4UEGA

Crystal structure of human glycogenin-2 catalytic domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
242
Chain Sequence
TDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSDLLRRILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSSPAFKQFGSSAKVVHFLGSMKPWNYKYQAAFLHLWWTVYQNNVLPLYKSVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGENIN-2
publication title Crystal Structure of Human Glycogenin-2 Catalytic Domain
rcsb
source organism Homo sapiens
total genus 86
structure length 242
sequence length 266
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4uegA00
4BMAA 3SXAA 4FRDA 3TQDA 4IRPA 3U0XA 3OH1A 5C4EA 5FV9A 3SXCA 1HM0A 2QGIA 3JUKA 1WT0A 3QVBA 3USQA 2I5EA 3E25A 2VSIA 3E26A 1GWVA 3V0PA 3I0CA 2RJ7A 2XWMA 4Y62A 2Y6PA 1FOAA 5C3AA 1JVDA 4M2AA 3LW6A 1FZWA 1ZI4A 1MC3A 2OI5A 3NGWA 4Y7UA 1G3LA 2I5KA 1V82A 5C8RA 3SX7A 1LL2A 2D7IA 3F1CA 4ASYA 2X5SA 1Z90A 2WAWA 2YQHA 4AYLA 5CQNX 2FFVA 2RJ5A 1W55A 3I0LA 4AAWA 4FRLA 2E8BA 1QGQA 1YROB 1S4OA 5DDVA 5CMHA 4J18A 2JCKA 1KWSA 3OH0A 4UEGA 4KPZA 1HV9A 3I0HA 1FRWA 4Y63A 2XMHA 1H7FA 5J49A 4IRQA 4KC4A 2RIYA 3N9WA 1IINA 2O1GA 3SXGA 4XWIA 3F1YA 2RJ6A 1R80A 1W57A 3OAMA 4ZDQA 4KNXA 1O7QA 3SXDA 1ZDGA 1ZDFA 3V0NA 1ZJ0A 2V0JA 1H5RA 2W0WA 2FY7A 4JISA 3U2WA 3U0YA 1JV3A 4ARWA 3GUEA 3V8YA 4EE4A 4R7PA 3OKRA 2PX7A 1G8OA 2RITA 4Y7VA 1VZUA 2ICYA 3DUVA 1ON6A 1O23B 2BO4A 5AJPA 1MP4A 5CMGX 4KNRA 5IDTA 3U2XA 1FXJA 4Y9XA 4HO5A 1NWGB 5C1GA 4ECMA 2DPWA 1H4DA 2V0HA 4FQWA 4Y6NA 2V0LA 4HO4A 2A8UA 3V90A 1G93A 5CMJA 1JYLA 1VGZA 5AJOA 4D11C 2D7RA 3I0JA 1QWJA 3FOQA 1ZJ3A 4KRVA 4EE5A 2WGZA 5C4BA 2VS5A 2FYCB 1FXOA 5C47A 2WE9A 1E5KA 1G9RA 1VGWA 2AH9A 2AESA 2BO6A 4NAIA 2D0JA 5L6VA 1R7VA 4LW6A 4HO2A 3ZGFA 3I0FA 1H5TA 3CGXA 3SPTA 4CJBA 5CQLX 4MYBA 1VGTA 1ZCVA 3I0IX 1NKHB 1JV1A 1GQ9A 1VZTA 1H7TA 4FCEA 2GGOA 4HCQA 1GX0A 1WT3A 4B4GA 1TZFA 1HJLA 3JTJA 2PA4A 1W77A 3V0QA 4EE3A 1ZCUA 3HL3A 4NAKA 4C2SA 4EVWA 4KPXA 4Y7TA 5C4FA 1WT2A 4JD0A 1QGSA 3DJ4A 4CJCA 3T7MA 3U2UA 1YP3A 4FCUA 5EJ1A 4DDZA 4FRHA 3I0DA 1H5SA 2AM4A 4BQHA 1GWWA 4FRMA 2RJ8A 1INJA 5FTSA 1HM9A 1LL0A 4AYJA 1R7UA 3USRA 4DECA 1FR8A 1OMZA 4D48A 2Y4MA 2VXLA 3IOJA 3JUJA 3EE5A 1G97A 1V83A 2JCJA 4KXOA 2Z86A 1FO9A 3OH3A 1YP4A 1IIMA 2XMEA 2W0VA 3CKVA 2RIZA 3SX5A 4E1KA 5I1FA 5DDTA 1QG8A 1FO8A 1NHEB 4DE7A 5BXCA 2X65A 2MZBA 1VPAA 3ZF8A 1G95A 5C3BA 2Z87A 2AM3A 3RMWA 3I0KA 2P72A 1HM8A 1ZJ1A 1FGXA 3KIAA 4M2BA 2V0IA 3CU0A 5FUHA 4KT7A 3V0MA 2Q4JA 4YS8A 1NMMB 3T7NA 1H4EA 4D0ZA 1VM8A 5EIYA 1VGUA 3R3IA 1G0RA 4B5BA 1LZJA 1LZ7A 3SX8A 1G2VA 1R7TA 1SS9A 2Y4JA 1WSZA 4Y7FA 4Y6UA 3ZGGA 5L6SA 2VS4A 4B2XA 4EEAA 1I52A 1LZIA 2X60A 5CMFX 3SXBA 3CKJA 4AC3A 4B4BA 4HO3A 2AGDA 2RJ4A 2I7BA 2A8WA 2APCA 1ZJPA 4B2WA 1H5SB 1R7XA 2XWNA 4LW3A 3TZTA 2FYBA 1H7EA 1O7OA 3OC9A 4KC1A 1FG5N 4HG6A 2RJ0A 2YQCA 4EEGA 2AE7A 3OH4A 2P73A 2V0KA 1WVCA 2YESA 3D5NA 4B42A 2RJ9A 4KQLA 3V91A 2NXVA 1NF5B 3ST8A 1EZIA 4FRPA 3RMVA 3PKPA 2OEFA 4EEMA 1TVYA 3CKOA 1NQIB 4FRQA 2ICXA 3D8VA 3V8ZA 2PGYA 1WT1A 4HO8A 1R81A 1PZYB 5JQQA 2VD4A 4HOCA 1XHBA 1FWYA 2YQSA 2E3DA 1R82A 3ZLLA 1H7HA 3PNNA 3SXEA 1GQCA 3O3PA 1HJJA 4ASJA 3R2WA 3U2TA 1K4VA 1FR9A 2UX8A 2FYDB 3FWWA 1ZJ2A 3BCVA 4FRAA 1H4CA 4HO9A 1H5RB 2XWLA 3K8DA 2VSHA 5C4DA 2WEEA 2YC5A 3Q4SA 1O0RA 1OMXA 4Y7GA 1LL3A 5C36A 2RIXA 3V0LA 2JCLA 2ZU8A 5C3DA 1JVGA 5C1LA 1INIA 2VS3A 3SX3A 3ZLKA 1H3MA 1TW1A 4Y64A 1S4NA 2O1HA 1XZ6A 2WVLA 1G1LA 4G3QA 1H7LA 2VXMA 1FGGA 3I0EA 5EJZA 1VZXA 5IFYA 1MP5A 4FREA 2VFZA 3IOIA 3PKQA 1MP3A 1H7GA 4K6RA 1ON8A 1ZI1A 5C49A 1JYKA 1PZTA 2BO8A 4M4KA 1ZIZA 2FFUA 