4UEGA

Crystal structure of human glycogenin-2 catalytic domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
242
Chain Sequence
TDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSDLLRRILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSSPAFKQFGSSAKVVHFLGSMKPWNYKYQAAFLHLWWTVYQNNVLPLYKSVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGENIN-2
publication title Crystal Structure of Human Glycogenin-2 Catalytic Domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 242
sequence length 266
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4uegA00
4ECMA 4M28A 4HO3A 5CQMX 1LZ0A 4HO2A 5C4CA 4J18A 1H7LA 1HM9A 1WVCA 5C3DA 2XMEA 1W77A 1G97A 1ZIZA 4Y7VA 4HCQA 1MP4A 2ZU7A 4KT7A 2QKXA 1O23B 5C1HA 1H5RB 2RJ1A 3V0OA 3SPTA 2RITA 2X5SA 4LW6A 3SX8A 5DDTA 4LW3A 2Q4JA 1WT0A 3I0HA 3HL3A 3ST8A 3LW6A 3T7NA 2RIZA 4KNRA 5FU8A 3O3PA 4CJBA 2GGQA 1H5TB 1H7FA 2FYDB 3SX3A 4KQLA 5C3AA 3FOQA 1IINA 4BMAA 1H4DA 1H5SD 4ZDQA 4P02A 1LZIA 3OH1A 4Y64A 1ZJPA 4B4GA 2VXLA 2OI7A 3I0IX 3SX5A 3V0NA 3T7OA 1Z90A 2BO7A 3OC9A 4HOCA 5HS2A 4EVWA 1VZTA 3QVBA 1FOAA 4EE4A 1QG8A 2FYCB 3SXEA 4D11A 3BCVA 2V0HA 1ZCTA 4KPXA 2XWMA 1JYLA 3D8VA 1SS9A 3Q4SA 5FUHA 3ZLKA 2A8UA 2Y4LA 1INJA 2P73A 5C49A 2X65A 3V8ZA 2Y4MA 2AM4A 5CMJA 1XZ6A 2GGOA 5CQPA 4FRMA 4JD0A 2RJ0A 3R2WA 1V83A 3I0FA 1R7UA 5C48A 4FCUA 3PKQA 4D0ZA 2VSHA 1INIA 2ICXA 2NXVA 1FG5N 4Y6NA 1ZHJA 2QH5A 3K8EA 1VH3A 4NALA 2WEEA 1LZ7A 2JCKA 1QGQA 5CQOA 2JCOA 1FXJA 2AE7A 2V0IA 4KPZA 2FFUA 3OH0A 3D5NA 4FRQA 3SXAA 5IFYA 5C4FA 2WGZA 1GQ9A 1VZXA 4MNDA 5L6VA 2V0LA 1FR9A 3OAMA 5FTSA 1JYKA 3OKRA 1ZCYA 4FRPA 5C1GA 1WSZA 3TZTA 5FV9A 1VGTA 1VZUA 4AYJA 2AH9A 3KIAA 2YC5A 3V0MA 2RJ9A 2O1HA 3CKQA 1R81A 2VS4A 4Y6UA 1H7TA 2JCLA 3ZGFA 4ASJA 2X60A 3I0GA 4EE5A 2VS5A 4CVHA 1ZJ1A 4B2WA 3NGWA 1G8OA 3I0EA 2ZU8A 1ZI1A 1K4VA 1YP3A 3R3IA 1H4EA 1VH1A 1VPAA 4HO9A 4IRQA 3I0LA 2VFZA 1VM8A 1S4PA 3E26A 1H3MA 5C4EA 3CU0A 4IRPA 1ZJ3A 2O1FA 1H5RA 1YROB 1R82A 4ARWA 1G2VA 1ZJOA 5FTVA 5EIYA 3BRKX 5CQLX 1NQIB 4Y7GA 1JVGA 4EEGA 4EEMA 1R7XA 4D48A 2PGVA 2O1GA 5EJZA 1LZJA 1H7HA 1GWWA 1OQMB 3K8DA 5JQQA 4K6RA 1FXOA 3USQA 3CKVA 1MP3A 1H5TA 4FRHA 1JV1A 1HV9A 4UEGA 1S4NA 1WT1A 1QGSA 5L6SA 4M2BA 4JISA 1TW5A 1EZIA 5C36A 2AM3A 5AJNA 2XMHA 1R7YA 3DJ4A 2FYBA 3F1CA 2ICYA 2V0JA 4FREA 3TQDA 3E25A 3CKNA 5DDVA 3V0LA 4FRDA 3SXBA 1FO9A 1PZYB 4YS8A 1H5SB 1NHEB 3Q7UA 1OMXA 3U2UA 1MP5A 2MZBA 1TW1A 1I52A 4B5BA 3USRA 3U2WA 1O7QA 3I0CA 4EEOA 2OI5A 1LVWA 2BO4A 4M2AA 4AAWA 4Y7FA 1ZJ0A 1IIMA 1FGGA 1VGZA 1KWSA 4G3SA 3ZGGA 1NF5B 1JV3A 4XWIA 1NKHB 4D0TA 3OH4A 2Y7AA 2OI6A 4B42A 5C38A 5IDTA 4Y7UA 1VGUA 4G3PA 4FROA 4NAIA 2Z86A 1MC3A 1ZJ2A 1G3LA 1G9RA 4DE7A 2FY7A 2OEFA 1G1LA 4KRVA 2BO6A 2JCJA 1FZWA 2D7IA 3N9WA 2E8BA 4L41C 4G3QA 3PKPA 1GX4A 1HJLA 2XWLA 3CGXA 1W57A 4MYBA 5I1FA 1ZCVA 2AM5A 1HJJA 1H7QA 1H5SC 2VD4A 1ON8A 2FFVA 2Y4KA 4B4MA 2ZU9A 4KC2A 1H7EA 1YP4A 3CKOA 3IOJA 1V84A 1EYRA 5AJOA 1TZFA 1ZI5A 1O0RA 3SXCA 1E5KA 3SX7A 4HO0A 1OMZA 1FWYA 1R80A 2A8WA 4Y7TA 1G93A 2P6WA 2YQJA 4KXOA 4NAKA 2QGIA 4Y62A 2RIYA 3V90A 2RJ7A 1WT3A 4HO4A 1FO8A 1QWJA 2D7RA 4E1KA 2WVMA 2I7BA 2YESA 3EE5A 1GWVA 4HO8A 2D0JA 2OEGA 4FRAA 4DECA 1S4OA 4KNXA 1G0RA 2VS3A 5C3BA 2RJ5A 3U0YA 3U0XA 3V91A 2PX7A 4HG6A 2YQCA 3I0KA 2RIXA 4KC1A 1NMMB 3D98A 4NANA 2CU2A 1HM0A 3ZF8A 5CMFX 1GQCA 3U2VA 2WAWA 3IOHA 1H7GA 5C4BA 4KC4A 2RJ6A 4CJ8A 2Z87A 3OGZA 2AECA 2VXMA 3JUJA 4EEAA 2V0KA 3T7MA 2WVKA 3FWWA 3I0DA 2I5KA 2W0WA 4AYLA 2XWNA 3ZLLA 5EJ1A 1VGWA 3I0JA 2YQHA 3CKJA 3DUVA 4C2SA 1H5SA 5CMGX 2PA4A 3DK5A 3Q80A 4G87A 1O7OA 3GUEA 1GX0A 