJ7 A;  3DJ4 A;  1ZCY A;  1IIN A;  5C3D A;  1VGU A;  5L6S A;  1MP3 A;  2RJ6 A;  3OH0 A;  1JV1 A;  5C1L A;  2D7R A;  1R7T A;  1S4P A;  2WE9 A;  1G95 A;  5IDT A;  1HM8 A;  4BMA A;  3V8Y A;  2UX8 A;  1G8O A;  4ASJ A;  3BRK X;  4Y64 A;  4KPZ A;  3R2W A;  4E1K A;  1H5S D;  4KNR A;  3POL A;  1VH1 A;  3Q80 A;  2FYA A;  3ZLL A;  3GUE A;  2O1F A;  2WVK A;  1QG8 A;  5C1G A;  3T7O A;  1OMX A;  4AYJ A;  2VD4 A;  4ECM A;  1ON8 A;  2AGD A;  5FTS A;  3ZF8 A;  3JUJ A;  4P02 A;  2X5Z A;  5C3B A;  1S4O A;  2RIT A;  5FU0 A;  2FFV A; 
#chains in the Genus database with same CATH topology
 2JCJ A;  4M28 A;  1TVY A;  1IIM A;  3V0O A;  2OI6 A;  3QVB A;  4G87 A;  5AJO A;  4FQW A;  3D98 A;  2Y6P A;  1JYK A;  1H5R B;  1V82 A;  1H3M A;  2ICX A;  4NAN A;  1INI A;  1ZDF A;  2VS3 A;  4NAI A;  2Y4L A;  4HO2 A;  3SXB A;  4DDZ A;  4IRQ A;  1R7U A;  2DPW A;  3SXG A;  2Y7A A;  3Q4S A;  3SX7 A;  2WAW A;  2PGY A;  2Q4J A;  3I0E A;  5CMF X;  2YQH A;  1H7G A;  2OI7 A;  1H4D A;  1ZI4 A;  3T7N A;  2X65 A;  2MZB A;  1FO9 A;  1QGS A;  1INJ A;  1ZCT A;  5FUH A;  2X60 A;  5CQL X;  1GWV A;  4B2W A;  1LZJ A;  5C4F A;  4EE5 A;  2FYD B;  1ZJ3 A;  1R82 A;  3HL3 A;  4B3U A;  3V0P A;  1NWG B;  5L6V A;  1YP2 A;  3SX8 A;  2E3D A;  4FIY A;  4HO3 A;  4AAW A;  2AEC A;  1VGW A;  2OI5 A;  3I0J A;  5C49 A;  4L41 C;  5CMI A;  2BO6 A;  1O0R A;  1ZI3 A;  2I7B A;  3N9W A;  4FRQ A;  2BO7 A;  3U2U A;  1H5R A;  1NKH B;  1G9R A;  4D0Z A;  1GX0 A;  2WVL A;  4B4G A;  2PX7 A;  2RJ5 A;  1FR9 A;  2GGO A;  3IOH A;  5C38 A;  4FIX A;  1FZW A;  1H5S C;  2A8U A;  1H7H A;  4EE3 A;  3U2V A;  1ZI5 A;  2RJ9 A;  5C48 A;  1OMZ A;  2BO4 A;  1NHE B;  2QGI A;  3PKQ A;  5DDT A;  5EJ1 A;  1LL0 A;  5D92 A;  2VXL A;  3K8D A;  5CQM X;  2AM4 A;  3V0M A;  4DEC A;  5C4E A;  4D11 A;  1XZ6 A;  2RIY A;  2WEE A;  3E25 A;  4FRP A;  2YQS A;  1YP4 A;  2D7I A;  3OAM A;  4G3S A;  4B4B A;  3OH1 A;  4Y63 A;  1QWJ A;  1WT0 A;  4EVW A;  3OH3 A;  2I5E A;  2QKX A;  5IDS A;  1H7L A;  3I0H A;  1LZ0 A;  5C4B A;  1LZI A;  4HO8 A;  1TW1 A;  5J49 A;  2ZU7 A;  4G3P A;  5HS2 A;  1ZJP A;  3K8E A;  1MC3 A;  2AM3 A;  3JTJ A;  1GWW A;  1ZJ2 A;  2E8B A;  5JQQ A;  2A8W A;  4K6R A;  4M2A A;  2XMH A;  4FRD A;  4Y6N A;  1NF5 B;  1O7O A;  4HO5 A;  4MND A;  3RSB A;  2VS5 A;  2YC3 A;  1H5T B;  1V84 A;  1VGZ A;  2Z86 A;  1NQI B;  