5AJNA 5C4CA 2Y4LA 1G23A 2AECA 5CMIA 4D11A 2RJ1A 3T7OA 3D98A 3DK5A 1VH1A 4FROA 1ZHJA 4G3PA 1GA8A 2OEGA 3IOHA 2Y7AA 4B4MA 2O1FA 4HO0A 2CU2A 4B3UA 1H5TB 1GX4A 2X5ZA 1H5SD 4FRBA 5CQPA 5C48A 3U2VA 2ZU7A 4P02A 2ZU9A 1ZCTA 1LVWA 1V84A 1TW5A 4CVHA 3POLA 1ZI3A 2OI6A 4EEOA 4NALA 1H5SC 2YCMA 4G87A 2PGVA 4L41C 1ZI5A 2YC3A 5IDSA 2WVKA 3OH2A 5FU0A 4P00A 1OQMB 2GGQA 5CQOA 1ZCYA 4G3SA 1H7QA 2QKXA 3CKQA 5FYEA 5HS2A 4CJ8A 3OGZA 2WVMA 3V0OA 2BO7A 5FTVA 1LZ0A 3BRKX 2Y4KA 2FYAA 3K8EA 4HO6A 2OI7A 1YP2A 4D0TA 2QH5A 1VICA 1EYRA 2AM5A 2JCOA 1VH3A 4NANA 1S4PA 5FU8A 4GBPA 2YQJA 5C1HA 5C38A 3RSBA 3Q7UA 2P6WA 3I0GA 1ZJOA 5CQMX 1R7YA 4M28A 4MNDA 3Q80A 4KC2A 3CKNA
chains in the Genus database with same CATH superfamily
4BMAA 3SXAA 4FRDA 3TQDA 4IRPA 3U0XA 3OH1A 5C4EA 5FV9A 3SXCA 1HM0A 2QGIA 3JUKA 1WT0A 3QVBA 3USQA 2I5EA 3E25A 2VSIA 3E26A 1GWVA 3V0PA 3I0CA 2RJ7A 2XWMA 4Y62A 2Y6PA 1FOAA 5C3AA 1JVDA 4M2AA 3LW6A 1FZWA 1ZI4A 1MC3A 2OI5A 3NGWA 4Y7UA 1G3LA 2I5KA 1V82A 5C8RA 3SX7A 1LL2A 2D7IA 3F1CA 4ASYA 2X5SA 1Z90A 2WAWA 2YQHA 4AYLA 5CQNX 2FFVA 2RJ5A 1W55A 3I0LA 4AAWA 4FRLA 2E8BA 1QGQA 1YROB 1S4OA 5DDVA 5CMHA 4J18A 2JCKA 1KWSA 3OH0A 4UEGA 4KPZA 1HV9A 3I0HA 1FRWA 4Y63A 2XMHA 1H7FA 5J49A 4IRQA 4KC4A 2RIYA 3N9WA 1IINA 2O1GA 3SXGA 2J0BA 4XWIA 3F1YA 2RJ6A 1R80A 1W57A 3OAMA 4ZDQA 4KNXA 1O7QA 3SXDA 1ZDGA 1ZDFA 3V0NA 1ZJ0A 2V0JA 1H5RA 2W0WA 2FY7A 4JISA 3U2WA 3U0YA 5D91A 1JV3A 4ARWA 3GUEA 3V8YA 4EE4A 4R7PA 3OKRA 2PX7A 1G8OA 2RITA 4Y7VA 1VZUA 2ICYA 3DUVA 1ON6A 1O23B 2BO4A 5AJPA 1MP4A 5CMGX 4KNRA 5IDTA 3U2XA 1FXJA 4Y9XA 4HO5A 1NWGB 5C1GA 4ECMA 2DPWA 1H4DA 2V0HA 4FQWA 4Y6NA 2V0LA 4HO4A 2A8UA 3V90A 1G93A 5CMJA 1JYLA 1VGZA 5AJOA 4D11C 2D7RA 3I0JA 1QWJA 3FOQA 1ZJ3A 4KRVA 4EE5A 2WGZA 5C4BA 2VS5A 2FYCB 1FXOA 5C47A 2WE9A 1E5KA 1G9RA 1VGWA 2AH9A 2AESA 2BO6A 4NAIA 2D0JA 5L6VA 1R7VA 4LW6A 4HO2A 3ZGFA 3I0FA 1H5TA 3CGXA 3SPTA 4CJBA 5CQLX 4MYBA 1VGTA 1ZCVA 3I0IX 1NKHB 1JV1A 1GQ9A 1VZTA 1H7TA 4FCEA 2GGOA 4HCQA 4Q7CA 1GX0A 1WT3A 4B4GA 1TZFA 1HJLA 3JTJA 2PA4A 1W77A 3V0QA 4EE3A 1ZCUA 3HL3A 4NAKA 4C2SA 4EVWA 4KPXA 4Y7TA 5C4FA 1WT2A 4JD0A 1QGSA 3DJ4A 4CJCA 3T7MA 3U2UA 1YP3A 4FCUA 5EJ1A 4DDZA 4FRHA 3I0DA 1H5SA 2AM4A 4BQHA 1GWWA 4FRMA 2RJ8A 1INJA 5FTSA 5D92A 1HM9A 1LL0A 4AYJA 1R7UA 3USRA 4DECA 1FR8A 1OMZA 4D48A 2Y4MA 2VXLA 3IOJA 3JUJA 3EE5A 1G97A 1V83A 2JCJA 4KXOA 2Z86A 1FO9A 3OH3A 1YP4A 1IIMA 2XMEA 2W0VA 3CKVA 2RIZA 3SX5A 4E1KA 5I1FA 5DDTA 1QG8A 1FO8A 1NHEB 4DE7A 5BXCA 2X65A 2MZBA 1VPAA 3ZF8A 1G95A 5C3BA 2Z87A 2AM3A 3RMWA 3I0KA 2P72A 1HM8A 1ZJ1A 1FGXA 3KIAA 4M2BA 2V0IA 3CU0A 5FUHA 4KT7A 3V0MA 2Q4JA 4YS8A 1NMMB 3T7NA 1H4EA 4D0ZA 1VM8A 5EIYA 1VGUA 3R3IA 1G0RA 4B5BA 1LZJA 1LZ7A 3SX8A 1G2VA 1R7TA 1SS9A 2Y4JA 1WSZA 4Y7FA 4Y6UA 3ZGGA 5L6SA 2VS4A 4B2XA 4EEAA 1I52A 1LZIA 2X60A 5CMFX 3SXBA 3CKJA 4AC3A 4B4BA 4HO3A 2AGDA 2RJ4A 2I7BA 2A8WA 2APCA 1ZJPA 4B2WA 1H5SB 1R7XA 2XWNA 4LW3A 3TZTA 2FYBA 1H7EA 1O7OA 3OC9A 4KC1A 1FG5N 4HG6A 2RJ0A 2YQCA 4FIYA 4EEGA 2AE7A 3OH4A 2P73A 2V0KA 1WVCA 2YESA 3D5NA 4B42A 2RJ9A 4KQLA 3V91A 2NXVA 1NF5B 3ST8A 1EZIA 4FRPA 3RMVA 3PKPA 2OEFA 4EEMA 1TVYA 3CKOA 1NQIB 4FRQA 2ICXA 3D8VA 3V8ZA 2PGYA 1WT1A 4HO8A 1R81A 1PZYB 4O6NA 5JQQA 2VD4A 4HOCA 1XHBA 2J0AA 1FWYA 2YQSA 4O6MA 2E3DA 1R82A 3ZLLA 1H7HA 3PNNA 3SXEA 1GQCA 3O3PA 1HJJA 4ASJA 3R2WA 3U2TA 1K4VA 1FR9A 2UX8A 2FYDB 3FWWA 1ZJ2A 3BCVA 4FRAA 1H4CA 4HO9A 1H5RB 2XWLA 3K8DA 2VSHA 5C4DA 2WEEA 2YC5A 3Q4SA 1O0RA 1OMXA 4FIXA 4Y7GA 1LL3A 5C36A 2RIXA 3V0LA 2JCLA 2ZU8A 5C3DA 1JVGA 5C1LA 1INIA 2VS3A 3SX3A 3ZLKA 1H3MA 1TW1A 4Y64A 1S4NA 2O1HA 