3SXDA

Crystal structure of bbbb+udp+gal with mpd as the cryoprotectant
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
284
structure length
272
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Sequence-dependent effects of cryoprotectants on the active sites of the human ABO(H) blood group A and B glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 272
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sxdA00
2YQCA 4FRQA 4AYLA 2V0KA 4K6RA 1HM9A 1H7EA 1O23B 1H5SA 3OH1A 3U2VA 1O7QA 4JISA 1VGZA 1H5RB 3U2XA 3SX7A 5FU8A 5C48A 4B3UA 1S4NA 2RJ8A 2X5ZA 2YQJA 3IOHA 2P6WA 3SX5A 1LZIA 2GGQA 1I52A 1LZJA 4FRDA 2JCKA 3BRKX 1ZJ3A 4AYJA 4FRPA 4Y7TA 1G95A 1V84A 5CMHA 2QGIA 1HJLA 1VGWA 1QGSA 2P73A 4EE3A 4KC2A 2X65A 3I0FA 1R7XA 2MZBA 3T7NA 4NAKA 1NWGB 2E3DA 3I0JA 5C4EA 1ZCYA 2WAWA 3I0DA 2CU2A 4AAWA 3CKOA 3I0CA 3POLA 1R7YA 5C4CA 1JYKA 1FR8A 4KT7A 3LW6A 1KWSA 3V0MA 3JUJA 1ZJOA 4HO4A 2PA4A 5CMGX 2D0JA 2PX7A 4J18A 1FR9A 2VS4A 4EEGA 4HCQA 4LW6A 2X60A 3SX3A 2O1GA 2BO8A 2PGVA 2YC3A 3V0OA 4EEOA 5FYEA 4BQHA 1VGTA 2RJ0A 2WE9A 2XMHA 1TW5A 3SXBA 4EEAA 3GUEA 4AC3A 2VXLA 2A8UA 2I5EA 1XZ6A 2RITA 2ZU8A 5IDTA 4M4KA 2RJ5A 2ICYA 2XMEA 4UEGA 4NAIA 2YQSA 5CMFX 3TZTA 5FV9A 1G2VA 3R2WA 3I0IX 1H3MA 1ZI5A 1K4VA 1W57A 4M2BA 1S4PA 1PZTA 2Y4LA 5C1HA 1ON8A 4KRVA 4D48A 4FRMA 2WVKA 1JVGA 1G0RA 4KC1A 4CJ8A 4G3SA 1ZI3A 3U0YA 1R80A 4E1KA 3V90A 1ZHJA 1EZIA 1TW1A 3V8YA 2D7RA 1LL2A 4EVWA 1R7UA 3U0XA 3JUKA 1H7GA 1WT0A 1OMXA 4Y6UA 1ZJ1A 4FREA 5L6VA 5FU0A 3OGZA 1H7FA 1INIA 4HOCA 4FRAA 1TVYA 3CGXA 1JVDA 2D7IA 3OH2A 1YROB 2DPWA 2FYBA 4HG6A 2AH9A 4HO5A 5C4DA 4LW3A 3RMVA 1H5SD 1GQCA 2JCOA 3OH0A 3K8DA 1ZI1A 2AM5A 1ZJPA 4P02A 4GBPA 1NKHB 1H4DA 5IFYA 4XWIA 2RIXA 5FTSA 3CKJA 2QH5A 3ST8A 2VS3A 1H4EA 2Y4JA 1GX0A 1WVCA 2P72A 3I0EA 3HL3A 3F1YA 3SXCA 5CQMX 2FYCB 5C49A 4ECMA 1G93A 2W0WA 4C2SA 5C38A 2RJ9A 2WVLA 2FFVA 4NALA 3FOQA 1TZFA 2APCA 1FOAA 1R7VA 1VZUA 5JQQA 3ZGFA 4CVHA 3D8VA 2E8BA 3CKNA 3E25A 4Y6NA 4KPXA 2WEEA 1R7TA 3RMWA 4M2AA 3USRA 1H5TB 2RJ7A 2V0HA 1LVWA 4G3PA 2VS5A 4FRBA 5HS2A 2V0IA 1FG5N 1HJJA 2Q4JA 1G3LA 5CQPA 2RIZA 1VH3A 4CJCA 3ZLKA 4B4GA 5L6SA 1H5RA 1H7HA 3PKQA 1ZJ2A 1EYRA 3DUVA 1G23A 1W77A 3TQDA 4EE5A 5C1LA 1LZ0A 3QVBA 1E5KA 4MYBA 1ON6A 