1FRWA

Structure of e. coli moba with bound gtp and manganese
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
185
Chain Sequence
NLMTTITGVVLAGGKVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS PROTEIN
publication title The crystal structure of the Escherichia coli MobA protein provides insight into molybdopterin guanine dinucleotide biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 185
sequence length 191
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1frwA00
4LW3A 2O1FA 2Y4MA 3DUVA 3I0IX 1MC3A 1IIMA 3V0PA 3HL3A 5AJNA 4KC1A 3K8EA 1I52A 4CVHA 2BO7A 2NXVA 3SX7A 1MP5A 5CQMX 1H5SA 4EVWA 3POLA 2JCJA 3OH2A 1H7EA 1YP3A 3R2WA 4EE4A 1G0RA 3N9WA 1GX0A 1R7UA 2JCKA 4FQWA 1HM0A 5C1HA 1NHEB 4FCEA 2FYCB 4AC3A 4NALA 1FO8A 4CJCA 2A8UA 1PZYB 3I0HA 5CMJA 3V0QA 2RJ7A 2VS4A 1ZIZA 5CMGX 4EEMA 4NAKA 3CKOA 1K4VA 5CMFX 2GGQA 4Y6NA 2I5EA 4D0TA 1FGGA 4ARWA 1VICA 1LZIA 2D0JA 1ZHJA 5FTSA 2AE7A 2JCLA 1V83A 1ZI5A 5BXCA 1ZCYA 2RJ9A 4LW6A 3U2WA 2RIZA 2AM5A 5IDTA 3I0DA 2PGYA 4HO9A 4AYJA 2VXMA 3I0LA 4HO3A 3V0NA 4M4KA 1HM8A 4ASYA 2BO6A 4EE3A 2W0VA 2RJ5A 4KPXA 3T7NA 1JYKA 2P6WA 2OI6A 2XMEA 3F1YA 4UEGA 1INIA 1JV1A 3OH4A 1FR9A 5C1LA 1HJJA 4KQLA 3RMWA 4D11A 5FTVA 4HOCA 3OH3A 1H4EA 1R7YA 1FG5N 4D48A 3CKNA 3USQA 4R7PA 3V8YA 3QVBA 3IOJA 1W57A 1O23B 3DJ4A 4HO5A 3ZF8A 5EIYA 5DDTA 1W77A 1QGSA 5IFYA 2VXLA 4B4MA 2ZU7A 1FWYA 1VGWA 1LVWA 3RMVA 3D8VA 3O3PA 4B3UA 2OI7A 1R82A 1SS9A 5L6SA 1ZJ2A 3PKPA 2RIYA 2VSHA 1G3LA 4CJ8A 2AGDA 2I5KA 4HCQA 4Y7FA 4GBPA 1NWGB 2RJ8A 5C3AA 2A8WA 1NMMB 4MNDA 1GQCA 2RITA 2YQHA 3ZLKA 1W55A 1H5TB 4XWIA 1OMXA 5C4CA 4B2WA 4Y6UA 2YQJA 3ST8A 1LL3A 2CU2A 1IINA 4EEOA 1G23A 5CMHA 2FYBA 3BRKX 3SX5A 1ZI3A 5CQPA 2WVKA 2X60A 1NKHB 1KWSA 2RIXA 4B42A 1TVYA 2WEEA 5C3BA 1H7FA 5JQQA 4FRPA 3OH0A 1E5KA 1VZXA 4NANA 1OQMB 1R81A 1H5RB 3TQDA 4IRQA 1QGQA 1YP2A 5FYEA 4FRBA 5CQLX 4B4GA 1G2VA 1LZ7A 1ZCVA 4G3QA 4J18A 2Y4JA 1ZJ1A 1H7GA 2VS5A 1Z90A 4FRLA 4Y7UA 1GWVA 1HJLA 1O0RA 3I0GA 5C1GA 1H7LA 1R80A 4ASJA 3CKQA 1HM9A 5AJPA 2GGOA 3LW6A 3IOIA 3T7MA 4P02A 4FREA 4MYBA 3V0OA 3V0LA 3I0FA 1ZJPA 1LZ0A 1ON8A 4KC4A 3U0XA 3RSBA 5CQNX 1G93A 2QKXA 2WE9A 3Q4SA 1ZI1A 3R3IA 4KT7A 4Y7VA 1FXOA 1VZTA 1JYLA 1EZIA 5C4EA 4KXOA 4M28A 1O7QA 2V0KA 3I0EA 4B4BA 1FZWA 2FYDB 1R7TA 3D5NA 1H4DA 1WT3A 1WT2A 2FYAA 5HS2A 2OI5A 1NQIB 2WGZA 2X5SA 2X65A 4EEAA 4KC2A 1YP4A 2Y4LA 2YC5A 1H7HA 1WSZA 3SXGA 2FFVA 4KNXA 4FRDA 4NAIA 3V91A 2Z87A 4Y62A 3ZGGA 2YQCA 2YC3A 2RJ6A 4G87A 3U2TA 2RJ0A 3OC9A 4KNRA 4M2BA 1H5SB 5FUHA 3OH1A 1LL0A 5C4BA 1XZ6A 2AM4A 2AECA 2AH9A 3T7OA 3CKVA 3OKRA 1EYRA 2X5ZA 4HO4A 2ICXA 1VGUA 1QG8A 2ICYA 4DDZA 2ZU8A 1WT0A 2P73A 2ZU9A 2Y7AA 1H7TA 4FCUA 1GA8A 2VS3A 3ZLLA 2AESA 3Q80A 4KPZA 4JD0A 3OAMA 3TZTA 1R7VA 4B2XA 3SXBA 2V0IA 1ZJOA 3V8ZA 3JTJA 3OGZA 2WVMA 5FU0A 4FRHA 1VPAA 4L41C 4AYLA 3SPTA 2QGIA 2V0HA 2E3DA 2AM3A 4B5BA 5DDVA 1O7OA 4C2SA 1VGZA 2P72A 1LL2A 4JISA 1R7XA 3PNNA 1H5SD 1WT1A 1VH3A 5C8RA 3Q7UA 1H4CA 4AAWA 1GQ9A 5FV9A 1G95A 1ZJ0A 1G8OA 1H3MA 2Y6PA 3CKJA 4G3SA 4FRQA 1ON6A 2BO4A 1QWJA 1TW5A 2E8BA 1JVDA 4HO0A 5L6VA 5I1FA 3SXDA 1FGXA 4IRPA 2RJ4A 4G3PA 4EEGA 3E26A 3ZGFA 3EE5A 4K6RA 1PZTA 1H7QA 3SXEA 2FY7A 2PGVA 1S4OA 3FWWA 2D7RA 5AJOA 2JCOA 3SX8A 1FRWA 2APCA 5C4DA 4HO8A 2V0JA 5C48A 1S4NA 3SXCA 4BMAA 5J49A 3D98A 5FU8A 3SX3A 4E1KA 1GWWA 5EJZA 1LZJA 3PKQA 3V0MA 3FOQA 2WVLA 1H5TA 1H5SC 3CGXA 1WVCA 1FOAA 1HV9A 5C38A 3IOHA 1ZCUA 1VH1A 2OEFA 1ZCTA 3DK5A 2V0LA 1FR8A 1MP3A 1G9RA 4KRVA 2FFUA 3CU0A 5C47A 2PA4A 2VSIA 1NF5B 1ZI4A 2VD4A 2D7IA 4HG6A 1GX4A 4M2AA 1JVGA 2YQSA 