1XZ6A 2WVLA 2C0NA 1G1LA 4G3QA 1H7LA 2VXMA 1FGGA 3I0EA 5EJZA 1VZXA 5IFYA 1MP5A 4FREA 2VFZA 3IOIA 3PKQA 1MP3A 1H7GA 4K6RA 1ON8A 1ZI1A 4MIXA 5C49A 1JYKA 1PZTA 2BO8A 4M4KA 1ZIZA 2FFUA 5AJNA 5C4CA 2Y4LA 1G23A 2AECA 5CMIA 4D11A 2RJ1A 3T7OA 3D98A 3DK5A 1VH1A 4FROA 1ZHJA 4G3PA 1GA8A 2OEGA 3IOHA 2Y7AA 4B4MA 2O1FA 4HO0A 2CU2A 4B3UA 1H5TB 1GX4A 2X5ZA 1H5SD 4FRBA 5CQPA 5C48A 3U2VA 2ZU7A 4P02A 2ZU9A 1ZCTA 1LVWA 1V84A 1TW5A 4CVHA 3POLA 1ZI3A 2OI6A 4EEOA 4NALA 1H5SC 2VK9A 2YCMA 4G87A 2PGVA 4L41C 1ZI5A 2YC3A 5IDSA 2WVKA 3OH2A 5FU0A 4P00A 1OQMB 2GGQA 5CQOA 1ZCYA 4G3SA 1H7QA 2QKXA 3CKQA 5FYEA 5HS2A 4CJ8A 3OGZA 2WVMA 3V0OA 2BO7A 5FTVA 1LZ0A 3BRKX 2Y4KA 2FYAA 3K8EA 4HO6A 2OI7A 1YP2A 4D0TA 2QH5A 1VICA 1EYRA 2AM5A 2JCOA 1VH3A 4NANA 1S4PA 5FU8A 4GBPA 2YQJA 5C1HA 5C38A 3RSBA 3Q7UA 2P6WA 3I0GA 1ZJOA 5CQMX 1R7YA 4M28A 4MNDA 3Q80A 4KC2A 3CKNA
chains in the Genus database with same CATH topology
4BMAA 3SXAA 4FRDA 3TQDA 4IRPA 3U0XA 3OH1A 5C4EA 5FV9A 3SXCA 1HM0A 2QGIA 3JUKA 1WT0A 3QVBA 3USQA 2I5EA 3E25A 2VSIA 3E26A 1GWVA 3V0PA 3I0CA 2RJ7A 2XWMA 4Y62A 2Y6PA 1FOAA 5C3AA 1JVDA 4M2AA 3LW6A 1FZWA 1ZI4A 1MC3A 2OI5A 3NGWA 4Y7UA 1G3LA 2I5KA 1V82A 5C8RA 3SX7A 1LL2A 2D7IA 3F1CA 4ASYA 2X5SA 1Z90A 2WAWA 2YQHA 4AYLA 5CQNX 2FFVA 2RJ5A 1W55A 3I0LA 4AAWA 4FRLA 2E8BA 1QGQA 1YROB 1S4OA 5DDVA 5CMHA 4J18A 2JCKA 1KWSA 3OH0A 4UEGA 4KPZA 1HV9A 3I0HA 1FRWA 4Y63A 2XMHA 1H7FA 5J49A 4IRQA 4KC4A 2RIYA 3N9WA 1IINA 2O1GA 3SXGA 2J0BA 4XWIA 3F1YA 2RJ6A 1R80A 1W57A 3OAMA 4ZDQA 4KNXA 1O7QA 3SXDA 1ZDGA 1ZDFA 3V0NA 1ZJ0A 2V0JA 1H5RA 2W0WA 2FY7A 4JISA 3U2WA 3U0YA 5D91A 1JV3A 4ARWA 3GUEA 3V8YA 4EE4A 4R7PA 3OKRA 2PX7A 1G8OA 2RITA 4Y7VA 1VZUA 2ICYA 3DUVA 1ON6A 1O23B 2BO4A 5AJPA 1MP4A 5CMGX 4KNRA 5IDTA 3U2XA 1FXJA 4Y9XA 4HO5A 1NWGB 5C1GA 4ECMA 2DPWA 1H4DA 2V0HA 4FQWA 4Y6NA 2V0LA 4HO4A 2A8UA 3V90A 1G93A 5CMJA 1JYLA 1VGZA 5AJOA 4D11C 2D7RA 3I0JA 1QWJA 3FOQA 1ZJ3A 4KRVA 4EE5A 2WGZA 5C4BA 2VS5A 2FYCB 1FXOA 5C47A 2WE9A 1E5KA 1G9RA 1VGWA 2AH9A 2AESA 2BO6A 4NAIA 2D0JA 5L6VA 1R7VA 4LW6A 4HO2A 3ZGFA 3I0FA 1H5TA 3CGXA 3SPTA 4CJBA 5CQLX 4MYBA 1VGTA 1ZCVA 3I0IX 1NKHB 1JV1A 1GQ9A 1VZTA 1H7TA 4FCEA 2GGOA 4HCQA 4Q7CA 1GX0A 1WT3A 4B4GA 1TZFA 1HJLA 3JTJA 2PA4A 1W77A 3V0QA 4EE3A 1ZCUA 3HL3A 4NAKA 4C2SA 4EVWA 4KPXA 4Y7TA 5C4FA 1WT2A 4JD0A 1QGSA 3DJ4A 4CJCA 3T7MA 3U2UA 1YP3A 4FCUA 5EJ1A 4DDZA 4FRHA 3I0DA 1H5SA 2AM4A 4BQHA 1GWWA 4FRMA 2RJ8A 1INJA 5FTSA 5D92A 1HM9A 1LL0A 4AYJA 1R7UA 3USRA 4DECA 1FR8A 1OMZA 4D48A 2Y4MA 2VXLA 3IOJA 3JUJA 3EE5A 1G97A 1V83A 2JCJA 4KXOA 2Z86A 1FO9A 3OH3A 1YP4A 1IIMA 2XMEA 2W0VA 3CKVA 2RIZA 3SX5A 4E1KA 5I1FA 5DDTA 1QG8A 1FO8A 1NHEB 4DE7A 5BXCA 2X65A 2MZBA 1VPAA 3ZF8A 1G95A 5C3BA 2Z87A 2AM3A 3RMWA 3I0KA 2P72A 1HM8A 1ZJ1A 1FGXA 3KIAA 4M2BA 2V0IA 3CU0A 5FUHA 4KT7A 3V0MA 2Q4JA 4YS8A 1NMMB 3T7NA 1H4EA 4D0ZA 1VM8A 5EIYA 1VGUA 3R3IA 1G0RA 4B5BA 1LZJA 1LZ7A 3SX8A 1G2VA 1R7TA 1SS9A 2Y4JA 1WSZA 4Y7FA 4Y6UA 3ZGGA 5L6SA 2VS4A 4B2XA 4EEAA 1I52A 1LZIA 2X60A 5CMFX 3SXBA 3CKJA 4AC3A 4B4BA 4HO3A 2AGDA 2RJ4A 2I7BA 2A8WA 2APCA 1ZJPA 4B2WA 1H5SB 1R7XA 2XWNA 4LW3A 3TZTA 2FYBA 1H7EA 1O7OA 3OC9A 4KC1A 1FG5N 4HG6A 2RJ0A 2YQCA 4FIYA 4EEGA 2AE7A 3OH4A 2P73A 2V0KA 1WVCA 2YESA 3D5NA 4B42A 2RJ9A 4KQLA 3V91A 2NXVA 1NF5B 3ST8A 1EZIA 4FRPA 3RMVA 3PKPA 2OEFA 4EEMA 1TVYA 3CKOA 1NQIB 4FRQA 2ICXA 3D8VA 3V8ZA 2PGYA 1WT1A 4HO8A 1R81A 1PZYB 4O6NA 5JQQA 2VD4A 4HOCA 1XHBA 2J0AA 1FWYA 2YQSA 4O6MA 2E3DA 1R82A 3ZLLA 1H7HA 3PNNA 3SXEA 1GQCA 3O3PA 1HJJA 4ASJA 3R2WA 3U2TA 1K4VA 1FR9A 2UX8A 2FYDB 3FWWA 1ZJ2A 3BCVA 4FRAA 1H4CA 4HO9A 