4R7PA 1XHBA 3IOIA 2YCMA 1ZCUA 3V0PA 4GBPA 4FCEA 2WE9A 4BQHA 2FYAA 4HO6A 3POLA 5C47A 3OH3A 1W55A 5CMHA 2AESA 1PZTA 5FU0A 2W0VA 1LL3A 1R7TA 1V82A 4DDZA 2X5ZA 1YP2A 5IDSA 4HO5A 3SXGA 5C1LA 4CJCA 3V0QA 5J49A 5C4DA 4B4BA 5C8RA 1ZI3A 2APCA 2BO8A 1H4CA 1TVYA 1ZDGA 3JTJA 4B3UA 1GA8A 3U2TA 2DPWA 1LL0A 1JVDA 1FR8A 1LL2A 4FRLA 2Y4JA 1ON6A 3OH2A 4Y9XA 5BXCA 4EE3A 5CQNX 1FRWA 4P00A 3F1YA 3RSBA 4B2XA 1G23A 2RJ8A 2WVLA 1R7VA 1VICA 4FQWA 5FYEA 2I5EA 3PNNA 1G95A 2UX8A 3V8YA 3U2XA 5AJPA 2RJ4A 5CMIA 1NWGB 2VSIA 4FRBA 1HM8A 2PGYA 3RMWA 4M4KA 3RMVA 2Y6PA 1WT2A 3SXDA 4ASYA 4D11C 2AGDA 2E3DA 2YC3A 1ZDFA 1ZI4A 2P72A 3JUKA 1FGXA 2YQSA 4AC3A 4Y63A
chains in the Genus database with same CATH superfamily
4ECMA 4M28A 5D91A 4HO3A 5CQMX 1LZ0A 4HO2A 5C4CA 4J18A 1H7LA 1HM9A 1WVCA 5C3DA 2XMEA 1W77A 1G97A 1ZIZA 4Y7VA 4HCQA 1MP4A 2ZU7A 4KT7A 2QKXA 1O23B 5C1HA 1H5RB 2RJ1A 3V0OA 3SPTA 2RITA 2X5SA 4LW6A 3SX8A 5DDTA 4LW3A 2Q4JA 1WT0A 3I0HA 3HL3A 3ST8A 3LW6A 3T7NA 2RIZA 4KNRA 5FU8A 3O3PA 4CJBA 2GGQA 1H5TB 1H7FA 2FYDB 3SX3A 4KQLA 5C3AA 3FOQA 1IINA 4BMAA 1H4DA 1H5SD 4ZDQA 4P02A 1LZIA 3OH1A 4Y64A 1ZJPA 4B4GA 2VXLA 2OI7A 3I0IX 3SX5A 3V0NA 4Q7CA 3T7OA 1Z90A 2BO7A 3OC9A 4HOCA 5HS2A 4EVWA 1VZTA 3QVBA 1FOAA 4EE4A 1QG8A 2FYCB 3SXEA 4D11A 3BCVA 2V0HA 1ZCTA 4KPXA 5D92A 2XWMA 1JYLA 3D8VA 1SS9A 3Q4SA 5FUHA 3ZLKA 2A8UA 2Y4LA 1INJA 2P73A 5C49A 2VK9A 2X65A 3V8ZA 2Y4MA 2AM4A 5CMJA 1XZ6A 2GGOA 5CQPA 4FRMA 4JD0A 2RJ0A 3R2WA 1V83A 3I0FA 1R7UA 5C48A 4FCUA 3PKQA 4D0ZA 2VSHA 1INIA 2ICXA 2NXVA 1FG5N 4Y6NA 1ZHJA 2QH5A 3K8EA 1VH3A 4NALA 2WEEA 1LZ7A 2JCKA 1QGQA 5CQOA 2JCOA 1FXJA 2AE7A 2V0IA 4KPZA 2FFUA 3OH0A 3D5NA 4FRQA 3SXAA 5IFYA 5C4FA 2WGZA 1GQ9A 1VZXA 4MNDA 5L6VA 2V0LA 1FR9A 3OAMA 5FTSA 1JYKA 3OKRA 1ZCYA 4FRPA 5C1GA 1WSZA 3TZTA 5FV9A 1VGTA 1VZUA 4AYJA 2AH9A 3KIAA 2YC5A 3V0MA 2RJ9A 2O1HA 3CKQA 1R81A 2VS4A 4Y6UA 1H7TA 2JCLA 3ZGFA 4ASJA 2X60A 3I0GA 4FIYA 4EE5A 2VS5A 4CVHA 1ZJ1A 4B2WA 3NGWA 1G8OA 3I0EA 2ZU8A 1ZI1A 1K4VA 1YP3A 3R3IA 1H4EA 1VH1A 1VPAA 4HO9A 4IRQA 3I0LA 2VFZA 1VM8A 1S4PA 3E26A 1H3MA 5C4EA 3CU0A 4IRPA 1ZJ3A 2O1FA 1H5RA 1YROB 1R82A 4ARWA 1G2VA 1ZJOA 5FTVA 5EIYA 3BRKX 5CQLX 1NQIB 4Y7GA 1JVGA 4EEGA 4EEMA 1R7XA 4D48A 2PGVA 2O1GA 5EJZA 1LZJA 1H7HA 1GWWA 1OQMB 3K8DA 5JQQA 4K6RA 1FXOA 3USQA 3CKVA 1MP3A 1H5TA 4FRHA 4O6NA 1JV1A 1HV9A 4UEGA 1S4NA 1WT1A 1QGSA 5L6SA 4M2BA 4JISA 1TW5A 1EZIA 5C36A 2AM3A 5AJNA 2XMHA 1R7YA 3DJ4A 2FYBA 3F1CA 2ICYA 2V0JA 4FREA 3TQDA 3E25A 3CKNA 5DDVA 3V0LA 4FRDA 3SXBA 1FO9A 1PZYB 4YS8A 1H5SB 2J0AA 1NHEB 3Q7UA 1OMXA 3U2UA 1MP5A 2MZBA 1TW1A 1I52A 4B5BA 3USRA 3U2WA 1O7QA 3I0CA 4EEOA 2OI5A 1LVWA 2BO4A 4M2AA 4AAWA 4Y7FA 1ZJ0A 1IIMA 1FGGA 1VGZA 1KWSA 4G3SA 3ZGGA 1NF5B 1JV3A 4XWIA 1NKHB 4D0TA 3OH4A 2Y7AA 2OI6A 4B42A 5C38A 5IDTA 4Y7UA 1VGUA 4G3PA 4FROA 4NAIA 2Z86A 1MC3A 1ZJ2A 1G3LA 1G9RA 4DE7A 2FY7A 2OEFA 1G1LA 4KRVA 2BO6A 2JCJA 1FZWA 2D7IA 3N9WA 2E8BA 4L41C 4G3QA 3PKPA 2C0NA 1GX4A 1HJLA 2XWLA 3CGXA 1W57A 4MYBA 5I1FA 1ZCVA 2AM5A 1HJJA 1H7QA 1H5SC 2VD4A 1ON8A 2FFVA 2Y4KA 4B4MA 2ZU9A 4KC2A 1H7EA 1YP4A 3CKOA 3IOJA 1V84A 1EYRA 4FIXA 1TZFA 5AJOA 1ZI5A 1O0RA 3SXCA 1E5KA 3SX7A 4HO0A 1OMZA 1FWYA 1R80A 2A8WA 4Y7TA 1G93A 4MIXA 2P6WA 2YQJA 4KXOA 4NAKA 2J0BA 2QGIA 4Y62A 2RIYA 3V90A 2RJ7A 1WT3A 4HO4A 1FO8A 1QWJA 2D7RA 4E1KA 2WVMA 2I7BA 2YESA 3EE5A 1GWVA 4HO8A 2D0JA 2OEGA 4FRAA 4DECA 1S4OA 4KNXA 1G0RA 2VS3A 5C3BA 2RJ5A 3U0YA 3U0XA 3V91A 2PX7A 4HG6A 2YQCA 3I0KA 2RIXA 4KC1A 1NMMB 3D98A 4NANA 2CU2A 1HM0A 3ZF8A 5CMFX 1GQCA 3U2VA 2WAWA 3IOHA 1H7GA 5C4BA 4KC4A 2RJ6A 4CJ8A 2Z87A 3OGZA 