4G3Q A;  2PA4 A;  4AC3 A;  3IOI A;  5DDV A;  2RJ8 A;  1ZI1 A;  2V0H A;  2Z87 A;  2ZU8 A;  2ICY A;  3ZGG A;  1K4V A;  1LL3 A;  2VSI A;  3I0C A;  3I0K A;  3I0D A;  4FRA A;  2P72 A;  4HO6 A;  1LVW A;  2VFZ A;  1VH3 A;  1GQC A;  2Y4K A;  3U2T A;  3V8Z A;  1GX4 A;  1W57 A;  2V0J A;  2W0W A;  1VM8 A;  2FYB A;  2QH5 A;  1VIC A;  4Y62 A;  3DUV A;  3ZGF A;  1ZCV A;  1ON6 A;  4HG6 A;  1G23 A;  1WSZ A;  2GGQ A;  5C4D A;  4KNX A;  4O6M A;  3OC9 A;  4KPX A;  3OH4 A;  1JYL A;  1ZJ0 A;  1WVC A;  3OH2 A;  1H5T A;  1Z90 A;  5I1F A;  1WT3 A;  4UEG A;  2NXV A;  4FRE A;  1H7Q A;  5CQP A;  1O23 B;  2YCM A;  1VPA A;  1S4N A;  2YES A;  4CJC A;  3U2W A;  3F1Y A;  1FO8 A;  5FU8 A;  1H7F A;  3TZT A;  4KXO A;  1NMM B;  2RIZ A;  2V0I A;  5EIY A;  2P73 A;  5BXC A;  1JVD A;  3USQ A;  4B5B A;  4P00 A;  1JV3 A;  4AYL A;  1W77 A;  1ZJO A;  3D5N A;  5FV9 A;  1EZI A;  1FXJ A;  4Y7T A;  4HOC A;  1PZY B;  1OQM B;  2OEG A;  4LW3 A;  4EEM A;  5AJP A;  5CMG X;  5C47 A;  2RIX A;  1R7X A;  4FRL A;  1TZF A;  1ZDG A;  1HJJ A;  4DE7 A;  1ZCU A;  4CJ8 A;  4KRV A;  3LW6 A;  1YP3 A;  4D48 A;  1G2V A;  2RJ1 A;  2XME A;  1E5K A;  3SXE A;  1MP4 A;  2J0A A;  4HCQ A;  1R81 A;  4LW6 A;  4HO0 A;  4KC2 A;  1H5S B;  5C8R A;  2FY7 A;  1JVG A;  3KIA A;  2FYC B;  2VXM A;  1PZT A;  4Y7F A;  4FCE A;  4Y7G A;  1VGT A;  4Y6U A;  1G1L A;  5CQN X;  2FFU A;  1LZ7 A;  4JD0 A;  2PGV A;  2P6W A;  5FTV A;  3I0F A;  1KWS A;  4HO4 A;  1H4C A;  4FRM A;  1VZU A;  3I0I X;  3T7M A;  2WGZ A;  3FWW A;  3SXA A;  3SXC A;  3JUK A;  3NGW A;  1FR8 A;  1W55 A;  3U0Y A;  1FOA A;  2XWN A;  4B42 A;  3CGX A;  3IOJ A;  4EEA A;  1HM9 A;  2YQC A;  3OGZ A;  1FWY A;  1YRO B;  1XHB A;  1ZJ1 A;  3ZLK A;  1R7V A;  4MYB A;  3TQD A;  5CMH A;  3O3P A;  1R80 A;  4KC1 A;  4JIS A;  3I0L A;  2YQJ A;  4KQL A;  5CMJ A;  1HV9 A;  4MIX A;  1FGG A;  1LL2 A;  2JCL A;  1FRW A;  3E26 A;  1MP5 A;  5CQO A;  4IRP A;  3USR A;  4B2X A;  4FRH A;  4KC4 A;  3RMW A;  4D0T A;  3F1C A;  2VSH A;  1HJL A;  1H5S A;  2ZU9 A;  2VK9 A;  4NAK A;  5EJZ A;  2X5S A;  3DK5 A;  4GBP A;  1HM0 A;  4B4M A;  2AES A;  4EEO A;  2RJ0 A;  1VZT A;  3V0N A;  5C4C A;  1FG5 N;  4ZDQ A;  2APC A;  4CJB A;  1G0R A;  3Q7U A;  3V91 A;  3PNN A;  1O7Q A;  4EE4 A;  2V0L A;  3CKN A;  4Y7V A;  4ARW A;  4C2S A;  4D11 C;  1ZIZ A;  3I0G A;  4XWI A;  2AH9 A;  3BCV