4B4MA 1ZCUA 4HO3A 3V91A 5BXCA 1WSZA 1QWJA 2OEGA 1FXJA 1JYLA 1QGQA 1IIMA 1V83A 4KXOA 2RJ6A 2Y7AA 3CU0A 3V0LA 1GA8A 5C8RA 1FXOA 1NF5B 1ZDGA 1FRWA 3SX8A 1MP3A 4KQLA 1FZWA 1HM8A 1Z90A 4Y7VA 3OH3A 2JCJA 3SXAA 2BO6A 4B2WA 4ASJA 3I0LA 4HO6A 1JV1A 5C4FA 2Y6PA 2Y4KA 3BCVA 3SXDA 1H5SB 1O0RA 4NANA 1R82A 5AJOA 2JCLA 4B42A 2X5SA 3CKQA 4KPZA 4D11C 1YP4A 1HV9A 3FWWA 1QG8A 3SXGA 2RJ4A 1YP3A 5CMJA 3NGWA 3U2WA 5IDSA 1H7QA 3K8EA 3SPTA 1R81A 5C3AA 1VGUA 2OI5A 2YESA 2VSHA 4EE4A 1MP5A 2FYAA 1ZI4A 2WVMA 2YQHA 3V8ZA 2QKXA 3CKVA 1FGXA 4FRHA 5EJZA 3ZLLA 1SS9A 2O1FA 2VXMA 4G3QA 3IOJA 3Q7UA 3U2TA 4CJBA 3PKPA 3EE5A 3Q4SA 3OAMA 2OI6A 4FCUA 2AM4A 2W0VA 4B4BA 4D11A 4DECA 2VD4A 2XWLA 3OC9A 5J49A 5C4BA 3DK5A 1NMMB 1H4CA 2BO4A 4FCEA 5CMIA 4D0TA 2BO7A 4ZDQA 4D0ZA 1H7TA 1XHBA 4FQWA 5CQLX 2NXVA 3R3IA 4HO0A 1INJA 1OQMB 2UX8A 4FROA 2RJ1A 1VICA 3JTJA 3USQA 4Y7FA 4EEMA 1G9RA 3ZGGA 4Y7UA 2OI7A 1VZXA 4JD0A 4MNDA 1ZCVA 1HM0A 2I5KA 4HO9A 3ZF8A 1GWWA 1WT1A 2V0LA 3OKRA 4Y62A 4B5BA 2AGDA 4KC4A 4HO2A 3D5NA 4P00A 2AE7A 1MP4A 5AJPA 3T7OA 2FFUA 2YC5A 4ARWA 1NQIB 1V82A 2Z87A 2Y4MA 3I0GA 3F1CA 5DDVA 4FRLA 3IOIA 5C36A 2GGOA 1ZIZA 5FTVA 5C3DA 5EJ1A 2AM3A 3I0KA 5DDTA 1VH1A 2ICXA 2VFZA 5CQOA 4ASYA 5C1GA 2XWNA 1IINA 1LL3A 1MC3A 1WT2A 4YS8A 2AESA 1VM8A 3T7MA 3OH4A 1FGGA 1G97A 1YP2A 4R7PA 3DJ4A 4Y63A 2O1HA 2PGYA 5EIYA 1GWVA 1WT3A 4L41C 3RSBA 4Y7GA 4BMAA 5CQNX 1GX4A 3V0PA 3U2UA 3I0HA 3Q80A 2ZU7A 1H5TA 5C3BA 5I1FA 3N9WA 3V0NA 3PNNA 3D98A 1NHEB 4DE7A 2WGZA 2AECA 4IRPA 1FWYA 2FYDB 1JV3A 4Y64A 2FY7A 1O7OA 4HO8A 1OMZA 2YCMA 1ZDFA 2V0JA 2Z86A 5FUHA 4B2XA 4Y9XA 1H5SC 2A8WA 1PZYB 1ZCTA 2ZU9A 1FO8A 1ZJ0A 1VPAA 1LL0A 3KIAA 4M28A 3O3PA 4KNRA 2XWMA 2I7BA 2OEFA 3SXEA 5AJNA 2RIYA 2VSIA 4DDZA 4G87A 1G8OA 5C47A 4KNXA 1S4OA 1GQ9A 3E26A 1LZ7A 1W55A 4IRQA 1G1LA 1VZTA 1FO9A 1H7LA 3V0QA
chains in the Genus database with same CATH superfamily
2YQCA 4FRQA 4AYLA 2V0KA 4K6RA 1HM9A 1H7EA 1O23B 1H5SA 3OH1A 3U2VA 1O7QA 4JISA 1VGZA 1H5RB 3U2XA 3SX7A 5FU8A 5C48A 4B3UA 1S4NA 2RJ8A 2X5ZA 2YQJA 3IOHA 2P6WA 3SX5A 1LZIA 2GGQA 1I52A 1LZJA 4FRDA 2JCKA 3BRKX 1ZJ3A 4AYJA 4FRPA 4Y7TA 1G95A 1V84A 5CMHA 2QGIA 1HJLA 1VGWA 1QGSA 2P73A 4EE3A 4KC2A 2X65A 3I0FA 1R7XA 2MZBA 3T7NA 4NAKA 1NWGB 2E3DA 3I0JA 5C4EA 