1H5RB 2XWLA 3K8DA 2VSHA 5C4DA 2WEEA 2YC5A 3Q4SA 1O0RA 1OMXA 4FIXA 4Y7GA 1LL3A 5C36A 2RIXA 3V0LA 2JCLA 2ZU8A 5C3DA 1JVGA 5C1LA 1INIA 2VS3A 3SX3A 3ZLKA 1H3MA 1TW1A 4Y64A 1S4NA 2O1HA 1XZ6A 2WVLA 2C0NA 1G1LA 4G3QA 1H7LA 2VXMA 1FGGA 3I0EA 5EJZA 1VZXA 5IFYA 1MP5A 4FREA 2VFZA 3IOIA 3PKQA 1MP3A 1H7GA 4K6RA 1ON8A 1ZI1A 4MIXA 5C49A 1JYKA 1PZTA 2BO8A 4M4KA 1ZIZA 2FFUA 5AJNA 5C4CA 2Y4LA 1G23A 2AECA 5CMIA 4D11A 2RJ1A 3T7OA 3D98A 3DK5A 1VH1A 4FROA 1ZHJA 4G3PA 1GA8A 2OEGA 3IOHA 2Y7AA 4B4MA 2O1FA 4HO0A 2CU2A 4B3UA 1H5TB 1GX4A 2X5ZA 1H5SD 4FRBA 5CQPA 5C48A 3U2VA 2ZU7A 4P02A 2ZU9A 1ZCTA 1LVWA 1V84A 1TW5A 4CVHA 3POLA 1ZI3A 2OI6A 4EEOA 4NALA 1H5SC 2VK9A 2YCMA 4G87A 2PGVA 4L41C 1ZI5A 2YC3A 5IDSA 2WVKA 3OH2A 5FU0A 4P00A 1OQMB 2GGQA 5CQOA 1ZCYA 4G3SA 1H7QA 2QKXA 3CKQA 5FYEA 5HS2A 4CJ8A 3OGZA 2WVMA 3V0OA 2BO7A 5FTVA 1LZ0A 3BRKX 2Y4KA 2FYAA 3K8EA 4HO6A 2OI7A 1YP2A 4D0TA 2QH5A 1VICA 1EYRA 2AM5A 2JCOA 1VH3A 4NANA 1S4PA 5FU8A 4GBPA 2YQJA 5C1HA 5C38A 3RSBA 3Q7UA 2P6WA 3I0GA 1ZJOA 5CQMX 1R7YA 4M28A 4MNDA 3Q80A 4KC2A 3CKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BMA A;  3SXA A;  4FRD A;  3TQD A;  4IRP A;  3U0X A;  3OH1 A;  5C4E A;  5FV9 A;  3SXC A;  1HM0 A;  2QGI A;  3JUK A;  1WT0 A;  3QVB A;  3USQ A;  2I5E A;  3E25 A;  2VSI A;  3E26 A;  1GWV A;  3V0P A;  3I0C A;  2RJ7 A;  2XWM A;  4Y62 A;  2Y6P A;  1FOA A;  5C3A A;  1JVD A;  4M2A A;  3LW6 A;  1FZW A;  1ZI4 A;  1MC3 A;  2OI5 A;  3NGW A;  4Y7U A;  1G3L A;  2I5K A;  1V82 A;  5C8R A;  3SX7 A;  1LL2 A;  2D7I A;  3F1C A;  4ASY A;  2X5S A;  1Z90 A;  2WAW A;  2YQH A;  4AYL A;  5CQN X;  2FFV A;  2RJ5 A;  1W55 A;  3I0L A;  4AAW A;  4FRL A;  2E8B A;  1QGQ A;  1YRO B;  1S4O A;  5DDV A;  5CMH A;  4J18 A;  2JCK A;  1KWS A;  3OH0 A;  4UEG A;  4KPZ A;  1HV9 A;  3I0H A;  1FRW A;  4Y63 A;  2XMH A;  1H7F A;  5J49 A;  4IRQ A;  4KC4 A;  2RIY A;  3N9W A;  1IIN A;  2O1G A;  3SXG A;  4XWI A;  3F1Y A;  2RJ6 A;  1R80 A;  1W57 A;  3OAM A;  4ZDQ A;  4KNX A;  1O7Q A;  3SXD A;  1ZDG A;  1ZDF A;  3V0N A;  1ZJ0 A;  2V0J A;  1H5R A;  2W0W A;  2FY7 A;  4JIS A;  3U2W A;  3U0Y A;  1JV3 A;  4ARW A;  3GUE A;  3V8Y A;  4EE4 A;  4R7P A;  3OKR A;  2PX7 A;  1G8O A;  2RIT A;  4Y7V A;  1VZU A;  2ICY A;  3DUV A;  1ON6 A;  1O23 B;  2BO4 A;  5AJP A;  1MP4 A;  5CMG X;  4KNR A;  5IDT A;  3U2X A;  1FXJ A;  4Y9X A;  4HO5 A;  1NWG B;  5C1G A;  4ECM A;  2DPW A;  1H4D A;  2V0H A;  4FQW A;  4Y6N A;  2V0L A;  4HO4 A;  2A8U A;  3V90 A;  1G93 A;  5CMJ A;  1JYL A;  1VGZ A;  5AJO A;  4D11 C;  2D7R A;  3I0J A;  1QWJ A;  3FOQ A;  1ZJ3 A;  4KRV A;  4EE5 A;  2WGZ A;  5C4B A;  2VS5 A;  2FYC B;  1FXO A;  5C47 A;  2WE9 A;  1E5K A;  1G9R A;  1VGW A;  2AH9 A;  2AES A;  2BO6 A;  4NAI A;  2D0J A;  5L6V A;  1R7V A;  4LW6 A;  4HO2 A;  3ZGF A;  3I0F A;  1H5T A;  3CGX A;  3SPT A;  4CJB A;  5CQL X;  4MYB A;  1VGT A;  1ZCV A;  3I0I X;  1NKH B;  1JV1 A;  1GQ9 A;  1VZT A;  1H7T A;  4FCE A;  2GGO A;  4HCQ A;  1GX0 A;  1WT3 A;  4B4G A;  1TZF A;  1HJL A;  3JTJ A;  2PA4 A;  1W77 A;  3V0Q A;  4EE3 A;  1ZCU A;  3HL3 A;  4NAK A;  4C2S A;  4EVW A;  4KPX A;  4Y7T A;  5C4F A;  1WT2 A;  4JD0 A;  1QGS A;  3DJ4 A;  4CJC A;  3T7M A;  3U2U A;  1YP3 A;  4FCU A;  5EJ1 A;  4DDZ A;  4FRH A;  3I0D A;  1H5S A;  2AM4 A;  4BQH A;  1GWW A;  4FRM A;  2RJ8 A;  1INJ A;  5FTS A;  1HM9 A;  1LL0 A;  4AYJ A;  1R7U A;  3USR A;  4DEC A;  1FR8 A;  1OMZ A;  4D48 A;  2Y4M A;  2VXL A;  3IOJ A;  3JUJ A;  3EE5 A;  1G97 A;  1V83 A;  2JCJ A;  4KXO A;  2Z86 A;  1FO9 A;  3OH3 A;  1YP4 A;  1IIM A;  2XME A;  