3I0KA 1H5RA 2OEGA 1ZDFA 4ECMA 3I0JA 3KIAA 5C4FA 5CMIA 3I0CA 2O1HA 2YCMA 4D0ZA 2XMHA 3U2XA 1YROB 4Y7TA 5C49A 3USRA 2RJ1A 1G1LA 5C3DA 1G97A 3F1CA 4P00A 1VM8A 3JUKA 4HO6A 2QH5A 1V84A 3U2VA 1TZFA 2MZBA 4YS8A 3SXAA 2UX8A 5EJ1A 4FRAA 1OMZA 2XWMA 1TW1A 4CJBA 4FRMA 1ZDGA 2O1GA 5C36A 3U0YA 4HO2A 3BCVA 2WAWA 2XWNA 3V90A 2Z86A 3E25A 1FO9A 1MP4A 1VZUA 2BO8A 1XHBA 3NGWA 3GUEA 2I7BA 1FXJA 2XWLA 4Y9XA 4D11C 4EE5A 1S4PA 1VGTA 1JV3A 4DECA 4DE7A 3JUJA 2YESA 1ZJ3A 5IDSA 3U2UA 4Y7GA 2Q4JA 4FROA 2W0WA 2PX7A 2Y4KA 4ZDQA 3K8DA 1INJA 2DPWA 5CQOA 1V82A 4Y63A 2VFZA 4BQHA 4Y64A
chains in the Genus database with same CATH superfamily
4LW3A 2O1FA 2Y4MA 3DUVA 3I0IX 2C0NA 1MC3A 1IIMA 3V0PA 3HL3A 5AJNA 4KC1A 3K8EA 1I52A 4CVHA 2BO7A 4O6NA 2NXVA 3SX7A 1MP5A 5CQMX 1H5SA 4EVWA 3POLA 2JCJA 3OH2A 1H7EA 1YP3A 3R2WA 4EE4A 1G0RA 3N9WA 1GX0A 1R7UA 2JCKA 4FQWA 1HM0A 5C1HA 1NHEB 4FCEA 2FYCB 4AC3A 4NALA 5D92A 1FO8A 4CJCA 2A8UA 1PZYB 3I0HA 5CMJA 4FIXA 3V0QA 2RJ7A 2VS4A 1ZIZA 5CMGX 4EEMA 4NAKA 3CKOA 1K4VA 5CMFX 2GGQA 4Y6NA 2I5EA 4D0TA 1FGGA 4ARWA 1VICA 1LZIA 2D0JA 1ZHJA 5FTSA 2AE7A 2JCLA 1V83A 1ZI5A 5BXCA 1ZCYA 2RJ9A 4LW6A 3U2WA 2RIZA 2AM5A 5IDTA 3I0DA 2PGYA 4HO9A 4AYJA 2VXMA 3I0LA 4HO3A 3V0NA 4M4KA 1HM8A 4ASYA 2BO6A 4EE3A 2W0VA 2RJ5A 4KPXA 3T7NA 1JYKA 2P6WA 2OI6A 2XMEA 3F1YA 4UEGA 1INIA 1JV1A 3OH4A 1FR9A 5C1LA 1HJJA 4KQLA 3RMWA 4D11A 5FTVA 4HOCA 3OH3A 1H4EA 1R7YA 1FG5N 4D48A 3CKNA 3USQA 4R7PA 3V8YA 3QVBA 3IOJA 1W57A 1O23B 3DJ4A 4HO5A 3ZF8A 5EIYA 5DDTA 1W77A 1QGSA 5IFYA 2VXLA 4B4MA 2ZU7A 1FWYA 1VGWA 1LVWA 3RMVA 3D8VA 3O3PA 4B3UA 2OI7A 1R82A 1SS9A 5L6SA 1ZJ2A 3PKPA 2RIYA 2VSHA 1G3LA 4CJ8A 2AGDA 2I5KA 4HCQA 4Y7FA 4GBPA 1NWGB 2RJ8A 5C3AA 2A8WA 1NMMB 4MNDA 1GQCA 2RITA 2YQHA 3ZLKA 1W55A 1H5TB 4XWIA 1OMXA 5C4CA 4B2WA 4Y6UA 2YQJA 3ST8A 1LL3A 2CU2A 1IINA 4EEOA 1G23A 5CMHA 2FYBA 3BRKX 3SX5A 1ZI3A 2J0BA 2WVKA 5CQPA 2X60A 1NKHB 1KWSA 2RIXA 4B42A 1TVYA 2WEEA 5C3BA 1H7FA 5JQQA 4FRPA 3OH0A 1E5KA 1VZXA 4NANA 1OQMB 1R81A 1H5RB 3TQDA 4IRQA 1QGQA 1YP2A 5FYEA 4FRBA 5CQLX 4B4GA 1G2VA 1LZ7A 1ZCVA 4G3QA 4J18A 2Y4JA 1ZJ1A 1H7GA 2VS5A 1Z90A 4FRLA 4Y7UA 1GWVA 1HJLA 1O0RA 3I0GA 5C1GA 1H7LA 1R80A 4ASJA 3CKQA 1HM9A 5AJPA 2GGOA 3LW6A 3IOIA 3T7MA 4P02A 4FREA 4MYBA 3V0OA 3V0LA 3I0FA 1ZJPA 1LZ0A 1ON8A 4KC4A 3U0XA 3RSBA 5CQNX 1G93A 2QKXA 2WE9A 3Q4SA 1ZI1A 3R3IA 4KT7A 4Y7VA 1FXOA 1VZTA 1JYLA 1EZIA 5C4EA 4KXOA 4O6MA 4M28A 1O7QA 2V0KA 3I0EA 4B4BA 1FZWA 2FYDB 1R7TA 3D5NA 1H4DA 1WT3A 1WT2A 2FYAA 5HS2A 2OI5A 1NQIB 2WGZA 2X5SA 2X65A 4EEAA 4KC2A 1YP4A 2Y4LA 2YC5A 1H7HA 1WSZA 3SXGA 2FFVA 4KNXA 4FRDA 4NAIA 3V91A 2Z87A 4Y62A 3ZGGA 2YQCA 2YC3A 2RJ6A 4G87A 3U2TA 2RJ0A 3OC9A 4KNRA 4M2BA 1H5SB 5FUHA 3OH1A 1LL0A 5C4BA 1XZ6A 2AM4A 2AECA 2AH9A 3T7OA 3CKVA 3OKRA 1EYRA 2X5ZA 4HO4A 2ICXA 1VGUA 1QG8A 2ICYA 4DDZA 2ZU8A 1WT0A 2P73A 2ZU9A 2Y7AA 1H7TA 4FCUA 1GA8A 2J0AA 2VS3A 3ZLLA 2AESA 3Q80A 4KPZA 4JD0A 3OAMA 3TZTA 1R7VA 4B2XA 3SXBA 2V0IA 4MIXA 1ZJOA 3V8ZA 3JTJA 3OGZA 2WVMA 5FU0A 4FRHA 1VPAA 4L41C 4AYLA 3SPTA 2QGIA 2V0HA 2E3DA 2AM3A 4B5BA 5DDVA 1O7OA 4C2SA 1VGZA 2P72A 1LL2A 4JISA 1R7XA 3PNNA 1H5SD 1WT1A 5D91A 1VH3A 5C8RA 3Q7UA 1H4CA 4AAWA 1GQ9A 5FV9A 1G95A 1ZJ0A 1G8OA 1H3MA 2Y6PA 3CKJA 4G3SA 4FRQA 1ON6A 2BO4A 1QWJA 1TW5A 2E8BA 1JVDA 4HO0A 5L6VA 5I1FA 3SXDA 1FGXA 4IRPA 2RJ4A 4G3PA 4EEGA 3E26A 3ZGFA 3EE5A 4K6RA 1PZTA 1H7QA 3SXEA 2FY7A 2PGVA 1S4OA 3FWWA 4Q7CA 2D7RA 5AJOA 2JCOA 3SX8A 1FRWA 2APCA 5C4DA 4HO8A 2V0JA 5C48A 1S4NA 3SXCA 4BMAA 5J49A 3D98A 5FU8A 3SX3A 4E1KA 1GWWA 5EJZA 1LZJA 3PKQA 3V0MA 3FOQA 2WVLA 1H5TA 