2AECA 2VXMA 3JUJA 4EEAA 2V0KA 3T7MA 2WVKA 3FWWA 3I0DA 2I5KA 2W0WA 4AYLA 2XWNA 4O6MA 3ZLLA 5EJ1A 1VGWA 3I0JA 2YQHA 3CKJA 3DUVA 4C2SA 1H5SA 5CMGX 2PA4A 3DK5A 3Q80A 4G87A 1O7OA 3GUEA 1GX0A 4R7PA 1XHBA 3IOIA 2YCMA 1ZCUA 3V0PA 4GBPA 4FCEA 2WE9A 4BQHA 2FYAA 4HO6A 3POLA 5C47A 3OH3A 1W55A 5CMHA 2AESA 1PZTA 5FU0A 2W0VA 1LL3A 1R7TA 1V82A 4DDZA 2X5ZA 1YP2A 5IDSA 4HO5A 3SXGA 5C1LA 4CJCA 3V0QA 5J49A 5C4DA 4B4BA 5C8RA 1ZI3A 2APCA 2BO8A 1H4CA 1TVYA 1ZDGA 3JTJA 4B3UA 1GA8A 3U2TA 2DPWA 1LL0A 1JVDA 1FR8A 1LL2A 4FRLA 2Y4JA 1ON6A 3OH2A 4Y9XA 5BXCA 4EE3A 5CQNX 1FRWA 4P00A 3F1YA 3RSBA 4B2XA 1G23A 2RJ8A 2WVLA 1R7VA 1VICA 4FQWA 5FYEA 2I5EA 3PNNA 1G95A 2UX8A 3V8YA 3U2XA 5AJPA 2RJ4A 5CMIA 1NWGB 2VSIA 4FRBA 1HM8A 2PGYA 3RMWA 4M4KA 3RMVA 2Y6PA 1WT2A 3SXDA 4ASYA 4D11C 2AGDA 2E3DA 2YC3A 1ZDFA 1ZI4A 2P72A 3JUKA 1FGXA 2YQSA 4AC3A 4Y63A
chains in the Genus database with same CATH topology
4ECMA 4M28A 5D91A 4HO3A 5CQMX 1LZ0A 4HO2A 5C4CA 4J18A 1H7LA 1HM9A 1WVCA 5C3DA 2XMEA 1W77A 1G97A 1ZIZA 4Y7VA 4HCQA 1MP4A 2ZU7A 4KT7A 2QKXA 1O23B 5C1HA 1H5RB 2RJ1A 3V0OA 3SPTA 2RITA 2X5SA 4LW6A 3SX8A 5DDTA 4LW3A 2Q4JA 1WT0A 3I0HA 3HL3A 3ST8A 3LW6A 3T7NA 2RIZA 4KNRA 5FU8A 3O3PA 4CJBA 2GGQA 1H5TB 1H7FA 2FYDB 3SX3A 4KQLA 5C3AA 3FOQA 1IINA 4BMAA 1H4DA 1H5SD 4ZDQA 4P02A 1LZIA 3OH1A 4Y64A 1ZJPA 4B4GA 2VXLA 2OI7A 3I0IX 3SX5A 3V0NA 4Q7CA 3T7OA 1Z90A 2BO7A 3OC9A 4HOCA 5HS2A 4EVWA 1VZTA 3QVBA 1FOAA 4EE4A 1QG8A 2FYCB 3SXEA 4D11A 3BCVA 2V0HA 1ZCTA 4KPXA 5D92A 2XWMA 1JYLA 3D8VA 1SS9A 3Q4SA 5FUHA 3ZLKA 2A8UA 2Y4LA 1INJA 2P73A 5C49A 2VK9A 2X65A 3V8ZA 2Y4MA 2AM4A 5CMJA 1XZ6A 2GGOA 5CQPA 4FRMA 4JD0A 2RJ0A 3R2WA 1V83A 3I0FA 1R7UA 5C48A 4FCUA 3PKQA 4D0ZA 2VSHA 1INIA 2ICXA 2NXVA 1FG5N 4Y6NA 1ZHJA 2QH5A 3K8EA 1VH3A 4NALA 2WEEA 1LZ7A 2JCKA 1QGQA 5CQOA 2JCOA 1FXJA 2AE7A 2V0IA 4KPZA 2FFUA 3OH0A 3D5NA 4FRQA 3SXAA 5IFYA 5C4FA 2WGZA 1GQ9A 1VZXA 4MNDA 5L6VA 2V0LA 1FR9A 3OAMA 5FTSA 1JYKA 3OKRA 1ZCYA 4FRPA 5C1GA 1WSZA 3TZTA 5FV9A 1VGTA 1VZUA 4AYJA 2AH9A 3KIAA 2YC5A 3V0MA 2RJ9A 2O1HA 3CKQA 1R81A 2VS4A 4Y6UA 1H7TA 2JCLA 3ZGFA 4ASJA 2X60A 3I0GA 4FIYA 4EE5A 2VS5A 4CVHA 1ZJ1A 4B2WA 3NGWA 1G8OA 3I0EA 2ZU8A 1ZI1A 1K4VA 1YP3A 3R3IA 1H4EA 1VH1A 1VPAA 4HO9A 4IRQA 3I0LA 2VFZA 1VM8A 1S4PA 3E26A 1H3MA 5C4EA 3CU0A 4IRPA 1ZJ3A 2O1FA 1H5RA 1YROB 1R82A 4ARWA 1G2VA 1ZJOA 5FTVA 5EIYA 3BRKX 5CQLX 1NQIB 4Y7GA 1JVGA 4EEGA 4EEMA 1R7XA 4D48A 2PGVA 2O1GA 5EJZA 1LZJA 1H7HA 1GWWA 1OQMB 3K8DA 5JQQA 4K6RA 1FXOA 3USQA 3CKVA 1MP3A 1H5TA 4FRHA 4O6NA 1JV1A 1HV9A 4UEGA 1S4NA 1WT1A 1QGSA 5L6SA 4M2BA 4JISA 1TW5A 1EZIA 5C36A 2AM3A 5AJNA 2XMHA 1R7YA 3DJ4A 2FYBA 3F1CA 2ICYA 2V0JA 4FREA 3TQDA 3E25A 3CKNA 5DDVA 3V0LA 4FRDA 3SXBA 1FO9A 1PZYB 4YS8A 1H5SB 2J0AA 1NHEB 3Q7UA 1OMXA 3U2UA 1MP5A 2MZBA 1TW1A 1I52A 4B5BA 3USRA 3U2WA 1O7QA 3I0CA 4EEOA 2OI5A 1LVWA 2BO4A 4M2AA 4AAWA 4Y7FA 1ZJ0A 1IIMA 1FGGA 1VGZA 1KWSA 4G3SA 3ZGGA 1NF5B 1JV3A 4XWIA 1NKHB 4D0TA 3OH4A 2Y7AA 2OI6A 4B42A 5C38A 5IDTA 4Y7UA 1VGUA 4G3PA 4FROA 4NAIA 2Z86A 1MC3A 1ZJ2A 1G3LA 1G9RA 4DE7A 2FY7A 2OEFA 1G1LA 4KRVA 2BO6A 2JCJA 1FZWA 2D7IA 3N9WA 2E8BA 4L41C 4G3QA 3PKPA 2C0NA 1GX4A 1HJLA 2XWLA 3CGXA 1W57A 4MYBA 5I1FA 1ZCVA 2AM5A 1HJJA 1H7QA 1H5SC 2VD4A 1ON8A 2FFVA 2Y4KA 4B4MA 2ZU9A 4KC2A 1H7EA 1YP4A 3CKOA 3IOJA 1V84A 1EYRA 4FIXA 1TZFA 5AJOA 1ZI5A 1O0RA 3SXCA 1E5KA 3SX7A 4HO0A 1OMZA 1FWYA 1R80A 2A8WA 4Y7TA 1G93A 4MIXA 2P6WA 2YQJA 4KXOA 4NAKA 2J0BA 2QGIA 4Y62A 2RIYA 3V90A 2RJ7A 1WT3A 4HO4A 1FO8A 1QWJA 2D7RA 4E1KA 2WVMA 2I7BA 2YESA 3EE5A 1GWVA 4HO8A 2D0JA 2OEGA 4FRAA 4DECA 1S4OA 4KNXA 