2W0V A;  3CKV A;  2RIZ A;  3SX5 A;  4E1K A;  5I1F A;  5DDT A;  1QG8 A;  1FO8 A;  1NHE B;  4DE7 A;  5BXC A;  2X65 A;  2MZB A;  1VPA A;  3ZF8 A;  1G95 A;  5C3B A;  2Z87 A;  2AM3 A;  3RMW A;  3I0K A;  2P72 A;  1HM8 A;  1ZJ1 A;  1FGX A;  3KIA A;  4M2B A;  2V0I A;  3CU0 A;  5FUH A;  4KT7 A;  3V0M A;  2Q4J A;  4YS8 A;  1NMM B;  3T7N A;  1H4E A;  4D0Z A;  1VM8 A;  5EIY A;  1VGU A;  3R3I A;  1G0R A;  4B5B A;  1LZJ A;  1LZ7 A;  3SX8 A;  1G2V A;  1R7T A;  1SS9 A;  2Y4J A;  1WSZ A;  4Y7F A;  4Y6U A;  3ZGG A;  5L6S A;  2VS4 A;  4B2X A;  4EEA A;  1I52 A;  1LZI A;  2X60 A;  5CMF X;  3SXB A;  3CKJ A;  4AC3 A;  4B4B A;  4HO3 A;  2AGD A;  2RJ4 A;  2I7B A;  2A8W A;  2APC A;  1ZJP A;  4B2W A;  1H5S B;  1R7X A;  2XWN A;  4LW3 A;  3TZT A;  2FYB A;  1H7E A;  1O7O A;  3OC9 A;  4KC1 A;  1FG5 N;  4HG6 A;  2RJ0 A;  2YQC A;  4EEG A;  2AE7 A;  3OH4 A;  2P73 A;  2V0K A;  1WVC A;  2YES A;  3D5N A;  4B42 A;  2RJ9 A;  4KQL A;  3V91 A;  2NXV A;  1NF5 B;  3ST8 A;  1EZI A;  4FRP A;  3RMV A;  3PKP A;  2OEF A;  4EEM A;  1TVY A;  3CKO A;  1NQI B;  4FRQ A;  2ICX A;  3D8V A;  3V8Z A;  2PGY A;  1WT1 A;  4HO8 A;  1R81 A;  1PZY B;  5JQQ A;  2VD4 A;  4HOC A;  1XHB A;  1FWY A;  2YQS A;  2E3D A;  1R82 A;  3ZLL A;  1H7H A;  3PNN A;  3SXE A;  1GQC A;  3O3P A;  1HJJ A;  4ASJ A;  3R2W A;  3U2T A;  1K4V A;  1FR9 A;  2UX8 A;  2FYD B;  3FWW A;  1ZJ2 A;  3BCV A;  4FRA A;  1H4C A;  4HO9 A;  1H5R B;  2XWL A;  3K8D A;  2VSH A;  5C4D A;  2WEE A;  2YC5 A;  3Q4S A;  1O0R A;  1OMX A;  4Y7G A;  1LL3 A;  5C36 A;  2RIX A;  3V0L A;  2JCL A;  2ZU8 A;  5C3D A;  1JVG A;  5C1L A;  1INI A;  2VS3 A;  3SX3 A;  3ZLK A;  1H3M A;  1TW1 A;  4Y64 A;  1S4N A;  2O1H A;  1XZ6 A;  2WVL A;  1G1L A;  4G3Q A;  1H7L A;  2VXM A;  1FGG A;  3I0E A;  5EJZ A;  1VZX A;  5IFY A;  1MP5 A;  4FRE A;  2VFZ A;  3IOI A;  3PKQ A;  1MP3 A;  1H7G A;  4K6R A;  1ON8 A;  1ZI1 A;  5C49 A;  1JYK A;  1PZT A;  2BO8 A;  4M4K A;  1ZIZ A;  2FFU A;  5AJN A;  5C4C A;  2Y4L A;  1G23 A;  2AEC A;  5CMI A;  4D11 A;  2RJ1 A;  3T7O A;  3D98 A;  3DK5 A;  1VH1 A;  4FRO A;  1ZHJ A;  4G3P A;  1GA8 A;  2OEG A;  3IOH A;  2Y7A A;  4B4M A;  2O1F A;  4HO0 A;  2CU2 A;  4B3U A;  1H5T B;  1GX4 A;  2X5Z A;  1H5S D;  4FRB A;  5CQP A;  5C48 A;  3U2V A;  2ZU7 A;  4P02 A;  2ZU9 A;  1ZCT A;  1LVW A;  1V84 A;  1TW5 A;  4CVH A;  3POL A;  1ZI3 A;  2OI6 A;  4EEO A;  4NAL A;  1H5S C;  2YCM A;  4G87 A;  2PGV A;  4L41 C;  1ZI5 A;  2YC3 A;  5IDS A;  2WVK A;  3OH2 A;  5FU0 A;  4P00 A;  1OQM B;  2GGQ A;  5CQO A;  1ZCY A;  4G3S A;  1H7Q A;  2QKX A;  3CKQ A;  5FYE A;  5HS2 A;  4CJ8 A;  3OGZ A;  2WVM A;  3V0O A;  2BO7 A;  5FTV A;  1LZ0 A;  3BRK X;  2Y4K A;  2FYA A;  3K8E A;  4HO6 A;  2OI7 A;  1YP2 A;  4D0T A;  2QH5 A;  1VIC A;  1EYR A;  2AM5 A;  2JCO A;  1VH3 A;  4NAN A;  1S4P A;  5FU8 A;  4GBP A;  2YQJ A;  5C1H A;  5C38 A;  3RSB A;  3Q7U A;  2P6W A;  3I0G A;  1ZJO A;  5CQM X;  1R7Y A;  4M28 A;  4MND A;  3Q80 A;  4KC2 A;  3CKN A; 
#chains in the Genus database with same CATH topology