1H5SC 3CGXA 1WVCA 1FOAA 1HV9A 5C38A 3IOHA 1ZCUA 1VH1A 2OEFA 1ZCTA 3DK5A 2V0LA 1FR8A 1MP3A 1G9RA 4KRVA 2FFUA 3CU0A 5C47A 2PA4A 2VSIA 1NF5B 1ZI4A 2VD4A 2D7IA 4HG6A 1GX4A 4M2AA 1JVGA 2YQSA 3I0KA 1H5RA 2OEGA 1ZDFA 4ECMA 3I0JA 3KIAA 5C4FA 5CMIA 3I0CA 2O1HA 2YCMA 4D0ZA 2XMHA 3U2XA 1YROB 4Y7TA 5C49A 3USRA 2RJ1A 1G1LA 5C3DA 4FIYA 1G97A 3F1CA 4P00A 1VM8A 3JUKA 4HO6A 2QH5A 1V84A 3U2VA 1TZFA 2VK9A 2MZBA 4YS8A 3SXAA 2UX8A 5EJ1A 4FRAA 1OMZA 2XWMA 1TW1A 4CJBA 4FRMA 1ZDGA 2O1GA 5C36A 3U0YA 4HO2A 3BCVA 2WAWA 2XWNA 3V90A 2Z86A 3E25A 1FO9A 1MP4A 1VZUA 2BO8A 1XHBA 3NGWA 3GUEA 2I7BA 1FXJA 2XWLA 4Y9XA 4D11C 4EE5A 1S4PA 1VGTA 1JV3A 4DECA 4DE7A 3JUJA 2YESA 1ZJ3A 5IDSA 3U2UA 4Y7GA 2Q4JA 4FROA 2W0WA 2PX7A 2Y4KA 4ZDQA 3K8DA 1INJA 2DPWA 5CQOA 1V82A 4Y63A 2VFZA 4BQHA 4Y64A
chains in the Genus database with same CATH topology
4LW3A 2O1FA 2Y4MA 3DUVA 3I0IX 2C0NA 1MC3A 1IIMA 3V0PA 3HL3A 5AJNA 4KC1A 3K8EA 1I52A 4CVHA 2BO7A 4O6NA 2NXVA 3SX7A 1MP5A 5CQMX 1H5SA 4EVWA 3POLA 2JCJA 3OH2A 1H7EA 1YP3A 3R2WA 4EE4A 1G0RA 3N9WA 1GX0A 1R7UA 2JCKA 4FQWA 1HM0A 5C1HA 1NHEB 4FCEA 2FYCB 4AC3A 4NALA 5D92A 1FO8A 4CJCA 2A8UA 1PZYB 3I0HA 5CMJA 4FIXA 3V0QA 2RJ7A 2VS4A 1ZIZA 5CMGX 4EEMA 4NAKA 3CKOA 1K4VA 5CMFX 2GGQA 4Y6NA 2I5EA 4D0TA 1FGGA 4ARWA 1VICA 1LZIA 2D0JA 1ZHJA 5FTSA 2AE7A 2JCLA 1V83A 1ZI5A 5BXCA 1ZCYA 2RJ9A 4LW6A 3U2WA 2RIZA 2AM5A 5IDTA 3I0DA 2PGYA 4HO9A 4AYJA 2VXMA 3I0LA 4HO3A 3V0NA 4M4KA 1HM8A 4ASYA 2BO6A 4EE3A 2W0VA 2RJ5A 4KPXA 3T7NA 1JYKA 2P6WA 2OI6A 2XMEA 3F1YA 4UEGA 1INIA 1JV1A 3OH4A 1FR9A 5C1LA 1HJJA 4KQLA 3RMWA 4D11A 5FTVA 4HOCA 3OH3A 1H4EA 1R7YA 1FG5N 4D48A 3CKNA 3USQA 4R7PA 3V8YA 3QVBA 3IOJA 1W57A 1O23B 3DJ4A 4HO5A 3ZF8A 5EIYA 5DDTA 1W77A 1QGSA 5IFYA 2VXLA 4B4MA 2ZU7A 1FWYA 1VGWA 1LVWA 3RMVA 3D8VA 3O3PA 4B3UA 2OI7A 1R82A 1SS9A 5L6SA 1ZJ2A 3PKPA 2RIYA 2VSHA 1G3LA 4CJ8A 2AGDA 2I5KA 4HCQA 4Y7FA 4GBPA 1NWGB 2RJ8A 5C3AA 2A8WA 1NMMB 4MNDA 1GQCA 2RITA 2YQHA 3ZLKA 1W55A 1H5TB 4XWIA 1OMXA 5C4CA 4B2WA 4Y6UA 2YQJA 3ST8A 1LL3A 2CU2A 1IINA 4EEOA 1G23A 5CMHA 2FYBA 3BRKX 3SX5A 1ZI3A 2J0BA 2WVKA 5CQPA 2X60A 1NKHB 1KWSA 2RIXA 4B42A 1TVYA 2WEEA 5C3BA 1H7FA 5JQQA 4FRPA 3OH0A 1E5KA 1VZXA 4NANA 1OQMB 1R81A 1H5RB 3TQDA 4IRQA 1QGQA 1YP2A 5FYEA 4FRBA 5CQLX 4B4GA 1G2VA 1LZ7A 1ZCVA 4G3QA 4J18A 2Y4JA 1ZJ1A 1H7GA 2VS5A 1Z90A 4FRLA 4Y7UA 1GWVA 1HJLA 1O0RA 3I0GA 5C1GA 1H7LA 1R80A 4ASJA 3CKQA 1HM9A 5AJPA 2GGOA 3LW6A 3IOIA 3T7MA 4P02A 4FREA 4MYBA 3V0OA 3V0LA 3I0FA 1ZJPA 1LZ0A 1ON8A 4KC4A 3U0XA 3RSBA 5CQNX 1G93A 2QKXA 2WE9A 3Q4SA 1ZI1A 3R3IA 4KT7A 4Y7VA 1FXOA 1VZTA 1JYLA 1EZIA 5C4EA 4KXOA 4O6MA 4M28A 1O7QA 2V0KA 3I0EA 4B4BA 1FZWA 2FYDB 1R7TA 3D5NA 1H4DA 1WT3A 1WT2A 2FYAA 5HS2A 2OI5A 1NQIB 2WGZA 2X5SA 2X65A 4EEAA 4KC2A 1YP4A 2Y4LA 2YC5A 1H7HA 1WSZA 3SXGA 2FFVA 4KNXA 4FRDA 4NAIA 3V91A 2Z87A 4Y62A 3ZGGA 2YQCA 2YC3A 2RJ6A 4G87A 3U2TA 2RJ0A 3OC9A 4KNRA 4M2BA 1H5SB 5FUHA 3OH1A 1LL0A 5C4BA 1XZ6A 2AM4A 2AECA 2AH9A 3T7OA 3CKVA 3OKRA 1EYRA 2X5ZA 4HO4A 2ICXA 1VGUA 1QG8A 2ICYA 4DDZA 2ZU8A 1WT0A 2P73A 2ZU9A 2Y7AA 1H7TA 4FCUA 1GA8A 2J0AA 2VS3A 3ZLLA 2AESA 3Q80A 4KPZA 4JD0A 3OAMA 3TZTA 1R7VA 4B2XA 3SXBA 2V0IA 4MIXA 1ZJOA 3V8ZA 3JTJA 3OGZA 2WVMA 5FU0A 4FRHA 1VPAA 4L41C 4AYLA 3SPTA 2QGIA 2V0HA 2E3DA 2AM3A 4B5BA 5DDVA 1O7OA 4C2SA 1VGZA 2P72A 1LL2A 4JISA 1R7XA 3PNNA 1H5SD 1WT1A 5D91A 1VH3A 5C8RA 3Q7UA 1H4CA 4AAWA 1GQ9A 5FV9A 1G95A 1ZJ0A 1G8OA 1H3MA 2Y6PA 3CKJA 4G3SA 4FRQA 1ON6A 2BO4A 1QWJA 1TW5A 2E8BA 1JVDA 4HO0A 5L6VA 5I1FA 3SXDA 1FGXA 4IRPA 2RJ4A 4G3PA 4EEGA 3E26A 3ZGFA 3EE5A 4K6RA 1PZTA 1H7QA 