A;  3U0X A;  1EYR A;  3R3I A;  1SS9 A;  2CU2 A;  2O1G A;  4M4K A;  2AE7 A;  1WT1 A;  5FYE A;  1I52 A;  3OKR A;  1V83 A;  2YC5 A;  3SX5 A;  2OEF A;  1VZX A;  3V90 A;  5C36 A;  3EE5 A;  1ZHJ A;  2O1H A;  2W0V A;  4M2B A;  3D8V A;  2I5K A;  2WVM A;  3SPT A;  1R7Y A;  4Y9X A;  3CKQ A;  3ST8 A;  4Y7U A;  2Y4J A;  4FRO A;  3RMV A;  2V0K A;  1H7T A;  3CU0 A;  2Y4M A;  1H4E A;  3CKO A;  4BQH A;  2AM5 A;  1H7E A;  3SX3 A;  1G93 A;  4ASY A;  2D0J A;  3V0Q A;  4YS8 A;  1WT2 A;  4FCU A;  5AJN A;  3U2X A;  3CKV A;  1TW5 A;  4CVH A;  4R7P A;  5C3A A;  2BO8 A;  3V0L A;  4EEG A;  3FOQ A;  4HO9 A;  1QGQ A;  2RJ4 A;  2XWL A;  2VS4 A;  4FRB A;  2JCO A;  3PKP A;  4KT7 A;  5C1H A;  3SXD A;  1GA8 A;  1GQ9 A;  1FGX A;  1FXO A;  3CKJ A;  4J18 A;  2JCK A;  2XWM A;  1G3L A;  4NAL A;  1G97 A;  5IFY A;  2RJ7 A;  3DJ4 A;  1ZCY A;  1IIN A;  5C3D A;  1VGU A;  5L6S A;  1MP3 A;  4Q7C A;  2RJ6 A;  3OH0 A;  1JV1 A;  5C1L A;  2D7R A;  1R7T A;  1S4P A;  2WE9 A;  1G95 A;  5IDT A;  1HM8 A;  4BMA A;  3V8Y A;  2UX8 A;  5D91 A;  1G8O A;  4ASJ A;  3BRK X;  4Y64 A;  4KPZ A;  3R2W A;  4E1K A;  4O6N A;  1H5S D;  4KNR A;  3POL A;  1VH1 A;  3Q80 A;  2FYA A;  3ZLL A;  3GUE A;  2O1F A;  2WVK A;  1QG8 A;  2J0B A;  5C1G A;  3T7O A;  1OMX A;  4AYJ A;  2C0N A;  2VD4 A;  4ECM A;  1ON8 A;  2AGD A;  5FTS A;  3ZF8 A;  3JUJ A;  4P02 A;  2X5Z A;  5C3B A;  1S4O A;  2RIT A;  5FU0 A;  2FFV A; 
#chains in the Genus database with same CATH homology
 2JCJ A;  4M28 A;  1TVY A;  1IIM A;  3V0O A;  2OI6 A;  3QVB A;  4G87 A;  5AJO A;  4FQW A;  3D98 A;  2Y6P A;  1JYK A;  1H5R B;  1V82 A;  1H3M A;  2ICX A;  4NAN A;  1INI A;  1ZDF A;  2VS3 A;  4NAI A;  2Y4L A;  4HO2 A;  3SXB A;  4DDZ A;  4IRQ A;  1R7U A;  2DPW A;  3SXG A;  2Y7A A;  3Q4S A;  3SX7 A;  2WAW A;  2PGY A;  2Q4J A;  3I0E A;  5CMF X;  2YQH A;  1H7G A;  2OI7 A;  1H4D A;  1ZI4 A;  3T7N A;  2X65 A;  2MZB A;  1FO9 A;  1QGS A;  1INJ A;  1ZCT A;  5FUH A;  2X60 A;  5CQL X;  1GWV A;  4B2W A;  1LZJ A;  5C4F A;  4EE5 A;  2FYD B;  1ZJ3 A;  1R82 A;  3HL3 A;  4B3U A;  3V0P A;  1NWG B;  5L6V A;  1YP2 A;  3SX8 A;  2E3D A;  4FIY A;  4HO3 A;  4AAW A;  2AEC A;  1VGW A;  2OI5 A;  3I0J A;  5C49 A;  4L41 C;  5CMI A;  2BO6 A;  1O0R A;  1ZI3 A;  2I7B A;  3N9W A;  4FRQ A;  2BO7 A;  3U2U A;  1H5R A;  1NKH B;  1G9R A;  4D0Z A;  1GX0 A;  2WVL