1G0RA 2VS3A 5C3BA 2RJ5A 3U0YA 3U0XA 3V91A 2PX7A 4HG6A 2YQCA 3I0KA 2RIXA 4KC1A 1NMMB 3D98A 4NANA 2CU2A 1HM0A 3ZF8A 5CMFX 1GQCA 3U2VA 2WAWA 3IOHA 1H7GA 5C4BA 4KC4A 2RJ6A 4CJ8A 2Z87A 3OGZA 2AECA 2VXMA 3JUJA 4EEAA 2V0KA 3T7MA 2WVKA 3FWWA 3I0DA 2I5KA 2W0WA 4AYLA 2XWNA 4O6MA 3ZLLA 5EJ1A 1VGWA 3I0JA 2YQHA 3CKJA 3DUVA 4C2SA 1H5SA 5CMGX 2PA4A 3DK5A 3Q80A 4G87A 1O7OA 3GUEA 1GX0A 4R7PA 1XHBA 3IOIA 2YCMA 1ZCUA 3V0PA 4GBPA 4FCEA 2WE9A 4BQHA 2FYAA 4HO6A 3POLA 5C47A 3OH3A 1W55A 5CMHA 2AESA 1PZTA 5FU0A 2W0VA 1LL3A 1R7TA 1V82A 4DDZA 2X5ZA 1YP2A 5IDSA 4HO5A 3SXGA 5C1LA 4CJCA 3V0QA 5J49A 5C4DA 4B4BA 5C8RA 1ZI3A 2APCA 2BO8A 1H4CA 1TVYA 1ZDGA 3JTJA 4B3UA 1GA8A 3U2TA 2DPWA 1LL0A 1JVDA 1FR8A 1LL2A 4FRLA 2Y4JA 1ON6A 3OH2A 4Y9XA 5BXCA 4EE3A 5CQNX 1FRWA 4P00A 3F1YA 3RSBA 4B2XA 1G23A 2RJ8A 2WVLA 1R7VA 1VICA 4FQWA 5FYEA 2I5EA 3PNNA 1G95A 2UX8A 3V8YA 3U2XA 5AJPA 2RJ4A 5CMIA 1NWGB 2VSIA 4FRBA 1HM8A 2PGYA 3RMWA 4M4KA 3RMVA 2Y6PA 1WT2A 3SXDA 4ASYA 4D11C 2AGDA 2E3DA 2YC3A 1ZDFA 1ZI4A 2P72A 3JUKA 1FGXA 2YQSA 4AC3A 4Y63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECM A;  4M28 A;  4HO3 A;  5CQM X;  1LZ0 A;  4HO2 A;  5C4C A;  4J18 A;  1H7L A;  1HM9 A;  1WVC A;  5C3D A;  2XME A;  1W77 A;  1G97 A;  1ZIZ A;  4Y7V A;  4HCQ A;  1MP4 A;  2ZU7 A;  4KT7 A;  2QKX A;  1O23 B;  5C1H A;  1H5R B;  2RJ1 A;  3V0O A;  3SPT A;  2RIT A;  2X5S A;  4LW6 A;  3SX8 A;  5DDT A;  4LW3 A;  2Q4J A;  1WT0 A;  3I0H A;  3HL3 A;  3ST8 A;  3LW6 A;  3T7N A;  2RIZ A;  4KNR A;  5FU8 A;  3O3P A;  4CJB A;  2GGQ A;  1H5T B;  1H7F A;  2FYD B;  3SX3 A;  4KQL A;  5C3A A;  3FOQ A;  1IIN A;  4BMA A;  1H4D A;  1H5S D;  4ZDQ A;  4P02 A;  1LZI A;  3OH1 A;  4Y64 A;  1ZJP A;  4B4G A;  2VXL A;  2OI7 A;  3I0I X;  3SX5 A;  3V0N A;  3T7O A;  1Z90 A;  2BO7 A;  3OC9 A;  4HOC A;  5HS2 A;  4EVW A;  1VZT A;  3QVB A;  1FOA A;  4EE4 A;  1QG8 A;  2FYC B;  3SXE A;  4D11 A;  3BCV A;  2V0H A;  1ZCT A;  4KPX A;  2XWM A;  1JYL A;  3D8V A;  1SS9 A;  3Q4S A;  5FUH A;  3ZLK A;  2A8U A;  2Y4L A;  1INJ A;  2P73 A;  5C49 A;  2X65 A;  3V8Z A;  2Y4M A;  2AM4 A;  5CMJ A;  1XZ6 A;  2GGO A;  5CQP A;  4FRM A;  4JD0 A;  2RJ0 A;  3R2W A;  1V83 A;  3I0F A;  1R7U A;  5C48 A;  4FCU A;  3PKQ A;  4D0Z A;  2VSH A;  1INI A;  2ICX A;  2NXV A;  1FG5 N;  4Y6N A;  1ZHJ A;  2QH5 A;  3K8E A;  1VH3 A;  4NAL A;  2WEE A;  1LZ7 A;  2JCK A;  1QGQ A;  5CQO A;  2JCO A;  1FXJ A;  2AE7 A;  2V0I A;  4KPZ A;  2FFU A;  3OH0 A;  3D5N A;  4FRQ A;  3SXA A;  5IFY A;  5C4F A;  2WGZ A;  1GQ9 A;  1VZX A;  4MND A;  5L6V A;  2V0L A;  1FR9 A;  3OAM A;  5FTS A;  1JYK A;  3OKR A;  1ZCY A;  4FRP A;  5C1G A;  1WSZ A;  3TZT A;  5FV9 A;  1VGT A;  1VZU A;  4AYJ A;  2AH9 A;  3KIA A;  2YC5 A;  3V0M A;  2RJ9 A;  2O1H A;  3CKQ A;  1R81 A;  2VS4 A;  4Y6U A;  1H7T A;  2JCL A;  3ZGF A;  4ASJ A;  2X60 A;  3I0G A;  4EE5 A;  2VS5 A;  4CVH A;  1ZJ1 A;  4B2W A;  3NGW A;  1G8O A;  3I0E A;  2ZU8 A;  1ZI1 A;  1K4V A;  1YP3 A;  3R3I A;  1H4E A;  1VH1 A;  1VPA A;  4HO9 A;  4IRQ A;  3I0L A;  2VFZ A;  1VM8 A;  1S4P A;  3E26 A;  1H3M A;  5C4E A;  3CU0 A;  4IRP A;  1ZJ3 A;  2O1F A;  1H5R A;  1YRO B;  1R82 A;  4ARW A;  1G2V A;  1ZJO A;  5FTV A;  5EIY A;  3BRK X;  5CQL X;  1NQI B;  4Y7G A;  1JVG A;  4EEG A;  4EEM A;  1R7X A;  4D48 A;  2PGV A;  2O1G A;  5EJZ A;  1LZJ A;  1H7H A;  1GWW A;  1OQM B;  3K8D A;  5JQQ A;  4K6R A;  1FXO A;  3USQ A;  3CKV A;  1MP3 A;  1H5T A;  4FRH A;  1JV1 A;  1HV9 A;  4UEG A;  1S4N A;  1WT1 A;  1QGS A;  5L6S A;  4M2B A;  4JIS A;  1TW5 A;  1EZI A;  5C36 A;  2AM3 A;  