3SXEA 2FY7A 2PGVA 1S4OA 3FWWA 4Q7CA 2D7RA 5AJOA 2JCOA 3SX8A 1FRWA 2APCA 5C4DA 4HO8A 2V0JA 5C48A 1S4NA 3SXCA 4BMAA 5J49A 3D98A 5FU8A 3SX3A 4E1KA 1GWWA 5EJZA 1LZJA 3PKQA 3V0MA 3FOQA 2WVLA 1H5TA 1H5SC 3CGXA 1WVCA 1FOAA 1HV9A 5C38A 3IOHA 1ZCUA 1VH1A 2OEFA 1ZCTA 3DK5A 2V0LA 1FR8A 1MP3A 1G9RA 4KRVA 2FFUA 3CU0A 5C47A 2PA4A 2VSIA 1NF5B 1ZI4A 2VD4A 2D7IA 4HG6A 1GX4A 4M2AA 1JVGA 2YQSA 3I0KA 1H5RA 2OEGA 1ZDFA 4ECMA 3I0JA 3KIAA 5C4FA 5CMIA 3I0CA 2O1HA 2YCMA 4D0ZA 2XMHA 3U2XA 1YROB 4Y7TA 5C49A 3USRA 2RJ1A 1G1LA 5C3DA 4FIYA 1G97A 3F1CA 4P00A 1VM8A 3JUKA 4HO6A 2QH5A 1V84A 3U2VA 1TZFA 2VK9A 2MZBA 4YS8A 3SXAA 2UX8A 5EJ1A 4FRAA 1OMZA 2XWMA 1TW1A 4CJBA 4FRMA 1ZDGA 2O1GA 5C36A 3U0YA 4HO2A 3BCVA 2WAWA 2XWNA 3V90A 2Z86A 3E25A 1FO9A 1MP4A 1VZUA 2BO8A 1XHBA 3NGWA 3GUEA 2I7BA 1FXJA 2XWLA 4Y9XA 4D11C 4EE5A 1S4PA 1VGTA 1JV3A 4DECA 4DE7A 3JUJA 2YESA 1ZJ3A 5IDSA 3U2UA 4Y7GA 2Q4JA 4FROA 2W0WA 2PX7A 2Y4KA 4ZDQA 3K8DA 1INJA 2DPWA 5CQOA 1V82A 4Y63A 2VFZA 4BQHA 4Y64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LW3 A;  2O1F A;  2Y4M A;  3DUV A;  3I0I X;  1MC3 A;  1IIM A;  3V0P A;  3HL3 A;  5AJN A;  4KC1 A;  3K8E A;  1I52 A;  4CVH A;  2BO7 A;  2NXV A;  3SX7 A;  1MP5 A;  5CQM X;  1H5S A;  4EVW A;  3POL A;  2JCJ A;  3OH2 A;  1H7E A;  1YP3 A;  3R2W A;  4EE4 A;  1G0R A;  3N9W A;  1GX0 A;  1R7U A;  2JCK A;  4FQW A;  1HM0 A;  5C1H A;  1NHE B;  4FCE A;  2FYC B;  4AC3 A;  4NAL A;  1FO8 A;  4CJC A;  2A8U A;  1PZY B;  3I0H A;  5CMJ A;  3V0Q A;  2RJ7 A;  2VS4 A;  1ZIZ A;  5CMG X;  4EEM A;  4NAK A;  3CKO A;  1K4V A;  5CMF X;  2GGQ A;  4Y6N A;  2I5E A;  4D0T A;  1FGG A;  4ARW A;  1VIC A;  1LZI A;  2D0J A;  1ZHJ A;  5FTS A;  2AE7 A;  2JCL A;  1V83 A;  1ZI5 A;  5BXC A;  1ZCY A;  2RJ9 A;  4LW6 A;  3U2W A;  2RIZ A;  2AM5 A;  5IDT A;  3I0D A;  2PGY A;  4HO9 A;  4AYJ A;  2VXM A;  3I0L A;  4HO3 A;  3V0N A;  4M4K A;  1HM8 A;  4ASY A;  2BO6 A;  4EE3 A;  2W0V A;  2RJ5 A;  4KPX A;  3T7N A;  1JYK A;  2P6W A;  2OI6 A;  2XME A;  3F1Y A;  4UEG A;  1INI A;  1JV1 A;  3OH4 A;  1FR9 A;  5C1L A;  1HJJ A;  4KQL A;  3RMW A;  4D11 A;  5FTV A;  4HOC A;  3OH3 A;  1H4E A;  1R7Y A;  1FG5 N;  4D48 A;  3CKN A;  3USQ A;  4R7P A;  3V8Y A;  3QVB A;  3IOJ A;  1W57 A;  1O23 B;  3DJ4 A;  4HO5 A;  3ZF8 A;  5EIY A;  5DDT A;  1W77 A;  1QGS A;  5IFY A;  2VXL A;  4B4M A;  2ZU7 A;  1FWY A;  1VGW A;  1LVW A;  3RMV A;  3D8V A;  3O3P A;  4B3U A;  2OI7 A;  1R82 A;  1SS9 A;  5L6S A;  1ZJ2 A;  3PKP A;  2RIY A;  2VSH A;  1G3L A;  4CJ8 A;  2AGD A;  2I5K A;  4HCQ A;  4Y7F A;  4GBP A;  1NWG B;  2RJ8 A;  5C3A A;  2A8W A;  1NMM B;  4MND A;  1GQC A;  2RIT A;  2YQH A;  3ZLK A;  1W55 A;  1H5T B;  4XWI A;  1OMX A;  5C4C A;  4B2W A;  4Y6U A;  2YQJ A;  3ST8 A;  1LL3 A;  2CU2 A;  1IIN A;  4EEO A;  1G23 A;  5CMH A;  2FYB A;  3BRK X;  3SX5 A;  1ZI3 A;  5CQP A;  2WVK A;  2X60 A;  1NKH B;  1KWS A;  2RIX A;  4B42 A;  1TVY A;  2WEE A;  5C3B A;  1H7F A;  5JQQ A;  4FRP A;  3OH0 A;  1E5K A;  1VZX A;  4NAN A;  1OQM B;  1R81 A;  1H5R B;  3TQD A;  4IRQ A;  1QGQ A;  1YP2 A;  5FYE A;  4FRB A;  5CQL X;  4B4G A;  1G2V A;  1LZ7 A;  1ZCV A;  4G3Q A;  4J18 A;  2Y4J A;  1ZJ1 A;  1H7G A;  2VS5 A;  1Z90 A;  4FRL A;  4Y7U A;  1GWV A;  1HJL A;  1O0R A;  3I0G A;  5C1G A;  1H7L A;  1R80 A;  4ASJ A;  3CKQ A;  1HM9 A;  5AJP A;  2GGO A;  3LW6 A;  3IOI A;  3T7M A;  4P02 A;  4FRE A;  4MYB A;  3V0O A;  3V0L A;  3I0F A;  1ZJP A;  1LZ0 A;  1ON8 A;  4KC4 A;  3U0X A;  3RSB A;  5CQN X;  1G93 A;  2QKX A;  2WE9 A;  3Q4S A;  1ZI1 A;  3R3I A;  4KT7 