 4BMA A;  3SXA A;  4FRD A;  3TQD A;  4IRP A;  3U0X A;  3OH1 A;  5C4E A;  5FV9 A;  3SXC A;  1HM0 A;  2QGI A;  3JUK A;  1WT0 A;  3QVB A;  3USQ A;  2I5E A;  3E25 A;  2VSI A;  3E26 A;  1GWV A;  3V0P A;  3I0C A;  2RJ7 A;  2XWM A;  4Y62 A;  2Y6P A;  1FOA A;  5C3A A;  1JVD A;  4M2A A;  3LW6 A;  1FZW A;  1ZI4 A;  1MC3 A;  2OI5 A;  3NGW A;  4Y7U A;  1G3L A;  2I5K A;  1V82 A;  5C8R A;  3SX7 A;  1LL2 A;  2D7I A;  3F1C A;  4ASY A;  2X5S A;  1Z90 A;  2WAW A;  2YQH A;  4AYL A;  5CQN X;  2FFV A;  2RJ5 A;  1W55 A;  3I0L A;  4AAW A;  4FRL A;  2E8B A;  1QGQ A;  1YRO B;  1S4O A;  5DDV A;  5CMH A;  4J18 A;  2JCK A;  1KWS A;  3OH0 A;  4UEG A;  4KPZ A;  1HV9 A;  3I0H A;  1FRW A;  4Y63 A;  2XMH A;  1H7F A;  5J49 A;  4IRQ A;  4KC4 A;  2RIY A;  3N9W A;  1IIN A;  2O1G A;  3SXG A;  2J0B A;  4XWI A;  3F1Y A;  2RJ6 A;  1R80 A;  1W57 A;  3OAM A;  4ZDQ A;  4KNX A;  1O7Q A;  3SXD A;  1ZDG A;  1ZDF A;  3V0N A;  1ZJ0 A;  2V0J A;  1H5R A;  2W0W A;  2FY7 A;  4JIS A;  3U2W A;  3U0Y A;  5D91 A;  1JV3 A;  4ARW A;  3GUE A;  3V8Y A;  4EE4 A;  4R7P A;  3OKR A;  2PX7 A;  1G8O A;  2RIT A;  4Y7V A;  1VZU A;  2ICY A;  3DUV A;  1ON6 A;  1O23 B;  2BO4 A;  5AJP A;  1MP4 A;  5CMG X;  4KNR A;  5IDT A;  3U2X A;  1FXJ A;  4Y9X A;  4HO5 A;  1NWG B;  5C1G A;  4ECM A;  2DPW A;  1H4D A;  2V0H A;  4FQW A;  4Y6N A;  2V0L A;  4HO4 A;  2A8U A;  3V90 A;  1G93 A;  5CMJ A;  1JYL A;  1VGZ A;  5AJO A;  4D11 C;  2D7R A;  3I0J A;  1QWJ A;  3FOQ A;  1ZJ3 A;  4KRV A;  4EE5 A;  2WGZ A;  5C4B A;  2VS5 A;  2FYC B;  1FXO A;  5C47 A;  2WE9 A;  1E5K A;  1G9R A;  1VGW A;  2AH9 A;  2AES A;  2BO6 A;  4NAI A;  2D0J A;  5L6V A;  1R7V A;  4LW6 A;  4HO2 A;  3ZGF A;  3I0F A;  1H5T A;  3CGX A;  3SPT A;  4CJB A;  5CQL X;  4MYB A;  1VGT A;  1ZCV A;  3I0I X;  1NKH B;  1JV1 A;  1GQ9 A;  1VZT A;  1H7T A;  4FCE A;  2GGO A;  4HCQ A;  4Q7C A;  1GX0 A;  1WT3 A;  4B4G A;  1TZF A;  1HJL A;  3JTJ A;  2PA4 A;  1W77 A;  3V0Q A;  4EE3 A;  1ZCU A;  3HL3 A;  4NAK A;  4C2S A;  4EVW A;  4KPX A;  4Y7T A;  5C4F A;  1WT2 A;  4JD0 A;  1QGS A;  3DJ4 A;  4CJC A;  3T7M A;  3U2U A;  1YP3 A;  4FCU A;  5EJ1 A;  4DDZ A;  4FRH A;  3I0D A;  1H5S A;  2AM4 A;  4BQH A;  1GWW A;  4FRM A;  2RJ8 A;  1INJ A;  5FTS A;  5D92 A;  1HM9 A;  1LL0 A;  4AYJ A;  1R7U A;  3USR A;  4DEC A;  1FR8 A;  1OMZ A;  4D48 A;  2Y4M A;  2VXL A;  3IOJ A;  3JUJ A;  3EE5 A;  1G97 A;  1V83 A;  2JCJ A;  4KXO A;  2Z86 A;  1FO9 A;  3OH3 A;  1YP4 A;  1IIM A;  2XME A;  2W0V A;  3CKV A;  2RIZ A;  3SX5 A;  4E1K A;  5I1F A;  5DDT A;  1QG8 A;  1FO8 A;  1NHE B;  4DE7 A;  5BXC A;  2X65 A;  2MZB A;  1VPA A;  3ZF8 A;  1G95 A;  5C3B A;  2Z87 A;  2AM3 A;  3RMW A;  3I0K A;  2P72 A;  1HM8 A;  1ZJ1 A;  1FGX A;  3KIA A;  4M2B A;  2V0I A;  3CU0 A;  5FUH A;  4KT7 A;  3V0M A;  2Q4J A;  4YS8 A;  1NMM B;  3T7N A;  1H4E A;  4D0Z A;  1VM8 A;  5EIY A;  1VGU A;  3R3I A;  1G0R A;  4B5B A;  1LZJ A;  1LZ7 A;  3SX8 A;  1G2V A;  1R7T A;  1SS9 A;  2Y4J A;  1WSZ A;  4Y7F A;  4Y6U A;  3ZGG A;  5L6S A;  2VS4 A;  4B2X A;  4EEA A;  1I52 A;  1LZI A;  2X60 A;  5CMF X;  3SXB A;  3CKJ A;  4AC3 A;  4B4B A;  4HO3 A;  2AGD A;  2RJ4 A;  2I7B A;  2A8W A;  2APC A;  1ZJP A;  4B2W A;  1H5S B;  1R7X A;  2XWN A;  4LW3 A;  3TZT A;  2FYB A;  1H7E A;  1O7O A;  3OC9 A;  4KC1 A;  1FG5 N;  4HG6 A;  2RJ0 A;  2YQC A;  4FIY A;  4EEG A;  2AE7 A;  3OH4 A;  2P73 A;  2V0K A;  1WVC A;  2YES A;  3D5N A;  4B42 A;  2RJ9 A;  4KQL A;  3V91 A;  2NXV A;  1NF5 B;  3ST8 A;  1EZI A;  4FRP A;  3RMV A;  3PKP A;  2OEF A;  4EEM A;  1TVY A;  3CKO A;  1NQI B;  4FRQ A;  2ICX A;  3D8V A;  3V8Z A;  2PGY A;  1WT1 A;  4HO8 A;  1R81 A;  1PZY B;  4O6N A;  5JQQ A;  2VD4 A;  4HOC A;  1XHB A;  2J0A A;  1FWY A;  2YQS A;  4O6M A;  2E3D A;  1R82 A;  3ZLL A;  1H7H A;  3PNN A;  3SXE A;  1GQC A;  3O3P A;  1HJJ A;  4ASJ A;  3R2W A;  3U2T A;  1K4V A;  1FR9 A;  2UX8 A;  2FYD B;  3FWW A;  1ZJ2 A;  3BCV A;  4FRA A;  1H4C A;  4HO9 A;  1H5R B;  2XWL A;  3K8D A;  2VSH A;  5C4D A;  2WEE A;  2YC5 A;  3Q4S A;  1O0R A;  1OMX A;  4FIX A;  4Y7G A;  1LL3 A;  