1ZCYA 2WAWA 3I0DA 2CU2A 4AAWA 3CKOA 3I0CA 3POLA 1R7YA 5C4CA 1JYKA 1FR8A 4KT7A 3LW6A 1KWSA 3V0MA 3JUJA 1ZJOA 4HO4A 2PA4A 5CMGX 2D0JA 2PX7A 4J18A 1FR9A 2VS4A 4EEGA 4HCQA 4LW6A 2X60A 3SX3A 2O1GA 2BO8A 2PGVA 2YC3A 3V0OA 4EEOA 5FYEA 4BQHA 1VGTA 2RJ0A 2WE9A 2XMHA 1TW5A 3SXBA 4EEAA 3GUEA 4AC3A 2VXLA 2A8UA 2I5EA 1XZ6A 2RITA 2ZU8A 5IDTA 4M4KA 4Q7CA 2RJ5A 5D92A 2ICYA 2XMEA 4UEGA 4NAIA 4FIYA 2YQSA 5CMFX 3TZTA 5FV9A 1G2VA 3R2WA 3I0IX 1H3MA 1ZI5A 1K4VA 1W57A 4M2BA 1S4PA 1PZTA 2Y4LA 5C1HA 1ON8A 4KRVA 4D48A 4FRMA 2WVKA 1JVGA 1G0RA 4KC1A 4CJ8A 4G3SA 1ZI3A 3U0YA 1R80A 4E1KA 3V90A 1ZHJA 1EZIA 1TW1A 3V8YA 2D7RA 1LL2A 4EVWA 1R7UA 3U0XA 3JUKA 1H7GA 1WT0A 1OMXA 4Y6UA 1ZJ1A 4FREA 5L6VA 5FU0A 3OGZA 1H7FA 1INIA 4HOCA 4FRAA 1TVYA 3CGXA 1JVDA 2D7IA 3OH2A 1YROB 2DPWA 2FYBA 4HG6A 2AH9A 4HO5A 5C4DA 4LW3A 3RMVA 1H5SD 1GQCA 2JCOA 3OH0A 3K8DA 1ZI1A 2AM5A 1ZJPA 4P02A 4GBPA 1NKHB 1H4DA 5IFYA 4XWIA 2RIXA 4O6MA 5FTSA 3CKJA 2QH5A 3ST8A 2VS3A 1H4EA 2Y4JA 1GX0A 1WVCA 2P72A 3I0EA 3HL3A 3F1YA 3SXCA 5CQMX 2FYCB 5C49A 4ECMA 1G93A 2W0WA 4C2SA 5C38A 2RJ9A 2WVLA 2FFVA 4NALA 3FOQA 1TZFA 2APCA 1FOAA 1R7VA 1VZUA 5JQQA 3ZGFA 4CVHA 3D8VA 2E8BA 3CKNA 3E25A 4Y6NA 4KPXA 2WEEA 1R7TA 3RMWA 4M2AA 3USRA 1H5TB 2RJ7A 2V0HA 1LVWA 4G3PA 2VS5A 4FRBA 5HS2A 2V0IA 1FG5N 1HJJA 2Q4JA 1G3LA 5CQPA 2RIZA 1VH3A 4CJCA 3ZLKA 4B4GA 5L6SA 1H5RA 1H7HA 3PKQA 1ZJ2A 1EYRA 3DUVA 1G23A 1W77A 3TQDA 4EE5A 5C1LA 1LZ0A 3QVBA 1E5KA 4MYBA 1ON6A 4B4MA 1ZCUA 4HO3A 3V91A 5BXCA 1WSZA 1QWJA 2OEGA 1FXJA 1JYLA 1QGQA 1IIMA 1V83A 4KXOA 2RJ6A 2Y7AA 3CU0A 3V0LA 1GA8A 5C8RA 1FXOA 1NF5B 1ZDGA 1FRWA 3SX8A 1MP3A 4KQLA 1FZWA 1HM8A 1Z90A 4Y7VA 3OH3A 2JCJA 3SXAA 2BO6A 4B2WA 4ASJA 3I0LA 4HO6A 1JV1A 5C4FA 2Y6PA 2Y4KA 3BCVA 3SXDA 1H5SB 1O0RA 4NANA 1R82A 5AJOA 2JCLA 4B42A 2X5SA 3CKQA 4KPZA 4D11C 1YP4A 1HV9A 3FWWA 1QG8A 3SXGA 2RJ4A 1YP3A 5CMJA 3NGWA 3U2WA 5IDSA 1H7QA 3K8EA 3SPTA 1R81A 5C3AA 1VGUA 2OI5A 2YESA 2VSHA 4EE4A 1MP5A 2FYAA 1ZI4A 2WVMA 2YQHA 3V8ZA 2QKXA 3CKVA 1FGXA 4FRHA 5EJZA 3ZLLA 1SS9A 2O1FA 2VXMA 4G3QA 3IOJA 3Q7UA 3U2TA 4CJBA 3PKPA 3EE5A 3Q4SA 3OAMA 2OI6A 4FCUA 2AM4A 2W0VA 4B4BA 4D11A 4DECA 2VD4A 2XWLA 3OC9A 5J49A 5C4BA 3DK5A 1NMMB 1H4CA 2BO4A 4FCEA 5CMIA 4D0TA 2BO7A 4ZDQA 4D0ZA 1H7TA 1XHBA 4FQWA 