5AJN A;  2XMH A;  1R7Y A;  3DJ4 A;  2FYB A;  3F1C A;  2ICY A;  2V0J A;  4FRE A;  3TQD A;  3E25 A;  3CKN A;  5DDV A;  3V0L A;  4FRD A;  3SXB A;  1FO9 A;  1PZY B;  4YS8 A;  1H5S B;  1NHE B;  3Q7U A;  1OMX A;  3U2U A;  1MP5 A;  2MZB A;  1TW1 A;  1I52 A;  4B5B A;  3USR A;  3U2W A;  1O7Q A;  3I0C A;  4EEO A;  2OI5 A;  1LVW A;  2BO4 A;  4M2A A;  4AAW A;  4Y7F A;  1ZJ0 A;  1IIM A;  1FGG A;  1VGZ A;  1KWS A;  4G3S A;  3ZGG A;  1NF5 B;  1JV3 A;  4XWI A;  1NKH B;  4D0T A;  3OH4 A;  2Y7A A;  2OI6 A;  4B42 A;  5C38 A;  5IDT A;  4Y7U A;  1VGU A;  4G3P A;  4FRO A;  4NAI A;  2Z86 A;  1MC3 A;  1ZJ2 A;  1G3L A;  1G9R A;  4DE7 A;  2FY7 A;  2OEF A;  1G1L A;  4KRV A;  2BO6 A;  2JCJ A;  1FZW A;  2D7I A;  3N9W A;  2E8B A;  4L41 C;  4G3Q A;  3PKP A;  1GX4 A;  1HJL A;  2XWL A;  3CGX A;  1W57 A;  4MYB A;  5I1F A;  1ZCV A;  2AM5 A;  1HJJ A;  1H7Q A;  1H5S C;  2VD4 A;  1ON8 A;  2FFV A;  2Y4K A;  4B4M A;  2ZU9 A;  4KC2 A;  1H7E A;  1YP4 A;  3CKO A;  3IOJ A;  1V84 A;  1EYR A;  5AJO A;  1TZF A;  1ZI5 A;  1O0R A;  3SXC A;  1E5K A;  3SX7 A;  4HO0 A;  1OMZ A;  1FWY A;  1R80 A;  2A8W A;  4Y7T A;  1G93 A;  2P6W A;  2YQJ A;  4KXO A;  4NAK A;  2QGI A;  4Y62 A;  2RIY A;  3V90 A;  2RJ7 A;  1WT3 A;  4HO4 A;  1FO8 A;  1QWJ A;  2D7R A;  4E1K A;  2WVM A;  2I7B A;  2YES A;  3EE5 A;  1GWV A;  4HO8 A;  2D0J A;  2OEG A;  4FRA A;  4DEC A;  1S4O A;  4KNX A;  1G0R A;  2VS3 A;  5C3B A;  2RJ5 A;  3U0Y A;  3U0X A;  3V91 A;  2PX7 A;  4HG6 A;  2YQC A;  3I0K A;  2RIX A;  4KC1 A;  1NMM B;  3D98 A;  4NAN A;  2CU2 A;  1HM0 A;  3ZF8 A;  5CMF X;  1GQC A;  3U2V A;  2WAW A;  3IOH A;  1H7G A;  5C4B A;  4KC4 A;  2RJ6 A;  4CJ8 A;  2Z87 A;  3OGZ A;  2AEC A;  2VXM A;  3JUJ A;  4EEA A;  2V0K A;  3T7M A;  2WVK A;  3FWW A;  3I0D A;  2I5K A;  2W0W A;  4AYL A;  2XWN A;  3ZLL A;  5EJ1 A;  1VGW A;  3I0J A;  2YQH A;  3CKJ A;  3DUV A;  4C2S A;  1H5S A;  5CMG X;  2PA4 A;  3DK5 A;  3Q80 A;  4G87 A;  1O7O A;  3GUE A;  1GX0 A;  4R7P A;  1XHB A;  3IOI A;  2YCM A;  1ZCU A;  3V0P A;  4GBP A;  4FCE A;  2WE9 A;  4BQH A;  2FYA A;  4HO6 A;  3POL A;  5C47 A;  3OH3 A;  1W55 A;  5CMH A;  2AES A;  1PZT A;  5FU0 A;  2W0V A;  1LL3 A;  1R7T A;  1V82 A;  4DDZ A;  2X5Z A;  1YP2 A;  5IDS A;  4HO5 A;  3SXG A;  5C1L A;  4CJC A;  3V0Q A;  5J49 A;  5C4D A;  4B4B A;  5C8R A;  1ZI3 A;  2APC A;  2BO8 A;  1H4C A;  1TVY A;  1ZDG A;  3JTJ A;  4B3U A;  1GA8 A;  3U2T A;  2DPW A;  1LL0 A;  1JVD A;  1FR8 A;  1LL2 A;  4FRL A;  2Y4J A;  1ON6 A;  3OH2 A;  4Y9X A;  5BXC A;  4EE3 A;  5CQN X;  1FRW A;  4P00 A;  3F1Y A;  3RSB A;  4B2X A;  1G23 A;  2RJ8 A;  2WVL A;  1R7V A;  1VIC A;  4FQW A;  5FYE A;  2I5E A;  3PNN A;  1G95 A;  2UX8 A;  3V8Y A;  3U2X A;  5AJP A;  2RJ4 A;  5CMI A;  1NWG B;  2VSI A;  4FRB A;  1HM8 A;  2PGY A;  3RMW A;  4M4K A;  3RMV A;  2Y6P A;  1WT2 A;  3SXD A;  4ASY A;  4D11 C;  2AGD A;  2E3D A;  2YC3 A;  1ZDF A;  1ZI4 A;  2P72 A;  3JUK A;  1FGX A;  2YQS A;  4AC3 A;  4Y63 A; 
#chains in the Genus database with same CATH topology