5C36 A;  2RIX A;  3V0L A;  2JCL A;  2ZU8 A;  5C3D A;  1JVG A;  5C1L A;  1INI A;  2VS3 A;  3SX3 A;  3ZLK A;  1H3M A;  1TW1 A;  4Y64 A;  1S4N A;  2O1H A;  1XZ6 A;  2WVL A;  2C0N A;  1G1L A;  4G3Q A;  1H7L A;  2VXM A;  1FGG A;  3I0E A;  5EJZ A;  1VZX A;  5IFY A;  1MP5 A;  4FRE A;  2VFZ A;  3IOI A;  3PKQ A;  1MP3 A;  1H7G A;  4K6R A;  1ON8 A;  1ZI1 A;  4MIX A;  5C49 A;  1JYK A;  1PZT A;  2BO8 A;  4M4K A;  1ZIZ A;  2FFU A;  5AJN A;  5C4C A;  2Y4L A;  1G23 A;  2AEC A;  5CMI A;  4D11 A;  2RJ1 A;  3T7O A;  3D98 A;  3DK5 A;  1VH1 A;  4FRO A;  1ZHJ A;  4G3P A;  1GA8 A;  2OEG A;  3IOH A;  2Y7A A;  4B4M A;  2O1F A;  4HO0 A;  2CU2 A;  4B3U A;  1H5T B;  1GX4 A;  2X5Z A;  1H5S D;  4FRB A;  5CQP A;  5C48 A;  3U2V A;  2ZU7 A;  4P02 A;  2ZU9 A;  1ZCT A;  1LVW A;  1V84 A;  1TW5 A;  4CVH A;  3POL A;  1ZI3 A;  2OI6 A;  4EEO A;  4NAL A;  1H5S C;  2VK9 A;  2YCM A;  4G87 A;  2PGV A;  4L41 C;  1ZI5 A;  2YC3 A;  5IDS A;  2WVK A;  3OH2 A;  5FU0 A;  4P00 A;  1OQM B;  2GGQ A;  5CQO A;  1ZCY A;  4G3S A;  1H7Q A;  2QKX A;  3CKQ A;  5FYE A;  5HS2 A;  4CJ8 A;  3OGZ A;  2WVM A;  3V0O A;  2BO7 A;  5FTV A;  1LZ0 A;  3BRK X;  2Y4K A;  2FYA A;  3K8E A;  4HO6 A;  2OI7 A;  1YP2 A;  4D0T A;  2QH5 A;  1VIC A;  1EYR A;  2AM5 A;  2JCO A;  1VH3 A;  4NAN A;  1S4P A;  5FU8 A;  4GBP A;  2YQJ A;  5C1H A;  5C38 A;  3RSB A;  3Q7U A;  2P6W A;  3I0G A;  1ZJO A;  5CQM X;  1R7Y A;  4M28 A;  4MND A;  3Q80 A;  4KC2 A;  3CKN A; 
#chains in the Genus database with same CATH homology
 4BMA A;  3SXA A;  4FRD A;  3TQD A;  4IRP A;  3U0X A;  3OH1 A;  5C4E A;  5FV9 A;  3SXC A;  1HM0 A;  2QGI A;  3JUK A;  1WT0 A;  3QVB A;  3USQ A;  2I5E A;  3E25 A;  2VSI A;  3E26 A;  1GWV A;  3V0P A;  3I0C A;  2RJ7 A;  2XWM A;  4Y62 A;  2Y6P A;  1FOA A;  5C3A A;  1JVD A;  4M2A A;  3LW6 A;  1FZW A;  1ZI4 A;  1MC3 A;  2OI5 A;  3NGW A;  4Y7U A;  1G3L A;  2I5K A;  1V82 A;  5C8R A;  3SX7 A;  1LL2 A;  2D7I A;  3F1C A;  4ASY A;  2X5S A;  1Z90 A;  2WAW A;  2YQH A;  4AYL A;  5CQN X;  2FFV A;  2RJ5 A;  1W55 A;  3I0L A;  4AAW A;  4FRL A;  2E8B A;  1QGQ A;  1YRO B;  1S4O A;  5DDV A;  5CMH A;  4J18 A;  2JCK A;  1KWS A;  3OH0 A;  4UEG A;  4KPZ A;  1HV9 A;  3I0H A;  1FRW A;  4Y63 A;  2XMH A;  1H7F A;  5J49 A;  4IRQ A;  4KC4 A;  2RIY A;  3N9W A;  1IIN A;  2O1G A;  3SXG A;  2J0B A;  4XWI A;  3F1Y A;  2RJ6 A;  1R80 A;  1W57 A;  3OAM A;  4ZDQ A;  4KNX A;  1O7Q A;  3SXD A;  1ZDG A;  1ZDF A;  3V0N A;  1ZJ0 A;  2V0J A;  1H5R A;  2W0W A;  2FY7 A;  4JIS A;  3U2W A;  3U0Y A;  5D91 A;  1JV3 A;  4ARW A;  3GUE A;  3V8Y A;  4EE4 A;  4R7P A;  3OKR A;  2PX7 A;  1G8O A;  2RIT A;  4Y7V A;  1VZU A;  2ICY A;  3DUV A;  1ON6 A;  1O23 B;  2BO4 A;  5AJP A;  1MP4 A;  5CMG X;  4KNR A;  5IDT A;  3U2X A;  1FXJ A;  4Y9X A;  4HO5 A;  1NWG B;  5C1G A;  4ECM A;  2DPW A;  1H4D A;  2V0H A;  4FQW A;  4Y6N A;  2V0L A;  4HO4 A;  2A8U A;  3V90 A;  1G93 A;  5CMJ A;  1JYL A;  1VGZ A;  5AJO A;  4D11 C;  2D7R A;  3I0J A;  1QWJ A;  3FOQ A;  1ZJ3 A;  4KRV A;  4EE5 A;  2WGZ A;  5C4B A;  2VS5 A;  2FYC B;  1FXO A;  5C47 A;  2WE9 A;  1E5K A;  1G9R A;  1VGW A;  2AH9 A;  2AES A;  2BO6 A;  4NAI A;  2D0J A;  5L6V A;  1R7V A;  4LW6 A;  4HO2 A;  3ZGF A;  3I0F A;  1H5T A;  3CGX A;  3SPT A;  4CJB A;  5CQL X;  4MYB A;  1VGT A;  1ZCV A;  3I0I X;  1NKH B;  1JV1 A;  1GQ9 A;  1VZT A;  1H7T A;  4FCE A;  2GGO A;  4HCQ A;  4Q7C A;  1GX0 A;  1WT3 A;  4B4G A;  1TZF A;  1HJL A;  3JTJ A;  2PA4 A;  1W77 A;  3V0Q A;  4EE3 A;  1ZCU A;  3HL3 A;  4NAK A;  4C2S A;  4EVW A;  4KPX A;  4Y7T A;  