4MIXA 5CQLX 2NXVA 3R3IA 4HO0A 1INJA 1OQMB 2UX8A 4FROA 2RJ1A 1VICA 3JTJA 2C0NA 3USQA 4Y7FA 4EEMA 1G9RA 3ZGGA 4Y7UA 2OI7A 1VZXA 4JD0A 4MNDA 1ZCVA 1HM0A 2I5KA 4HO9A 3ZF8A 1GWWA 1WT1A 2V0LA 3OKRA 4Y62A 4B5BA 2AGDA 4KC4A 4HO2A 3D5NA 4P00A 2AE7A 1MP4A 5AJPA 3T7OA 2FFUA 2YC5A 4ARWA 1NQIB 1V82A 2Z87A 2Y4MA 3I0GA 3F1CA 5DDVA 4FRLA 3IOIA 5C36A 2GGOA 1ZIZA 5FTVA 5C3DA 5EJ1A 2AM3A 3I0KA 5DDTA 1VH1A 2ICXA 2VFZA 5CQOA 4ASYA 5C1GA 2XWNA 1IINA 1LL3A 1MC3A 1WT2A 4YS8A 2AESA 1VM8A 3T7MA 3OH4A 1FGGA 1G97A 1YP2A 4R7PA 3DJ4A 4Y63A 2O1HA 2PGYA 5EIYA 1GWVA 1WT3A 4L41C 3RSBA 4Y7GA 4BMAA 5CQNX 1GX4A 3V0PA 3U2UA 3I0HA 3Q80A 2ZU7A 1H5TA 5C3BA 5I1FA 3N9WA 3V0NA 3PNNA 3D98A 1NHEB 4DE7A 2WGZA 2AECA 4IRPA 1FWYA 2FYDB 1JV3A 4Y64A 2FY7A 1O7OA 4HO8A 1OMZA 2YCMA 1ZDFA 2V0JA 2Z86A 5D91A 5FUHA 4B2XA 4Y9XA 1H5SC 2A8WA 1PZYB 1ZCTA 2ZU9A 1FO8A 1ZJ0A 1VPAA 1LL0A 3KIAA 4FIXA 4M28A 3O3PA 4KNRA 2XWMA 2I7BA 2OEFA 3SXEA 5AJNA 2RIYA 2VSIA 4DDZA 4G87A 1G8OA 5C47A 2VK9A 4KNXA 1S4OA 1GQ9A 3E26A 1LZ7A 1W55A 4O6NA 2J0BA 4IRQA 1G1LA 1VZTA 1FO9A 2J0AA 1H7LA 3V0QA
chains in the Genus database with same CATH topology
2YQCA 4FRQA 4AYLA 2V0KA 4K6RA 1HM9A 1H7EA 1O23B 1H5SA 3OH1A 3U2VA 1O7QA 4JISA 1VGZA 1H5RB 3U2XA 3SX7A 5FU8A 5C48A 4B3UA 1S4NA 2RJ8A 2X5ZA 2YQJA 3IOHA 2P6WA 3SX5A 1LZIA 2GGQA 1I52A 1LZJA 4FRDA 2JCKA 3BRKX 1ZJ3A 4AYJA 4FRPA 4Y7TA 1G95A 1V84A 5CMHA 2QGIA 1HJLA 1VGWA 1QGSA 2P73A 4EE3A 4KC2A 2X65A 3I0FA 1R7XA 2MZBA 3T7NA 4NAKA 1NWGB 2E3DA 3I0JA 5C4EA 1ZCYA 2WAWA 3I0DA 2CU2A 4AAWA 3CKOA 3I0CA 3POLA 1R7YA 5C4CA 1JYKA 1FR8A 4KT7A 3LW6A 1KWSA 3V0MA 3JUJA 1ZJOA 4HO4A 2PA4A 5CMGX 2D0JA 2PX7A 4J18A 1FR9A 2VS4A 4EEGA 4HCQA 4LW6A 2X60A 3SX3A 2O1GA 2BO8A 2PGVA 2YC3A 3V0OA 4EEOA 5FYEA 4BQHA 1VGTA 2RJ0A 2WE9A 2XMHA 1TW5A 3SXBA 4EEAA 3GUEA 4AC3A 2VXLA 2A8UA 2I5EA 1XZ6A 2RITA 2ZU8A 5IDTA 4M4KA 4Q7CA 2RJ5A 5D92A 2ICYA 2XMEA 4UEGA 4NAIA 4FIYA 2YQSA 5CMFX 3TZTA 5FV9A 1G2VA 3R2WA 3I0IX 1H3MA 1ZI5A 1K4VA 1W57A 4M2BA 1S4PA 1PZTA 2Y4LA 5C1HA 1ON8A 4KRVA 4D48A 4FRMA 2WVKA 1JVGA 1G0RA 4KC1A 4CJ8A 4G3SA 1ZI3A 3U0YA 1R80A 4E1KA 3V90A 1ZHJA 1EZIA 1TW1A 3V8YA 2D7RA 1LL2A 4EVWA 1R7UA 3U0XA 3JUKA 1H7GA 1WT0A 1OMXA 4Y6UA 1ZJ1A 4FREA 5L6VA 5FU0A 3OGZA 1H7FA 1INIA 4HOCA 4FRAA 