A;  4Y7V A;  1FXO A;  1VZT A;  1JYL A;  1EZI A;  5C4E A;  4KXO A;  4M28 A;  1O7Q A;  2V0K A;  3I0E A;  4B4B A;  1FZW A;  2FYD B;  1R7T A;  3D5N A;  1H4D A;  1WT3 A;  1WT2 A;  2FYA A;  5HS2 A;  2OI5 A;  1NQI B;  2WGZ A;  2X5S A;  2X65 A;  4EEA A;  4KC2 A;  1YP4 A;  2Y4L A;  2YC5 A;  1H7H A;  1WSZ A;  3SXG A;  2FFV A;  4KNX A;  4FRD A;  4NAI A;  3V91 A;  2Z87 A;  4Y62 A;  3ZGG A;  2YQC A;  2YC3 A;  2RJ6 A;  4G87 A;  3U2T A;  2RJ0 A;  3OC9 A;  4KNR A;  4M2B A;  1H5S B;  5FUH A;  3OH1 A;  1LL0 A;  5C4B A;  1XZ6 A;  2AM4 A;  2AEC A;  2AH9 A;  3T7O A;  3CKV A;  3OKR A;  1EYR A;  2X5Z A;  4HO4 A;  2ICX A;  1VGU A;  1QG8 A;  2ICY A;  4DDZ A;  2ZU8 A;  1WT0 A;  2P73 A;  2ZU9 A;  2Y7A A;  1H7T A;  4FCU A;  1GA8 A;  2VS3 A;  3ZLL A;  2AES A;  3Q80 A;  4KPZ A;  4JD0 A;  3OAM A;  3TZT A;  1R7V A;  4B2X A;  3SXB A;  2V0I A;  1ZJO A;  3V8Z A;  3JTJ A;  3OGZ A;  2WVM A;  5FU0 A;  4FRH A;  1VPA A;  4L41 C;  4AYL A;  3SPT A;  2QGI A;  2V0H A;  2E3D A;  2AM3 A;  4B5B A;  5DDV A;  1O7O A;  4C2S A;  1VGZ A;  2P72 A;  1LL2 A;  4JIS A;  1R7X A;  3PNN A;  1H5S D;  1WT1 A;  1VH3 A;  5C8R A;  3Q7U A;  1H4C A;  4AAW A;  1GQ9 A;  5FV9 A;  1G95 A;  1ZJ0 A;  1G8O A;  1H3M A;  2Y6P A;  3CKJ A;  4G3S A;  4FRQ A;  1ON6 A;  2BO4 A;  1QWJ A;  1TW5 A;  2E8B A;  1JVD A;  4HO0 A;  5L6V A;  5I1F A;  3SXD A;  1FGX A;  4IRP A;  2RJ4 A;  4G3P A;  4EEG A;  3E26 A;  3ZGF A;  3EE5 A;  4K6R A;  1PZT A;  1H7Q A;  3SXE A;  2FY7 A;  2PGV A;  1S4O A;  3FWW A;  2D7R A;  5AJO A;  2JCO A;  3SX8 A;  1FRW A;  2APC A;  5C4D A;  4HO8 A;  2V0J A;  5C48 A;  1S4N A;  3SXC A;  4BMA A;  5J49 A;  3D98 A;  5FU8 A;  3SX3 A;  4E1K A;  1GWW A;  5EJZ A;  1LZJ A;  3PKQ A;  3V0M A;  3FOQ A;  2WVL A;  1H5T A;  1H5S C;  3CGX A;  1WVC A;  1FOA A;  1HV9 A;  5C38 A;  3IOH A;  1ZCU A;  1VH1 A;  2OEF A;  1ZCT A;  3DK5 A;  2V0L A;  1FR8 A;  1MP3 A;  1G9R A;  4KRV A;  2FFU A;  3CU0 A;  5C47 A;  2PA4 A;  2VSI A;  1NF5 B;  1ZI4 A;  2VD4 A;  2D7I A;  4HG6 A;  1GX4 A;  4M2A A;  1JVG A;  2YQS A;  3I0K A;  1H5R A;  2OEG A;  1ZDF A;  4ECM A;  3I0J A;  3KIA A;  5C4F A;  5CMI A;  3I0C A;  2O1H A;  2YCM A;  4D0Z A;  2XMH A;  3U2X A;  1YRO B;  4Y7T A;  5C49 A;  3USR A;  2RJ1 A;  1G1L A;  5C3D A;  1G97 A;  3F1C A;  4P00 A;  1VM8 A;  3JUK A;  4HO6 A;  2QH5 A;  1V84 A;  3U2V A;  1TZF A;  2MZB A;  4YS8 A;  3SXA A;  2UX8 A;  5EJ1 A;  4FRA A;  1OMZ A;  2XWM A;  1TW1 A;  4CJB A;  4FRM A;  1ZDG A;  2O1G A;  5C36 A;  3U0Y A;  4HO2 A;  3BCV A;  2WAW A;  2XWN A;  3V90 A;  2Z86 A;  3E25 A;  1FO9 A;  1MP4 A;  1VZU A;  2BO8 A;  1XHB A;  3NGW A;  3GUE A;  2I7B A;  1FXJ A;  2XWL A;  4Y9X A;  4D11 C;  4EE5 A;  1S4P A;  1VGT A;  1JV3 A;  4DEC A;  4DE7 A;  3JUJ A;  2YES A;  1ZJ3 A;  5IDS A;  3U2U A;  4Y7G A;  2Q4J A;  4FRO A;  2W0W A;  2PX7 A;  2Y4K A;  4ZDQ A;  3K8D A;  1INJ A;  2DPW A;  5CQO A;  1V82 A;  4Y63 A;  2VFZ A;  4BQH A;  4Y64 A; 
#chains in the Genus database with same CATH topology
 4LW3 A;  2O1F A;  2Y4M A;  3DUV A;  3I0I X;  2C0N A;  1MC3 A;  1IIM A;  3V0P A;  3HL3 A;  5AJN A;  4KC1 A;  3K8E A;  1I52 A;  4CVH A;  2BO7 A;  4O6N A;  2NXV A;  3SX7 A;  1MP5 A;  5CQM X;  1H5S A;  4EVW A;  3POL A;  2JCJ A;  3OH2 A;  1H7E A;  1YP3 A;  3R2W A;  4EE4 A;  1G0R A;  3N9W A;  1GX0 A;  1R7U A;  2JCK A;  4FQW A;  1HM0 A;  5C1H A;  1NHE B;  4FCE A;  2FYC B;  4AC3 A;  4NAL A;  5D92 A;  1FO8 A;  4CJC A;  2A8U A;  1PZY B;  3I0H A;  5CMJ A;  4FIX A;  3V0Q A;  2RJ7 A;  2VS4 A;  1ZIZ A;  5CMG X;  4EEM A;  4NAK A;  3CKO