5C4F A;  1WT2 A;  4JD0 A;  1QGS A;  3DJ4 A;  4CJC A;  3T7M A;  3U2U A;  1YP3 A;  4FCU A;  5EJ1 A;  4DDZ A;  4FRH A;  3I0D A;  1H5S A;  2AM4 A;  4BQH A;  1GWW A;  4FRM A;  2RJ8 A;  1INJ A;  5FTS A;  5D92 A;  1HM9 A;  1LL0 A;  4AYJ A;  1R7U A;  3USR A;  4DEC A;  1FR8 A;  1OMZ A;  4D48 A;  2Y4M A;  2VXL A;  3IOJ A;  3JUJ A;  3EE5 A;  1G97 A;  1V83 A;  2JCJ A;  4KXO A;  2Z86 A;  1FO9 A;  3OH3 A;  1YP4 A;  1IIM A;  2XME A;  2W0V A;  3CKV A;  2RIZ A;  3SX5 A;  4E1K A;  5I1F A;  5DDT A;  1QG8 A;  1FO8 A;  1NHE B;  4DE7 A;  5BXC A;  2X65 A;  2MZB A;  1VPA A;  3ZF8 A;  1G95 A;  5C3B A;  2Z87 A;  2AM3 A;  3RMW A;  3I0K A;  2P72 A;  1HM8 A;  1ZJ1 A;  1FGX A;  3KIA A;  4M2B A;  2V0I A;  3CU0 A;  5FUH A;  4KT7 A;  3V0M A;  2Q4J A;  4YS8 A;  1NMM B;  3T7N A;  1H4E A;  4D0Z A;  1VM8 A;  5EIY A;  1VGU A;  3R3I A;  1G0R A;  4B5B A;  1LZJ A;  1LZ7 A;  3SX8 A;  1G2V A;  1R7T A;  1SS9 A;  2Y4J A;  1WSZ A;  4Y7F A;  4Y6U A;  3ZGG A;  5L6S A;  2VS4 A;  4B2X A;  4EEA A;  1I52 A;  1LZI A;  2X60 A;  5CMF X;  3SXB A;  3CKJ A;  4AC3 A;  4B4B A;  4HO3 A;  2AGD A;  2RJ4 A;  2I7B A;  2A8W A;  2APC A;  1ZJP A;  4B2W A;  1H5S B;  1R7X A;  2XWN A;  4LW3 A;  3TZT A;  2FYB A;  1H7E A;  1O7O A;  3OC9 A;  4KC1 A;  1FG5 N;  4HG6 A;  2RJ0 A;  2YQC A;  4FIY A;  4EEG A;  2AE7 A;  3OH4 A;  2P73 A;  2V0K A;  1WVC A;  2YES A;  3D5N A;  4B42 A;  2RJ9 A;  4KQL A;  3V91 A;  2NXV A;  1NF5 B;  3ST8 A;  1EZI A;  4FRP A;  3RMV A;  3PKP A;  2OEF A;  4EEM A;  1TVY A;  3CKO A;  1NQI B;  4FRQ A;  2ICX A;  3D8V A;  3V8Z A;  2PGY A;  1WT1 A;  4HO8 A;  1R81 A;  1PZY B;  4O6N A;  5JQQ A;  2VD4 A;  4HOC A;  1XHB A;  2J0A A;  1FWY A;  2YQS A;  4O6M A;  2E3D A;  1R82 A;  3ZLL A;  1H7H A;  3PNN A;  3SXE A;  1GQC A;  3O3P A;  1HJJ A;  4ASJ A;  3R2W A;  3U2T A;  1K4V A;  1FR9 A;  2UX8 A;  2FYD B;  3FWW A;  1ZJ2 A;  3BCV A;  4FRA A;  1H4C A;  4HO9 A;  1H5R B;  2XWL A;  3K8D A;  2VSH A;  5C4D A;  2WEE A;  2YC5 A;  3Q4S A;  1O0R A;  1OMX A;  4FIX A;  4Y7G A;  1LL3 A;  5C36 A;  2RIX A;  3V0L A;  2JCL A;  2ZU8 A;  5C3D A;  1JVG A;  5C1L A;  1INI A;  2VS3 A;  3SX3 A;  3ZLK A;  1H3M A;  1TW1 A;  4Y64 A;  1S4N A;  2O1H A;  1XZ6 A;  2WVL A;  2C0N A;  1G1L A;  4G3Q A;  1H7L A;  2VXM A;  1FGG A;  3I0E A;  5EJZ A;  1VZX A;  5IFY A;  1MP5 A;  4FRE A;  2VFZ A;  3IOI A;  3PKQ A;  1MP3 A;  1H7G A;  4K6R A;  1ON8 A;  1ZI1 A;  4MIX A;  5C49 A;  1JYK A;  1PZT A;  2BO8 A;  4M4K A;  1ZIZ A;  2FFU A;  5AJN A;  5C4C A;  2Y4L A;  1G23 A;  2AEC A;  5CMI A;  4D11 A;  2RJ1 A;  3T7O A;  3D98 A;  3DK5 A;  1VH1 A;  4FRO A;  1ZHJ A;  4G3P A;  1GA8 A;  2OEG A;  3IOH A;  2Y7A A;  4B4M A;  2O1F A;  4HO0 A;  2CU2 A;  4B3U A;  1H5T B;  1GX4 A;  2X5Z A;  1H5S D;  4FRB A;  5CQP A;  5C48 A;  3U2V A;  2ZU7 A;  4P02 A;  2ZU9 A;  1ZCT A;  1LVW A;  1V84 A;  1TW5 A;  4CVH A;  3POL A;  1ZI3 A;  2OI6 A;  4EEO A;  4NAL A;  1H5S C;  2VK9 A;  2YCM A;  4G87 A;  2PGV A;  4L41 C;  1ZI5 A;  2YC3 A;  5IDS A;  2WVK A;  3OH2 A;  5FU0 A;  4P00 A;  1OQM B;  2GGQ A;  5CQO A;  1ZCY A;  4G3S A;  1H7Q A;  2QKX A;  3CKQ A;  5FYE A;  5HS2 A;  4CJ8 A;  3OGZ A;  2WVM A;  3V0O A;  2BO7 A;  5FTV A;  1LZ0 A;  3BRK X;  2Y4K A;  2FYA A;  3K8E A;  4HO6 A;  2OI7 A;  1YP2 A;  4D0T A;  2QH5 A;  1VIC A;  1EYR A;  2AM5 A;  2JCO A;  1VH3 A;  4NAN A;  1S4P A;  5FU8 A;  4GBP A;  2YQJ A;  5C1H A;  5C38 A;  3RSB A;  3Q7U A;  2P6W A;  3I0G A;  1ZJO A;  5CQM X;  1R7Y A;  4M28 A;  4MND A;  3Q80 A;  4KC2 A;  3CKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...