1TVYA 3CGXA 1JVDA 2D7IA 3OH2A 1YROB 2DPWA 2FYBA 4HG6A 2AH9A 4HO5A 5C4DA 4LW3A 3RMVA 1H5SD 1GQCA 2JCOA 3OH0A 3K8DA 1ZI1A 2AM5A 1ZJPA 4P02A 4GBPA 1NKHB 1H4DA 5IFYA 4XWIA 2RIXA 4O6MA 5FTSA 3CKJA 2QH5A 3ST8A 2VS3A 1H4EA 2Y4JA 1GX0A 1WVCA 2P72A 3I0EA 3HL3A 3F1YA 3SXCA 5CQMX 2FYCB 5C49A 4ECMA 1G93A 2W0WA 4C2SA 5C38A 2RJ9A 2WVLA 2FFVA 4NALA 3FOQA 1TZFA 2APCA 1FOAA 1R7VA 1VZUA 5JQQA 3ZGFA 4CVHA 3D8VA 2E8BA 3CKNA 3E25A 4Y6NA 4KPXA 2WEEA 1R7TA 3RMWA 4M2AA 3USRA 1H5TB 2RJ7A 2V0HA 1LVWA 4G3PA 2VS5A 4FRBA 5HS2A 2V0IA 1FG5N 1HJJA 2Q4JA 1G3LA 5CQPA 2RIZA 1VH3A 4CJCA 3ZLKA 4B4GA 5L6SA 1H5RA 1H7HA 3PKQA 1ZJ2A 1EYRA 3DUVA 1G23A 1W77A 3TQDA 4EE5A 5C1LA 1LZ0A 3QVBA 1E5KA 4MYBA 1ON6A 4B4MA 1ZCUA 4HO3A 3V91A 5BXCA 1WSZA 1QWJA 2OEGA 1FXJA 1JYLA 1QGQA 1IIMA 1V83A 4KXOA 2RJ6A 2Y7AA 3CU0A 3V0LA 1GA8A 5C8RA 1FXOA 1NF5B 1ZDGA 1FRWA 3SX8A 1MP3A 4KQLA 1FZWA 1HM8A 1Z90A 4Y7VA 3OH3A 2JCJA 3SXAA 2BO6A 4B2WA 4ASJA 3I0LA 4HO6A 1JV1A 5C4FA 2Y6PA 2Y4KA 3BCVA 3SXDA 1H5SB 1O0RA 4NANA 1R82A 5AJOA 2JCLA 4B42A 2X5SA 3CKQA 4KPZA 4D11C 1YP4A 1HV9A 3FWWA 1QG8A 3SXGA 2RJ4A 1YP3A 5CMJA 3NGWA 3U2WA 5IDSA 1H7QA 3K8EA 3SPTA 1R81A 5C3AA 1VGUA 2OI5A 2YESA 2VSHA 4EE4A 1MP5A 2FYAA 1ZI4A 2WVMA 2YQHA 3V8ZA 2QKXA 3CKVA 1FGXA 4FRHA 5EJZA 3ZLLA 1SS9A 2O1FA 2VXMA 4G3QA 3IOJA 3Q7UA 3U2TA 4CJBA 3PKPA 3EE5A 3Q4SA 3OAMA 2OI6A 4FCUA 2AM4A 2W0VA 4B4BA 4D11A 4DECA 2VD4A 2XWLA 3OC9A 5J49A 5C4BA 3DK5A 1NMMB 1H4CA 2BO4A 4FCEA 5CMIA 4D0TA 2BO7A 4ZDQA 4D0ZA 1H7TA 1XHBA 4FQWA 4MIXA 5CQLX 2NXVA 3R3IA 4HO0A 1INJA 1OQMB 2UX8A 4FROA 2RJ1A 1VICA 3JTJA 2C0NA 3USQA 4Y7FA 4EEMA 1G9RA 3ZGGA 4Y7UA 2OI7A 1VZXA 4JD0A 4MNDA 1ZCVA 1HM0A 2I5KA 4HO9A 3ZF8A 1GWWA 1WT1A 2V0LA 3OKRA 4Y62A 4B5BA 2AGDA 4KC4A 4HO2A 3D5NA 4P00A 2AE7A 1MP4A 5AJPA 3T7OA 2FFUA 2YC5A 4ARWA 1NQIB 1V82A 2Z87A 2Y4MA 3I0GA 3F1CA 5DDVA 4FRLA 3IOIA 5C36A 2GGOA 1ZIZA 5FTVA 5C3DA 5EJ1A 2AM3A 3I0KA 5DDTA 1VH1A 2ICXA 2VFZA 5CQOA 4ASYA 5C1GA 2XWNA 1IINA 1LL3A 1MC3A 1WT2A 4YS8A 2AESA 1VM8A 3T7MA 3OH4A 1FGGA 1G97A 1YP2A 4R7PA 3DJ4A 4Y63A 2O1HA 2PGYA 5EIYA 1GWVA 1WT3A 4L41C 3RSBA 4Y7GA 4BMAA 5CQNX 1GX4A 3V0PA 3U2UA 3I0HA 3Q80A 2ZU7A 1H5TA 5C3BA 5I1FA 3N9WA 3V0NA 3PNNA 3D98A 1NHEB 4DE7A 2WGZA 2AECA 4IRPA 1FWYA 2FYDB 1JV3A 4Y64A 