A;  1K4V A;  5CMF X;  2GGQ A;  4Y6N A;  2I5E A;  4D0T A;  1FGG A;  4ARW A;  1VIC A;  1LZI A;  2D0J A;  1ZHJ A;  5FTS A;  2AE7 A;  2JCL A;  1V83 A;  1ZI5 A;  5BXC A;  1ZCY A;  2RJ9 A;  4LW6 A;  3U2W A;  2RIZ A;  2AM5 A;  5IDT A;  3I0D A;  2PGY A;  4HO9 A;  4AYJ A;  2VXM A;  3I0L A;  4HO3 A;  3V0N A;  4M4K A;  1HM8 A;  4ASY A;  2BO6 A;  4EE3 A;  2W0V A;  2RJ5 A;  4KPX A;  3T7N A;  1JYK A;  2P6W A;  2OI6 A;  2XME A;  3F1Y A;  4UEG A;  1INI A;  1JV1 A;  3OH4 A;  1FR9 A;  5C1L A;  1HJJ A;  4KQL A;  3RMW A;  4D11 A;  5FTV A;  4HOC A;  3OH3 A;  1H4E A;  1R7Y A;  1FG5 N;  4D48 A;  3CKN A;  3USQ A;  4R7P A;  3V8Y A;  3QVB A;  3IOJ A;  1W57 A;  1O23 B;  3DJ4 A;  4HO5 A;  3ZF8 A;  5EIY A;  5DDT A;  1W77 A;  1QGS A;  5IFY A;  2VXL A;  4B4M A;  2ZU7 A;  1FWY A;  1VGW A;  1LVW A;  3RMV A;  3D8V A;  3O3P A;  4B3U A;  2OI7 A;  1R82 A;  1SS9 A;  5L6S A;  1ZJ2 A;  3PKP A;  2RIY A;  2VSH A;  1G3L A;  4CJ8 A;  2AGD A;  2I5K A;  4HCQ A;  4Y7F A;  4GBP A;  1NWG B;  2RJ8 A;  5C3A A;  2A8W A;  1NMM B;  4MND A;  1GQC A;  2RIT A;  2YQH A;  3ZLK A;  1W55 A;  1H5T B;  4XWI A;  1OMX A;  5C4C A;  4B2W A;  4Y6U A;  2YQJ A;  3ST8 A;  1LL3 A;  2CU2 A;  1IIN A;  4EEO A;  1G23 A;  5CMH A;  2FYB A;  3BRK X;  3SX5 A;  1ZI3 A;  2J0B A;  2WVK A;  5CQP A;  2X60 A;  1NKH B;  1KWS A;  2RIX A;  4B42 A;  1TVY A;  2WEE A;  5C3B A;  1H7F A;  5JQQ A;  4FRP A;  3OH0 A;  1E5K A;  1VZX A;  4NAN A;  1OQM B;  1R81 A;  1H5R B;  3TQD A;  4IRQ A;  1QGQ A;  1YP2 A;  5FYE A;  4FRB A;  5CQL X;  4B4G A;  1G2V A;  1LZ7 A;  1ZCV A;  4G3Q A;  4J18 A;  2Y4J A;  1ZJ1 A;  1H7G A;  2VS5 A;  1Z90 A;  4FRL A;  4Y7U A;  1GWV A;  1HJL A;  1O0R A;  3I0G A;  5C1G A;  1H7L A;  1R80 A;  4ASJ A;  3CKQ A;  1HM9 A;  5AJP A;  2GGO A;  3LW6 A;  3IOI A;  3T7M A;  4P02 A;  4FRE A;  4MYB A;  3V0O A;  3V0L A;  3I0F A;  1ZJP A;  1LZ0 A;  1ON8 A;  4KC4 A;  3U0X A;  3RSB A;  5CQN X;  1G93 A;  2QKX A;  2WE9 A;  3Q4S A;  1ZI1 A;  3R3I A;  4KT7 A;  4Y7V A;  1FXO A;  1VZT A;  1JYL A;  1EZI A;  5C4E A;  4KXO A;  4O6M A;  4M28 A;  1O7Q A;  2V0K A;  3I0E A;  4B4B A;  1FZW A;  2FYD B;  1R7T A;  3D5N A;  1H4D A;  1WT3 A;  1WT2 A;  2FYA A;  5HS2 A;  2OI5 A;  1NQI B;  2WGZ A;  2X5S A;  2X65 A;  4EEA A;  4KC2 A;  1YP4 A;  2Y4L A;  2YC5 A;  1H7H A;  1WSZ A;  3SXG A;  2FFV A;  4KNX A;  4FRD A;  4NAI A;  3V91 A;  2Z87 A;  4Y62 A;  3ZGG A;  2YQC A;  2YC3 A;  2RJ6 A;  4G87 A;  3U2T A;  2RJ0 A;  3OC9 A;  4KNR A;  4M2B A;  1H5S B;  5FUH A;  3OH1 A;  1LL0 A;  5C4B A;  1XZ6 A;  2AM4 A;  2AEC A;  2AH9 A;  3T7O A;  3CKV A;  3OKR A;  1EYR A;  2X5Z A;  4HO4 A;  2ICX A;  1VGU A;  1QG8 A;  2ICY A;  4DDZ A;  2ZU8 A;  1WT0 A;  2P73 A;  2ZU9 A;  2Y7A A;  1H7T A;  4FCU A;  1GA8 A;  2J0A A;  2VS3 A;  3ZLL A;  2AES A;  3Q80 A;  4KPZ A;  4JD0 A;  3OAM A;  3TZT A;  1R7V A;  4B2X A;  3SXB A;  2V0I A;  4MIX A;  1ZJO A;  3V8Z A;  3JTJ A;  3OGZ A;  2WVM A;  5FU0 A;  4FRH A;  1VPA A;  4L41 C;  4AYL A;  3SPT A;  2QGI A;  2V0H A;  2E3D A;  2AM3 A;  4B5B A;  5DDV A;  1O7O A;  4C2S A;  1VGZ A;  2P72 A;  1LL2 A;  4JIS A;  1R7X A;  3PNN A;  1H5S D;  1WT1 A;  5D91 A;  1VH3 A;  5C8R A;  3Q7U A;  1H4C A;  4AAW A;  1GQ9 A;  5FV9 A;  1G95 A;  1ZJ0 A;  1G8O A;  1H3M A;  2Y6P A;  3CKJ A;  4G3S A;  4FRQ A;  1ON6 A;  2BO4 A;  1QWJ A;  1TW5 A;  2E8B A;  1JVD A;  4HO0 A;  5L6V A;  5I1F A;  3SXD A;  1FGX A;  4IRP A;  2RJ4 A;  4G3P A;  4EEG A;  3E26 A;  3ZGF A;  3EE5 A;  4K6R A;  1PZT A;  1H7Q A;  3SXE A;  2FY7 A;  2PGV A;  1S4O A;  3FWW A;  4Q7C A;  