A;  4B4G A;  2PX7 A;  2RJ5 A;  1FR9 A;  2GGO A;  3IOH A;  5C38 A;  4FIX A;  1FZW A;  1H5S C;  2A8U A;  1H7H A;  4EE3 A;  3U2V A;  1ZI5 A;  2RJ9 A;  5C48 A;  1OMZ A;  2BO4 A;  1NHE B;  2QGI A;  3PKQ A;  5DDT A;  5EJ1 A;  1LL0 A;  5D92 A;  2VXL A;  3K8D A;  5CQM X;  2AM4 A;  3V0M A;  4DEC A;  5C4E A;  4D11 A;  1XZ6 A;  2RIY A;  2WEE A;  3E25 A;  4FRP A;  2YQS A;  1YP4 A;  2D7I A;  3OAM A;  4G3S A;  4B4B A;  3OH1 A;  4Y63 A;  1QWJ A;  1WT0 A;  4EVW A;  3OH3 A;  2I5E A;  2QKX A;  5IDS A;  1H7L A;  3I0H A;  1LZ0 A;  5C4B A;  1LZI A;  4HO8 A;  1TW1 A;  5J49 A;  2ZU7 A;  4G3P A;  5HS2 A;  1ZJP A;  3K8E A;  1MC3 A;  2AM3 A;  3JTJ A;  1GWW A;  1ZJ2 A;  2E8B A;  5JQQ A;  2A8W A;  4K6R A;  4M2A A;  2XMH A;  4FRD A;  4Y6N A;  1NF5 B;  1O7O A;  4HO5 A;  4MND A;  3RSB A;  2VS5 A;  2YC3 A;  1H5T B;  1V84 A;  1VGZ A;  2Z86 A;  1NQI B;  4G3Q A;  2PA4 A;  4AC3 A;  3IOI A;  5DDV A;  2RJ8 A;  1ZI1 A;  2V0H A;  2Z87 A;  2ZU8 A;  2ICY A;  3ZGG A;  1K4V A;  1LL3 A;  2VSI A;  3I0C A;  3I0K A;  3I0D A;  4FRA A;  2P72 A;  4HO6 A;  1LVW A;  2VFZ A;  1VH3 A;  1GQC A;  2Y4K A;  3U2T A;  3V8Z A;  1GX4 A;  1W57 A;  2V0J A;  2W0W A;  1VM8 A;  2FYB A;  2QH5 A;  1VIC A;  4Y62 A;  3DUV A;  3ZGF A;  1ZCV A;  1ON6 A;  4HG6 A;  1G23 A;  1WSZ A;  2GGQ A;  5C4D A;  4KNX A;  4O6M A;  3OC9 A;  4KPX A;  3OH4 A;  1JYL A;  1ZJ0 A;  1WVC A;  3OH2 A;  1H5T A;  1Z90 A;  5I1F A;  1WT3 A;  4UEG A;  2NXV A;  4FRE A;  1H7Q A;  5CQP A;  1O23 B;  2YCM A;  1VPA A;  1S4N A;  2YES A;  4CJC A;  3U2W A;  3F1Y A;  1FO8 A;  5FU8 A;  1H7F A;  3TZT A;  4KXO A;  1NMM B;  2RIZ A;  2V0I A;  5EIY A;  2P73 A;  5BXC A;  1JVD A;  3USQ A;  4B5B A;  4P00 A;  1JV3 A;  4AYL A;  1W77 A;  1ZJO A;  3D5N A;  5FV9 A;  1EZI A;  1FXJ A;  4Y7T A;  4HOC A;  1PZY B;  1OQM B;  2OEG A;  4LW3 A;  4EEM A;  5AJP A;  5CMG X;  5C47 A;  2RIX A;  1R7X A;  4FRL A;  1TZF A;  1ZDG A;  1HJJ A;  4DE7 A;  1ZCU A;  4CJ8 A;  4KRV A;  3LW6 A;  1YP3 A;  4D48 A;  1G2V A;  2RJ1 A;  2XME A;  1E5K A;  3SXE A;  1MP4 A;  2J0A A;  4HCQ A;  1R81 A;  4LW6 A;  4HO0 A;  4KC2 A;  1H5S B;  5C8R A;  2FY7 A;  1JVG A;  3KIA A;  2FYC B;  2VXM A;  1PZT A;  4Y7F A;  4FCE A;  4Y7G A;  1VGT A;  4Y6U A;  1G1L A;  5CQN X;  2FFU A;  1LZ7 A;  4JD0 A;  2PGV A;  2P6W A;  5FTV A;  3I0F A;  1KWS A;  4HO4 A;  1H4C A;  4FRM A;  1VZU