 4ECM A;  4M28 A;  5D91 A;  4HO3 A;  5CQM X;  1LZ0 A;  4HO2 A;  5C4C A;  4J18 A;  1H7L A;  1HM9 A;  1WVC A;  5C3D A;  2XME A;  1W77 A;  1G97 A;  1ZIZ A;  4Y7V A;  4HCQ A;  1MP4 A;  2ZU7 A;  4KT7 A;  2QKX A;  1O23 B;  5C1H A;  1H5R B;  2RJ1 A;  3V0O A;  3SPT A;  2RIT A;  2X5S A;  4LW6 A;  3SX8 A;  5DDT A;  4LW3 A;  2Q4J A;  1WT0 A;  3I0H A;  3HL3 A;  3ST8 A;  3LW6 A;  3T7N A;  2RIZ A;  4KNR A;  5FU8 A;  3O3P A;  4CJB A;  2GGQ A;  1H5T B;  1H7F A;  2FYD B;  3SX3 A;  4KQL A;  5C3A A;  3FOQ A;  1IIN A;  4BMA A;  1H4D A;  1H5S D;  4ZDQ A;  4P02 A;  1LZI A;  3OH1 A;  4Y64 A;  1ZJP A;  4B4G A;  2VXL A;  2OI7 A;  3I0I X;  3SX5 A;  3V0N A;  4Q7C A;  3T7O A;  1Z90 A;  2BO7 A;  3OC9 A;  4HOC A;  5HS2 A;  4EVW A;  1VZT A;  3QVB A;  1FOA A;  4EE4 A;  1QG8 A;  2FYC B;  3SXE A;  4D11 A;  3BCV A;  2V0H A;  1ZCT A;  4KPX A;  5D92 A;  2XWM A;  1JYL A;  3D8V A;  1SS9 A;  3Q4S A;  5FUH A;  3ZLK A;  2A8U A;  2Y4L A;  1INJ A;  2P73 A;  5C49 A;  2VK9 A;  2X65 A;  3V8Z A;  2Y4M A;  2AM4 A;  5CMJ A;  1XZ6 A;  2GGO A;  5CQP A;  4FRM A;  4JD0 A;  2RJ0 A;  3R2W A;  1V83 A;  3I0F A;  1R7U A;  5C48 A;  4FCU A;  3PKQ A;  4D0Z A;  2VSH A;  1INI A;  2ICX A;  2NXV A;  1FG5 N;  4Y6N A;  1ZHJ A;  2QH5 A;  3K8E A;  1VH3 A;  4NAL A;  2WEE A;  1LZ7 A;  2JCK A;  1QGQ A;  5CQO A;  2JCO A;  1FXJ A;  2AE7 A;  2V0I A;  4KPZ A;  2FFU A;  3OH0 A;  3D5N A;  4FRQ A;  3SXA A;  5IFY A;  5C4F A;  2WGZ A;  1GQ9 A;  1VZX A;  4MND A;  5L6V A;  2V0L A;  1FR9 A;  3OAM A;  5FTS A;  1JYK A;  3OKR A;  1ZCY A;  4FRP A;  5C1G A;  1WSZ A;  3TZT A;  5FV9 A;  1VGT A;  1VZU A;  4AYJ A;  2AH9 A;  3KIA A;  2YC5 A;  3V0M A;  2RJ9 A;  2O1H A;  3CKQ A;  1R81 A;  2VS4 A;  4Y6U A;  1H7T A;  2JCL A;  3ZGF A;  4ASJ A;  2X60 A;  3I0G A;  4FIY A;  4EE5 A;  2VS5 A;  4CVH A;  1ZJ1 A;  4B2W A;  3NGW A;  1G8O A;  3I0E A;  2ZU8 A;  1ZI1 A;  1K4V A;  1YP3 A;  3R3I A;  1H4E A;  1VH1 A;  1VPA A;  4HO9 A;  4IRQ A;  3I0L A;  2VFZ A;  1VM8 A;  1S4P A;  3E26 A;  1H3M A;  5C4E A;  3CU0 A;  4IRP A;  1ZJ3 A;  2O1F A;  1H5R A;  1YRO B;  1R82 A;  4ARW A;  1G2V A;  1ZJO A;  5FTV A;  5EIY A;  3BRK X;  5CQL X;  1NQI B;  4Y7G A;  1JVG A;  4EEG A;  4EEM A;  1R7X A;  4D48 A;  2PGV A;  2O1G A;  5EJZ A;  1LZJ A;  1H7H A;  1GWW A;  1OQM B;  3K8D A;  5JQQ A;  4K6R A;  1FXO A;  3USQ A;  3CKV A;  1MP3 A;  1H5T A;  4FRH A;  4O6N A;  1JV1 A;  1HV9 A;  4UEG A;  1S4N A;  1WT1 A;  1QGS A;  5L6S A;  4M2B A;  4JIS A;  1TW5 A;  1EZI A;  5C36 A;  2AM3 A;  5AJN A;  2XMH A;  1R7Y A;  3DJ4 A;  2FYB A;  3F1C A;  2ICY A;  2V0J A;  4FRE A;  3TQD A;  3E25 A;  3CKN A;  5DDV A;  3V0L A;  4FRD A;  3SXB A;  1FO9 A;  1PZY B;  4YS8 A;  1H5S B;  2J0A A;  1NHE B;  3Q7U A;  1OMX A;  3U2U A;  1MP5 A;  2MZB A;  1TW1 A;  1I52 A;  4B5B A;  3USR A;  3U2W A;  1O7Q A;  3I0C A;  4EEO A;  2OI5 A;  1LVW A;  2BO4 A;  4M2A A;  4AAW A;  4Y7F A;  1ZJ0 A;  1IIM A;  1FGG A;  1VGZ A;  1KWS A;  4G3S A;  3ZGG A;  1NF5 B;  1JV3 A;  4XWI A;  1NKH B;  4D0T A;  3OH4 A;  2Y7A A;  2OI6 A;  4B42 A;  5C38 A;  5IDT A;  4Y7U A;  1VGU A;  4G3P A;  4FRO A;  4NAI A;  2Z86 A;  1MC3 A;  1ZJ2 A;  1G3L A;  1G9R A;  4DE7 A;  2FY7 A;  2OEF A;  1G1L A;  4KRV A;  2BO6 A;  2JCJ A;  1FZW A;  2D7I A;  3N9W A;  2E8B A;  4L41 C;  4G3Q A;  3PKP A;  2C0N A;  1GX4 A;  1HJL A;  2XWL A;  3CGX A;  1W57 A;  4MYB A;  5I1F A;  1ZCV A;  2AM5 A;  1HJJ A;  1H7Q A;  1H5S C;  2VD4 A;  1ON8 A;  2FFV A;  2Y4K A;  4B4M A;  2ZU9 A;  4KC2 A;  1H7E A;  1YP4 A;  3CKO A;  3IOJ A;  1V84 A;  1EYR A;  4FIX A;  1TZF A;  5AJO A;  1ZI5 A;  1O0R A;  3SXC A;  1E5K A;  3SX7 A;  4HO0 A;  1OMZ A;  1FWY A;  1R80 A;  2A8W A;  4Y7T A;  1G93 A;  4MIX A;  2P6W A;  2YQJ A;  4KXO A;  4NAK A;  2J0B A;  2QGI A;  4Y62 A;  2RIY A;  3V90 A;  2RJ7 A;  1WT3 A;  4HO4 A;  1FO8 A;  1QWJ A;  2D7R A;  4E1K A;  2WVM A;  2I7B A;  2YES A;  3EE5 A;  1GWV A;  4HO8 A;  2D0J A;  2OEG A;  4FRA A;  4DEC A;  1S4O A;  4KNX A;  1G0R A;  2VS3 A;  5C3B A;  2RJ5 A;  3U0Y A;  3U0X A;  3V91 A;  2PX7 A;  4HG6 A;  2YQC A;  3I0K A;  2RIX A;  4KC1 