2FY7A 1O7OA 4HO8A 1OMZA 2YCMA 1ZDFA 2V0JA 2Z86A 5D91A 5FUHA 4B2XA 4Y9XA 1H5SC 2A8WA 1PZYB 1ZCTA 2ZU9A 1FO8A 1ZJ0A 1VPAA 1LL0A 3KIAA 4FIXA 4M28A 3O3PA 4KNRA 2XWMA 2I7BA 2OEFA 3SXEA 5AJNA 2RIYA 2VSIA 4DDZA 4G87A 1G8OA 5C47A 2VK9A 4KNXA 1S4OA 1GQ9A 3E26A 1LZ7A 1W55A 4O6NA 2J0BA 4IRQA 1G1LA 1VZTA 1FO9A 2J0AA 1H7LA 3V0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQC A;  4FRQ A;  4AYL A;  2V0K A;  4K6R A;  1HM9 A;  1H7E A;  1O23 B;  1H5S A;  3OH1 A;  3U2V A;  1O7Q A;  4JIS A;  1VGZ A;  1H5R B;  3U2X A;  3SX7 A;  5FU8 A;  5C48 A;  4B3U A;  1S4N A;  2RJ8 A;  2X5Z A;  2YQJ A;  3IOH A;  2P6W A;  3SX5 A;  1LZI A;  2GGQ A;  1I52 A;  1LZJ A;  4FRD A;  2JCK A;  3BRK X;  1ZJ3 A;  4AYJ A;  4FRP A;  4Y7T A;  1G95 A;  1V84 A;  5CMH A;  2QGI A;  1HJL A;  1VGW A;  1QGS A;  2P73 A;  4EE3 A;  4KC2 A;  2X65 A;  3I0F A;  1R7X A;  2MZB A;  3T7N A;  4NAK A;  1NWG B;  2E3D A;  3I0J A;  5C4E A;  1ZCY A;  2WAW A;  3I0D A;  2CU2 A;  4AAW A;  3CKO A;  3I0C A;  3POL A;  1R7Y A;  5C4C A;  1JYK A;  1FR8 A;  4KT7 A;  3LW6 A;  1KWS A;  3V0M A;  3JUJ A;  1ZJO A;  4HO4 A;  2PA4 A;  5CMG X;  2D0J A;  2PX7 A;  4J18 A;  1FR9 A;  2VS4 A;  4EEG A;  4HCQ A;  4LW6 A;  2X60 A;  3SX3 A;  2O1G A;  2BO8 A;  2PGV A;  2YC3 A;  3V0O A;  4EEO A;  5FYE A;  4BQH A;  1VGT A;  2RJ0 A;  2WE9 A;  2XMH A;  1TW5 A;  3SXB A;  4EEA A;  3GUE A;  4AC3 A;  2VXL A;  2A8U A;  2I5E A;  1XZ6 A;  2RIT A;  2ZU8 A;  5IDT A;  4M4K A;  2RJ5 A;  2ICY A;  2XME A;  4UEG A;  4NAI A;  2YQS A;  5CMF X;  3TZT A;  5FV9 A;  1G2V A;  3R2W A;  3I0I X;  1H3M A;  1ZI5 A;  1K4V A;  1W57 A;  4M2B A;  1S4P A;  1PZT A;  2Y4L A;  5C1H A;  1ON8 A;  4KRV A;  4D48 A;  4FRM A;  2WVK A;  1JVG A;  1G0R A;  4KC1 A;  4CJ8 A;  4G3S A;  1ZI3 A;  3U0Y A;  1R80 A;  4E1K A;  3V90 A;  1ZHJ A;  1EZI A;  1TW1 A;  3V8Y A;  2D7R A;  1LL2 A;  4EVW A;  1R7U A;  3U0X A;  3JUK A;  1H7G A;  1WT0 A;  1OMX A;  4Y6U A;  1ZJ1 A;  4FRE A;  5L6V A;  5FU0 A;  3OGZ A;  1H7F A;  1INI A;  4HOC A;  4FRA A;  1TVY A;  3CGX A;  1JVD A;  2D7I A;  3OH2 A;  1YRO B;  2DPW A;  2FYB A;  4HG6 A;  2AH9 A;  4HO5 A;  5C4D A;  4LW3 A;  3RMV A;  1H5S D;  1GQC A;  2JCO A;  3OH0 A;  3K8D A;  1ZI1 A;  2AM5 A;  1ZJP A;  4P02 A;  4GBP A;  