2D7R A;  5AJO A;  2JCO A;  3SX8 A;  1FRW A;  2APC A;  5C4D A;  4HO8 A;  2V0J A;  5C48 A;  1S4N A;  3SXC A;  4BMA A;  5J49 A;  3D98 A;  5FU8 A;  3SX3 A;  4E1K A;  1GWW A;  5EJZ A;  1LZJ A;  3PKQ A;  3V0M A;  3FOQ A;  2WVL A;  1H5T A;  1H5S C;  3CGX A;  1WVC A;  1FOA A;  1HV9 A;  5C38 A;  3IOH A;  1ZCU A;  1VH1 A;  2OEF A;  1ZCT A;  3DK5 A;  2V0L A;  1FR8 A;  1MP3 A;  1G9R A;  4KRV A;  2FFU A;  3CU0 A;  5C47 A;  2PA4 A;  2VSI A;  1NF5 B;  1ZI4 A;  2VD4 A;  2D7I A;  4HG6 A;  1GX4 A;  4M2A A;  1JVG A;  2YQS A;  3I0K A;  1H5R A;  2OEG A;  1ZDF A;  4ECM A;  3I0J A;  3KIA A;  5C4F A;  5CMI A;  3I0C A;  2O1H A;  2YCM A;  4D0Z A;  2XMH A;  3U2X A;  1YRO B;  4Y7T A;  5C49 A;  3USR A;  2RJ1 A;  1G1L A;  5C3D A;  4FIY A;  1G97 A;  3F1C A;  4P00 A;  1VM8 A;  3JUK A;  4HO6 A;  2QH5 A;  1V84 A;  3U2V A;  1TZF A;  2VK9 A;  2MZB A;  4YS8 A;  3SXA A;  2UX8 A;  5EJ1 A;  4FRA A;  1OMZ A;  2XWM A;  1TW1 A;  4CJB A;  4FRM A;  1ZDG A;  2O1G A;  5C36 A;  3U0Y A;  4HO2 A;  3BCV A;  2WAW A;  2XWN A;  3V90 A;  2Z86 A;  3E25 A;  1FO9 A;  1MP4 A;  1VZU A;  2BO8 A;  1XHB A;  3NGW A;  3GUE A;  2I7B A;  1FXJ A;  2XWL A;  4Y9X A;  4D11 C;  4EE5 A;  1S4P A;  1VGT A;  1JV3 A;  4DEC A;  4DE7 A;  3JUJ A;  2YES A;  1ZJ3 A;  5IDS A;  3U2U A;  4Y7G A;  2Q4J A;  4FRO A;  2W0W A;  2PX7 A;  2Y4K A;  4ZDQ A;  3K8D A;  1INJ A;  2DPW A;  5CQO A;  1V82 A;  4Y63 A;  2VFZ A;  4BQH A;  4Y64 A; 
#chains in the Genus database with same CATH homology
 4LW3 A;  2O1F A;  2Y4M A;  3DUV A;  3I0I X;  2C0N A;  1MC3 A;  1IIM A;  3V0P A;  3HL3 A;  5AJN A;  4KC1 A;  3K8E A;  1I52 A;  4CVH A;  2BO7 A;  4O6N A;  2NXV A;  3SX7 A;  1MP5 A;  5CQM X;  1H5S A;  4EVW A;  3POL A;  2JCJ A;  3OH2 A;  1H7E A;  1YP3 A;  3R2W A;  4EE4 A;  1G0R A;  3N9W A;  1GX0 A;  1R7U A;  2JCK A;  4FQW A;  1HM0 A;  5C1H A;  1NHE B;  4FCE A;  2FYC B;  4AC3 A;  4NAL A;  5D92 A;  1FO8 A;  4CJC A;  2A8U A;  1PZY B;  3I0H A;  5CMJ A;  4FIX A;  3V0Q A;  2RJ7 A;  2VS4 A;  1ZIZ A;  5CMG X;  4EEM A;  4NAK A;  3CKO A;  1K4V A;  5CMF X;  2GGQ A;  4Y6N A;  2I5E A;  4D0T A;  1FGG A;  4ARW A;  1VIC A;  1LZI A;  2D0J A;  1ZHJ A;  5FTS A;  2AE7 A;  2JCL A;  1V83 A;  1ZI5 A;  5BXC A;  1ZCY A;  2RJ9 A;  4LW6 A;  3U2W A;  2RIZ A;  2AM5 A;  5IDT A;  3I0D A;  2PGY A;  4HO9 A;  4AYJ A;  2VXM A;  3I0L A;  4HO3 A;  3V0N A;  4M4K A;  1HM8 A;  4ASY A;  2BO6 A;  4EE3 A;  2W0V A;  2RJ5 A;  4KPX A;  3T7N A;  1JYK A;  2P6W A;  2OI6 A;  2XME A;  3F1Y A;  4UEG A;  1INI A;  1JV1 A;  3OH4 A;  1FR9 A;  5C1L A;  1HJJ A;  4KQL A;  3RMW A;  4D11 A;  5FTV A;  4HOC A;  3OH3 A;  1H4E A;  1R7Y A;  1FG5 N;  4D48 A;  3CKN A;  3USQ A;  4R7P A;  3V8Y A;  3QVB A;  3IOJ A;  1W57 A;  1O23 B;  3DJ4 A;  4HO5 A;  3ZF8 A;  5EIY A;  5DDT A;  1W77 A;  1QGS A;  5IFY A;  2VXL A;  4B4M A;  2ZU7 A;  1FWY A;  1VGW A;  1LVW A;  3RMV A;  3D8V A;  3O3P A;  4B3U A;  2OI7 A;  1R82 A;  1SS9 A;  5L6S A;  1ZJ2 A;  3PKP A;  2RIY A;  2VSH A;  1G3L A;  4CJ8 A;  2AGD A;  2I5K A;  4HCQ A;  4Y7F A;  4GBP A;  1NWG B;  2RJ8 A;  5C3A A;  2A8W A;  1NMM B;  4MND A;  1GQC A;  2RIT A;  2YQH A;  3ZLK A;  1W55 A;  1H5T B;  4XWI A;  1OMX A;  5C4C A;  4B2W A;  4Y6U A;  2YQJ A;  3ST8 A;  1LL3 A;  2CU2 A;  1IIN A;  4EEO A;  1G23 A;  5CMH A;  2FYB A;  3BRK X;  3SX5 A;  1ZI3 A;  2J0B A;  2WVK A;  5CQP A;  2X60 A;  1NKH B;  1KWS A;  2RIX A;  4B42 A;  1TVY A;  2WEE A;  5C3B A;  1H7F A;  5JQQ A;  4FRP A;  3OH0 A;  1E5K A;  1VZX A;  4NAN A;  1OQM B;  1R81 A;  1H5R B;  3TQD A;  4IRQ A;  1QGQ A;  1YP2 A;  5FYE A;  4FRB A;  5CQL X;  4B4G A;  1G2V A;  1LZ7 A;  1ZCV A;  4G3Q A;  4J18 A;  2Y4J A;  1ZJ1 A;  1H7G A;  2VS5 A;  1Z90 A;  4FRL A;  4Y7U A;  1GWV A;  1HJL A;  1O0R A;  3I0G A;  5C1G A;  1H7L A;  1R80 A;  4ASJ A;  3CKQ A;  1HM9 A;  5AJP A;  2GGO A;  3LW6 A;  3IOI A;  3T7M A;  4P02 A;  4FRE A;  4MYB A;  3V0O A;  3V0L A;  3I0F A;  1ZJP A;  1LZ0 A;  1ON8 A;  4KC4 A;  3U0X A;  3RSB A;  5CQN X;  1G93 A;  2QKX A;  2WE9 A;  3Q4S A;  1ZI1 A;  3R3I A;  4KT7 A;  4Y7V A;  1FXO A;  1VZT A;  1JYL A;  1EZI A;  5C4E A;  4KXO A;  4O6M A;  4M28 A;  1O7Q A;  2V0K A;  3I0E A;  4B4B A;  1FZW A;  2FYD B;  1R7T A;  3D5N A;  1H4D A;  1WT3 A;  1WT2 A;  2FYA A;  5HS2 A;  2OI5 A;  1NQI B;  2WGZ A;  2X5S A;  2X65 A;  4EEA A;  4KC2 A;  1YP4 A;  2Y4L A;  2YC5 A;  1H7H A;  1WSZ A;  3SXG A;  2FFV A;  4KNX A;  4FRD A;  4NAI A;  3V91 A;  2Z87 A;  4Y62 A;  3ZGG A;  2YQC A;  2YC3 A;  2RJ6 A;  4G87 A;  3U2T A;  2RJ0 A;  3OC9 A;  4KNR A;  4M2B A;  1H5S B;  5FUH A;  3OH1 A;  1LL0 A;  5C4B A;  1XZ6 A;  2AM4 A;  2AEC A;  2AH9 A;  3T7O A;  3CKV A;  3OKR A;  1EYR A;  2X5Z A;  4HO4 A;  2ICX A;  1VGU A;  1QG8 A;  2ICY A;  4DDZ A;  2ZU8 A;  1WT0 A;  2P73 A;  2ZU9 A;  2Y7A A;  1H7T A;  4FCU A;  1GA8 A;  2J0A A;  2VS3 A;  3ZLL A;  2AES A;  3Q80 A;  4KPZ A;  4JD0 A;  3OAM A;  3TZT A;  1R7V A;  4B2X A;  3SXB A;  2V0I A;  4MIX A;  1ZJO A;  3V8Z A;  3JTJ A;  3OGZ A;  2WVM A;  5FU0 A;  4FRH A;  1VPA A;  4L41 C;  4AYL A;  3SPT A;  2QGI A;  2V0H A;  2E3D A;  2AM3 A;  4B5B A;  5DDV A;  1O7O A;  4C2S A;  1VGZ A;  2P72 A;  1LL2 A;  4JIS A;  1R7X A;  3PNN A;  1H5S D;  1WT1 A;  5D91 A;  1VH3 A;  5C8R A;  3Q7U A;  1H4C A;  4AAW A;  1GQ9 A;  5FV9 A;  1G95 A;  1ZJ0 A;  1G8O A;  1H3M A;  2Y6P A;  3CKJ A;  4G3S A;  4FRQ A;  1ON6 A;  2BO4 A;  1QWJ A;  1TW5 A;  2E8B A;  1JVD A;  4HO0 A;  5L6V A;  5I1F A;  3SXD A;  1FGX A;  4IRP A;  2RJ4 A;  4G3P A;  4EEG A;  3E26 A;  3ZGF A;  3EE5 A;  4K6R A;  1PZT A;  1H7Q A;  3SXE A;  2FY7 A;  2PGV A;  1S4O A;  3FWW A;  4Q7C A;  2D7R A;  5AJO A;  2JCO A;  3SX8 A;  1FRW A;  2APC A;  5C4D A;  4HO8 A;  2V0J A;  5C48 A;  1S4N A;  3SXC A;  4BMA A;  5J49 A;  3D98 A;  5FU8 A;  3SX3 A;  4E1K A;  1GWW A;  5EJZ A;  1LZJ A;  3PKQ A;  3V0M A;  3FOQ A;  2WVL A;  1H5T A;  1H5S C;  3CGX A;  1WVC A;  1FOA A;  1HV9 A;  5C38 A;  3IOH A;  1ZCU A;  1VH1 A;  2OEF A;  1ZCT A;  3DK5 A;  2V0L A;  1FR8 A;  1MP3 A;  1G9R A;  4KRV A;  2FFU A;  3CU0 A;  5C47 A;  2PA4 A;  2VSI A;  1NF5 B;  1ZI4 A;  2VD4 A;  2D7I A;  4HG6 A;  1GX4 A;  4M2A A;  1JVG A;  2YQS A;  3I0K A;  1H5R A;  2OEG A;  1ZDF A;  4ECM A;  3I0J A;  3KIA A;  5C4F A;  5CMI A;  3I0C A;  2O1H A;  2YCM A;  4D0Z A;  2XMH A;  3U2X A;  1YRO B;  4Y7T A;  5C49 A;  3USR A;  2RJ1 A;  1G1L A;  5C3D A;  4FIY A;  1G97 A;  3F1C A;  4P00 A;  1VM8 A;  3JUK A;  4HO6 A;  2QH5 A;  1V84 A;  3U2V A;  1TZF A;  2VK9 A;  2MZB A;  4YS8 A;  3SXA A;  2UX8 A;  5EJ1 A;  4FRA A;  1OMZ A;  2XWM A;  1TW1 A;  4CJB A;  4FRM A;  1ZDG A;  2O1G A;  5C36 A;  3U0Y A;  4HO2 A;  3BCV A;  2WAW A;  2XWN A;  3V90 A;  2Z86 A;  3E25 A;  1FO9 A;  1MP4 A;  1VZU A;  2BO8 A;  1XHB A;  3NGW A;  3GUE A;  2I7B A;  1FXJ A;  2XWL A;  4Y9X A;  4D11 C;  4EE5 A;  1S4P A;  1VGT A;  1JV3 A;  4DEC A;  4DE7 A;  3JUJ A;  2YES A;  1ZJ3 A;  5IDS A;  3U2U A;  4Y7G A;  2Q4J A;  4FRO A;  2W0W A;  2PX7 A;  2Y4K A;  4ZDQ A;  3K8D A;  1INJ A;  2DPW A;  5CQO A;  1V82 A;  4Y63 A;  2VFZ A;  4BQH A;  4Y64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...