A;  1NMM B;  3D98 A;  4NAN A;  2CU2 A;  1HM0 A;  3ZF8 A;  5CMF X;  1GQC A;  3U2V A;  2WAW A;  3IOH A;  1H7G A;  5C4B A;  4KC4 A;  2RJ6 A;  4CJ8 A;  2Z87 A;  3OGZ A;  2AEC A;  2VXM A;  3JUJ A;  4EEA A;  2V0K A;  3T7M A;  2WVK A;  3FWW A;  3I0D A;  2I5K A;  2W0W A;  4AYL A;  2XWN A;  4O6M A;  3ZLL A;  5EJ1 A;  1VGW A;  3I0J A;  2YQH A;  3CKJ A;  3DUV A;  4C2S A;  1H5S A;  5CMG X;  2PA4 A;  3DK5 A;  3Q80 A;  4G87 A;  1O7O A;  3GUE A;  1GX0 A;  4R7P A;  1XHB A;  3IOI A;  2YCM A;  1ZCU A;  3V0P A;  4GBP A;  4FCE A;  2WE9 A;  4BQH A;  2FYA A;  4HO6 A;  3POL A;  5C47 A;  3OH3 A;  1W55 A;  5CMH A;  2AES A;  1PZT A;  5FU0 A;  2W0V A;  1LL3 A;  1R7T A;  1V82 A;  4DDZ A;  2X5Z A;  1YP2 A;  5IDS A;  4HO5 A;  3SXG A;  5C1L A;  4CJC A;  3V0Q A;  5J49 A;  5C4D A;  4B4B A;  5C8R A;  1ZI3 A;  2APC A;  2BO8 A;  1H4C A;  1TVY A;  1ZDG A;  3JTJ A;  4B3U A;  1GA8 A;  3U2T A;  2DPW A;  1LL0 A;  1JVD A;  1FR8 A;  1LL2 A;  4FRL A;  2Y4J A;  1ON6 A;  3OH2 A;  4Y9X A;  5BXC A;  4EE3 A;  5CQN X;  1FRW A;  4P00 A;  3F1Y A;  3RSB A;  4B2X A;  1G23 A;  2RJ8 A;  2WVL A;  1R7V A;  1VIC A;  4FQW A;  5FYE A;  2I5E A;  3PNN A;  1G95 A;  2UX8 A;  3V8Y A;  3U2X A;  5AJP A;  2RJ4 A;  5CMI A;  1NWG B;  2VSI A;  4FRB A;  1HM8 A;  2PGY A;  3RMW A;  4M4K A;  3RMV A;  2Y6P A;  1WT2 A;  3SXD A;  4ASY A;  4D11 C;  2AGD A;  2E3D A;  2YC3 A;  1ZDF A;  1ZI4 A;  2P72 A;  3JUK A;  1FGX A;  2YQS A;  4AC3 A;  4Y63 A; 
#chains in the Genus database with same CATH homology
 4ECM A;  4M28 A;  5D91 A;  4HO3 A;  5CQM X;  1LZ0 A;  4HO2 A;  5C4C A;  4J18 A;  1H7L A;  1HM9 A;  1WVC A;  5C3D A;  2XME A;  1W77 A;  1G97 A;  1ZIZ A;  4Y7V A;  4HCQ A;  1MP4 A;  2ZU7 A;  4KT7 A;  2QKX A;  1O23 B;  5C1H A;  1H5R B;  2RJ1 A;  3V0O A;  3SPT A;  2RIT A;  2X5S A;  4LW6 A;  3SX8 A;  5DDT A;  4LW3 A;  2Q4J A;  1WT0 A;  3I0H A;  3HL3 A;  3ST8 A;  3LW6 A;  3T7N A;  2RIZ A;  4KNR A;  5FU8 A;  3O3P A;  4CJB A;  2GGQ A;  1H5T B;  1H7F A;  2FYD B;  3SX3 A;  4KQL A;  5C3A A;  3FOQ A;  1IIN A;  4BMA A;  1H4D A;  1H5S D;  4ZDQ A;  4P02 A;  1LZI A;  3OH1 A;  4Y64 A;  1ZJP A;  4B4G A;  2VXL A;  2OI7 A;  3I0I X;  3SX5 A;  3V0N A;  4Q7C A;  3T7O A;  1Z90 A;  2BO7 A;  3OC9 A;  4HOC A;  5HS2 A;  4EVW A;  1VZT A;  3QVB A;  1FOA A;  4EE4 A;  1QG8 A;  2FYC B;  3SXE A;  4D11 A;  3BCV A;  2V0H A;  1ZCT A;  4KPX A;  5D92 A;  2XWM A;  1JYL A;  3D8V A;  1SS9 A;  3Q4S A;  5FUH A;  3ZLK A;  2A8U A;  2Y4L A;  1INJ A;  2P73 A;  5C49 A;  2VK9 A;  2X65 A;  3V8Z A;  2Y4M A;  2AM4 A;  5CMJ A;  1XZ6 A;  2GGO A;  5CQP A;  4FRM A;  4JD0 A;  2RJ0 A;  3R2W A;  1V83 A;  3I0F A;  1R7U A;  5C48 A;  4FCU A;  3PKQ A;  4D0Z A;  2VSH A;  1INI A;  2ICX A;  2NXV A;  1FG5 N;  4Y6N A;  1ZHJ A;  2QH5 A;  3K8E A;  1VH3 A;  4NAL A;  2WEE A;  1LZ7 A;  2JCK A;  1QGQ A;  5CQO A;  2JCO A;  1FXJ A;  2AE7 A;  2V0I A;  4KPZ A;  2FFU A;  3OH0 A;  3D5N A;  4FRQ A;  3SXA A;  5IFY A;  5C4F A;  2WGZ A;  1GQ9 A;  1VZX A;  4MND A;  5L6V A;  2V0L A;  1FR9 A;  3OAM A;  5FTS A;  1JYK A;  3OKR A;  1ZCY A;  4FRP A;  5C1G A;  1WSZ A;  3TZT A;  5FV9 A;  1VGT A;  1VZU A;  4AYJ A;  2AH9 A;  3KIA A;  2YC5 A;  3V0M A;  2RJ9 A;  2O1H A;  3CKQ A;  1R81 A;  2VS4 A;  4Y6U A;  1H7T A;  2JCL A;  3ZGF A;  4ASJ A;  2X60 A;  3I0G A;  4FIY A;  4EE5 A;  2VS5 A;  4CVH A;  1ZJ1 A;  4B2W A;  3NGW A;  1G8O A;  3I0E A;  2ZU8 A;  1ZI1 A;  1K4V A;  1YP3 A;  3R3I A;  1H4E A;  1VH1 A;  1VPA A;  4HO9 A;  4IRQ A;  3I0L A;  2VFZ A;  1VM8 A;  1S4P A;  3E26 A;  1H3M A;  5C4E A;  3CU0 A;  4IRP A;  1ZJ3 A;  2O1F A;  1H5R A;  1YRO B;  1R82 A;  4ARW A;  1G2V A;  1ZJO A;  5FTV A;  5EIY A;  3BRK X;  5CQL X;  1NQI B;  4Y7G A;  1JVG A;  4EEG A;  4EEM A;  1R7X A;  4D48 A;  2PGV A;  2O1G A;  5EJZ A;  1LZJ A;  1H7H A;  1GWW A;  1OQM B;  3K8D A;  5JQQ A;  4K6R A;  1FXO A;  3USQ A;  3CKV A;  1MP3 A;  1H5T A;  4FRH A;  4O6N A;  1JV1 A;  1HV9 A;  4UEG A;  1S4N A;  1WT1 A;  1QGS A;  5L6S A;  4M2B A;  4JIS A;  1TW5 A;  1EZI A;  5C36 A;  2AM3 A;  5AJN A;  2XMH A;  1R7Y A;  3DJ4 A;  2FYB A;  3F1C A;  2ICY A;  2V0J A;  4FRE A;  3TQD A;  3E25 A;  3CKN A;  5DDV A;  3V0L A;  4FRD A;  3SXB A;  1FO9 A;  1PZY B;  4YS8 A;  1H5S B;  2J0A A;  1NHE B;  3Q7U A;  1OMX A;  3U2U A;  1MP5 A;  2MZB A;  1TW1 A;  1I52 A;  4B5B A;  3USR A;  3U2W A;  1O7Q A;  3I0C A;  4EEO A;  2OI5 A;  1LVW A;  2BO4 A;  4M2A A;  4AAW A;  4Y7F A;  1ZJ0 A;  1IIM A;  1FGG A;  1VGZ A;  1KWS A;  4G3S A;  3ZGG A;  1NF5 B;  1JV3 A;  4XWI A;  1NKH B;  4D0T A;  3OH4 A;  2Y7A A;  2OI6 A;  4B42 A;  5C38 A;  5IDT A;  4Y7U A;  1VGU A;  4G3P A;  4FRO A;  4NAI A;  2Z86 A;  1MC3 A;  1ZJ2 A;  1G3L A;  1G9R A;  4DE7 A;  2FY7 A;  2OEF A;  1G1L A;  4KRV A;  2BO6 A;  2JCJ A;  1FZW A;  2D7I A;  3N9W A;  2E8B A;  4L41 C;  4G3Q A;  3PKP A;  2C0N A;  1GX4 A;  1HJL A;  2XWL A;  3CGX A;  1W57 A;  4MYB A;  5I1F A;  1ZCV A;  2AM5 A;  1HJJ A;  1H7Q A;  1H5S C;  2VD4 A;  1ON8 A;  2FFV A;  2Y4K A;  4B4M A;  2ZU9 A;  4KC2 A;  1H7E A;  1YP4 A;  3CKO A;  3IOJ A;  1V84 A;  1EYR A;  4FIX A;  1TZF A;  5AJO A;  1ZI5 A;  1O0R A;  3SXC A;  1E5K A;  3SX7 A;  4HO0 A;  1OMZ A;  1FWY A;  1R80 A;  2A8W A;  4Y7T A;  1G93 A;  4MIX A;  2P6W A;  2YQJ A;  4KXO A;  4NAK A;  2J0B A;  2QGI A;  4Y62 A;  2RIY A;  3V90 A;  2RJ7 A;  1WT3 A;  4HO4 A;  1FO8 A;  1QWJ A;  2D7R A;  4E1K A;  2WVM A;  2I7B A;  2YES A;  3EE5 A;  1GWV A;  4HO8 A;  2D0J A;  2OEG A;  4FRA A;  4DEC A;  1S4O A;  4KNX A;  1G0R A;  2VS3 A;  5C3B A;  2RJ5 A;  3U0Y A;  3U0X A;  3V91 A;  2PX7 A;  4HG6 A;  2YQC A;  3I0K A;  2RIX A;  4KC1 A;  1NMM B;  3D98 A;  4NAN A;  2CU2 A;  1HM0 A;  3ZF8 A;  5CMF X;  1GQC A;  3U2V A;  2WAW A;  3IOH A;  1H7G A;  5C4B A;  4KC4 A;  2RJ6 A;  4CJ8 A;  2Z87 A;  3OGZ A;  2AEC A;  2VXM A;  3JUJ A;  4EEA A;  2V0K A;  3T7M A;  2WVK A;  3FWW A;  3I0D A;  2I5K A;  2W0W A;  4AYL A;  2XWN A;  4O6M A;  3ZLL A;  5EJ1 A;  1VGW A;  3I0J A;  2YQH A;  3CKJ A;  3DUV A;  4C2S A;  1H5S A;  5CMG X;  2PA4 A;  3DK5 A;  3Q80 A;  4G87 A;  1O7O A;  3GUE A;  1GX0 A;  4R7P A;  1XHB A;  3IOI A;  2YCM A;  1ZCU A;  3V0P A;  4GBP A;  4FCE A;  2WE9 A;  4BQH A;  2FYA A;  4HO6 A;  3POL A;  5C47 A;  3OH3 A;  1W55 A;  5CMH A;  2AES A;  1PZT A;  5FU0 A;  2W0V A;  1LL3 A;  1R7T A;  1V82 A;  4DDZ A;  2X5Z A;  1YP2 A;  5IDS A;  4HO5 A;  3SXG A;  5C1L A;  4CJC A;  3V0Q A;  5J49 A;  5C4D A;  4B4B A;  5C8R A;  1ZI3 A;  2APC A;  2BO8 A;  1H4C A;  1TVY A;  1ZDG A;  3JTJ A;  4B3U A;  1GA8 A;  3U2T A;  2DPW A;  1LL0 A;  1JVD A;  1FR8 A;  1LL2 A;  4FRL A;  2Y4J A;  1ON6 A;  3OH2 A;  4Y9X A;  5BXC A;  4EE3 A;  5CQN X;  1FRW A;  4P00 A;  3F1Y A;  3RSB A;  4B2X A;  1G23 A;  2RJ8 A;  2WVL A;  1R7V A;  1VIC A;  4FQW A;  5FYE A;  2I5E A;  3PNN A;  1G95 A;  2UX8 A;  3V8Y A;  3U2X A;  5AJP A;  2RJ4 A;  5CMI A;  1NWG B;  2VSI A;  4FRB A;  1HM8 A;  2PGY A;  3RMW A;  4M4K A;  3RMV A;  2Y6P A;  1WT2 A;  3SXD A;  4ASY A;  4D11 C;  2AGD A;  2E3D A;  2YC3 A;  1ZDF A;  1ZI4 A;  2P72 A;  3JUK A;  1FGX A;  2YQS A;  4AC3 A;  4Y63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...