1NKH B;  1H4D A;  5IFY A;  4XWI A;  2RIX A;  5FTS A;  3CKJ A;  2QH5 A;  3ST8 A;  2VS3 A;  1H4E A;  2Y4J A;  1GX0 A;  1WVC A;  2P72 A;  3I0E A;  3HL3 A;  3F1Y A;  3SXC A;  5CQM X;  2FYC B;  5C49 A;  4ECM A;  1G93 A;  2W0W A;  4C2S A;  5C38 A;  2RJ9 A;  2WVL A;  2FFV A;  4NAL A;  3FOQ A;  1TZF A;  2APC A;  1FOA A;  1R7V A;  1VZU A;  5JQQ A;  3ZGF A;  4CVH A;  3D8V A;  2E8B A;  3CKN A;  3E25 A;  4Y6N A;  4KPX A;  2WEE A;  1R7T A;  3RMW A;  4M2A A;  3USR A;  1H5T B;  2RJ7 A;  2V0H A;  1LVW A;  4G3P A;  2VS5 A;  4FRB A;  5HS2 A;  2V0I A;  1FG5 N;  1HJJ A;  2Q4J A;  1G3L A;  5CQP A;  2RIZ A;  1VH3 A;  4CJC A;  3ZLK A;  4B4G A;  5L6S A;  1H5R A;  1H7H A;  3PKQ A;  1ZJ2 A;  1EYR A;  3DUV A;  1G23 A;  1W77 A;  3TQD A;  4EE5 A;  5C1L A;  1LZ0 A;  3QVB A;  1E5K A;  4MYB A;  1ON6 A;  4B4M A;  1ZCU A;  4HO3 A;  3V91 A;  5BXC A;  1WSZ A;  1QWJ A;  2OEG A;  1FXJ A;  1JYL A;  1QGQ A;  1IIM A;  1V83 A;  4KXO A;  2RJ6 A;  2Y7A A;  3CU0 A;  3V0L A;  1GA8 A;  5C8R A;  1FXO A;  1NF5 B;  1ZDG A;  1FRW A;  3SX8 A;  1MP3 A;  4KQL A;  1FZW A;  1HM8 A;  1Z90 A;  4Y7V A;  3OH3 A;  2JCJ A;  3SXA A;  2BO6 A;  4B2W A;  4ASJ A;  3I0L A;  4HO6 A;  1JV1 A;  5C4F A;  2Y6P A;  2Y4K A;  3BCV A;  3SXD A;  1H5S B;  1O0R A;  4NAN A;  1R82 A;  5AJO A;  2JCL A;  4B42 A;  2X5S A;  3CKQ A;  4KPZ A;  4D11 C;  1YP4 A;  1HV9 A;  3FWW A;  1QG8 A;  3SXG A;  2RJ4 A;  1YP3 A;  5CMJ A;  3NGW A;  3U2W A;  5IDS A;  1H7Q A;  3K8E A;  3SPT A;  1R81 A;  5C3A A;  1VGU A;  2OI5 A;  2YES A;  2VSH A;  4EE4 A;  1MP5 A;  2FYA A;  1ZI4 A;  2WVM A;  2YQH A;  3V8Z A;  2QKX A;  3CKV A;  1FGX A;  4FRH A;  5EJZ A;  3ZLL A;  1SS9 A;  2O1F A;  2VXM A;  4G3Q A;  3IOJ A;  3Q7U A;  3U2T A;  4CJB A;  3PKP A;  3EE5 A;  3Q4S A;  3OAM A;  2OI6 A;  4FCU A;  2AM4 A;  2W0V A;  4B4B A;  4D11 A;  4DEC A;  2VD4 A;  2XWL A;  3OC9 A;  5J49 A;  5C4B A;  3DK5 A;  1NMM B;  1H4C A;  2BO4 A;  4FCE A;  5CMI A;  4D0T A;  2BO7 A;  4ZDQ A;  4D0Z A;  1H7T A;  1XHB A;  4FQW A;  5CQL X;  2NXV A;  3R3I A;  4HO0 A;  1INJ A;  1OQM B;  2UX8 A;  4FRO A;  2RJ1 A;  1VIC A;  3JTJ A;  3USQ A;  4Y7F A;  4EEM A;  1G9R A;  3ZGG A;  4Y7U A;  2OI7 A;  1VZX A;  4JD0 A;  4MND A;  1ZCV A;  1HM0 A;  2I5K A;  4HO9 