A;  3I0I X;  3T7M A;  2WGZ A;  3FWW A;  3SXA A;  3SXC A;  3JUK A;  3NGW A;  1FR8 A;  1W55 A;  3U0Y A;  1FOA A;  2XWN A;  4B42 A;  3CGX A;  3IOJ A;  4EEA A;  1HM9 A;  2YQC A;  3OGZ A;  1FWY A;  1YRO B;  1XHB A;  1ZJ1 A;  3ZLK A;  1R7V A;  4MYB A;  3TQD A;  5CMH A;  3O3P A;  1R80 A;  4KC1 A;  4JIS A;  3I0L A;  2YQJ A;  4KQL A;  5CMJ A;  1HV9 A;  4MIX A;  1FGG A;  1LL2 A;  2JCL A;  1FRW A;  3E26 A;  1MP5 A;  5CQO A;  4IRP A;  3USR A;  4B2X A;  4FRH A;  4KC4 A;  3RMW A;  4D0T A;  3F1C A;  2VSH A;  1HJL A;  1H5S A;  2ZU9 A;  2VK9 A;  4NAK A;  5EJZ A;  2X5S A;  3DK5 A;  4GBP A;  1HM0 A;  4B4M A;  2AES A;  4EEO A;  2RJ0 A;  1VZT A;  3V0N A;  5C4C A;  1FG5 N;  4ZDQ A;  2APC A;  4CJB A;  1G0R A;  3Q7U A;  3V91 A;  3PNN A;  1O7Q A;  4EE4 A;  2V0L A;  3CKN A;  4Y7V A;  4ARW A;  4C2S A;  4D11 C;  1ZIZ A;  3I0G A;  4XWI A;  2AH9 A;  3BCV A;  3U0X A;  1EYR A;  3R3I A;  1SS9 A;  2CU2 A;  2O1G A;  4M4K A;  2AE7 A;  1WT1 A;  5FYE A;  1I52 A;  3OKR A;  1V83 A;  2YC5 A;  3SX5 A;  2OEF A;  1VZX A;  3V90 A;  5C36 A;  3EE5 A;  1ZHJ A;  2O1H A;  2W0V A;  4M2B A;  3D8V A;  2I5K A;  2WVM A;  3SPT A;  1R7Y A;  4Y9X A;  3CKQ A;  3ST8 A;  4Y7U A;  2Y4J A;  4FRO A;  3RMV A;  2V0K A;  1H7T A;  3CU0 A;  2Y4M A;  1H4E A;  3CKO A;  4BQH A;  2AM5 A;  1H7E A;  3SX3 A;  1G93 A;  4ASY A;  2D0J A;  3V0Q A;  4YS8 A;  1WT2 A;  4FCU A;  5AJN A;  3U2X A;  3CKV A;  1TW5 A;  4CVH A;  4R7P A;  5C3A A;  2BO8 A;  3V0L A;  4EEG A;  3FOQ A;  4HO9 A;  1QGQ A;  2RJ4 A;  2XWL A;  2VS4 A;  4FRB A;  2JCO A;  3PKP A;  4KT7 A;  5C1H A;  3SXD A;  1GA8 A;  1GQ9 A;  1FGX A;  1FXO A;  3CKJ A;  4J18 A;  2JCK A;  2XWM A;  1G3L A;  4NAL A;  1G97 A;  5IFY A;  2RJ7 A;  3DJ4 A;  1ZCY A;  1IIN A;  5C3D A;  1VGU A;  5L6S A;  1MP3 A;  4Q7C A;  2RJ6 A;  3OH0 A;  1JV1 A;  5C1L A;  2D7R A;  1R7T A;  1S4P A;  2WE9 A;  1G95 A;  5IDT A;  1HM8 A;  4BMA A;  3V8Y A;  2UX8 A;  5D91 A;  1G8O A;  4ASJ A;  3BRK X;  4Y64 A;  4KPZ A;  3R2W A;  4E1K A;  4O6N A;  1H5S D;  4KNR A;  3POL A;  1VH1 A;  3Q80 A;  2FYA A;  3ZLL A;  3GUE A;  2O1F A;  2WVK A;  1QG8 A;  2J0B A;  5C1G A;  3T7O A;  1OMX A;  4AYJ A;  2C0N A;  2VD4 A;  4ECM A;  1ON8 A;  2AGD A;  5FTS A;  3ZF8 A;  3JUJ A;  4P02 A;  2X5Z A;  5C3B A;  1S4O A;  2RIT A;  5FU0 A;  2FFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...