A;  3ZF8 A;  1GWW A;  1WT1 A;  2V0L A;  3OKR A;  4Y62 A;  4B5B A;  2AGD A;  4KC4 A;  4HO2 A;  3D5N A;  4P00 A;  2AE7 A;  1MP4 A;  5AJP A;  3T7O A;  2FFU A;  2YC5 A;  4ARW A;  1NQI B;  1V82 A;  2Z87 A;  2Y4M A;  3I0G A;  3F1C A;  5DDV A;  4FRL A;  3IOI A;  5C36 A;  2GGO A;  1ZIZ A;  5FTV A;  5C3D A;  5EJ1 A;  2AM3 A;  3I0K A;  5DDT A;  1VH1 A;  2ICX A;  2VFZ A;  5CQO A;  4ASY A;  5C1G A;  2XWN A;  1IIN A;  1LL3 A;  1MC3 A;  1WT2 A;  4YS8 A;  2AES A;  1VM8 A;  3T7M A;  3OH4 A;  1FGG A;  1G97 A;  1YP2 A;  4R7P A;  3DJ4 A;  4Y63 A;  2O1H A;  2PGY A;  5EIY A;  1GWV A;  1WT3 A;  4L41 C;  3RSB A;  4Y7G A;  4BMA A;  5CQN X;  1GX4 A;  3V0P A;  3U2U A;  3I0H A;  3Q80 A;  2ZU7 A;  1H5T A;  5C3B A;  5I1F A;  3N9W A;  3V0N A;  3PNN A;  3D98 A;  1NHE B;  4DE7 A;  2WGZ A;  2AEC A;  4IRP A;  1FWY A;  2FYD B;  1JV3 A;  4Y64 A;  2FY7 A;  1O7O A;  4HO8 A;  1OMZ A;  2YCM A;  1ZDF A;  2V0J A;  2Z86 A;  5FUH A;  4B2X A;  4Y9X A;  1H5S C;  2A8W A;  1PZY B;  1ZCT A;  2ZU9 A;  1FO8 A;  1ZJ0 A;  1VPA A;  1LL0 A;  3KIA A;  4M28 A;  3O3P A;  4KNR A;  2XWM A;  2I7B A;  2OEF A;  3SXE A;  5AJN A;  2RIY A;  2VSI A;  4DDZ A;  4G87 A;  1G8O A;  5C47 A;  4KNX A;  1S4O A;  1GQ9 A;  3E26 A;  1LZ7 A;  1W55 A;  4IRQ A;  1G1L A;  1VZT A;  1FO9 A;  1H7L A;  3V0Q A; 
#chains in the Genus database with same CATH topology
 2YQC A;  4FRQ A;  4AYL A;  2V0K A;  4K6R A;  1HM9 A;  1H7E A;  1O23 B;  1H5S A;  3OH1 A;  3U2V A;  1O7Q A;  4JIS A;  1VGZ A;  1H5R B;  3U2X A;  3SX7 A;  5FU8 A;  5C48 A;  4B3U A;  1S4N A;  2RJ8 A;  2X5Z A;  2YQJ A;  3IOH A;  2P6W A;  3SX5 A;  1LZI A;  2GGQ A;  1I52 A;  1LZJ A;  4FRD A;  2JCK A;  3BRK X;  1ZJ3 A;  4AYJ A;  4FRP A;  4Y7T A;  1G95 A;  1V84 A;  5CMH A;  2QGI A;  1HJL A;  1VGW A;  1QGS A;  2P73 A;  4EE3 A;  4KC2 A;  2X65 A;  3I0F A;  1R7X A;  2MZB A;  3T7N A;  4NAK A;  1NWG B;  2E3D A;  3I0J A;  5C4E A;  1ZCY A;  2WAW A;  3I0D A;  2CU2 A;  4AAW A;  3CKO A;  3I0C A;  3POL A;  1R7Y A;  5C4C A;  1JYK A;  1FR8 A;  4KT7 A;  3LW6 A;  1KWS A;  3V0M A;  3JUJ A;  1ZJO A;  4HO4 A;  2PA4 A;  5CMG X;  2D0J A;  2PX7 A;  4J18 A;  1FR9 A;  2VS4 A;  4EEG A;  4HCQ A;  4LW6 A;  2X60 A;  3SX3 A;  2O1G A;  2BO8 A;  2PGV A;  2YC3 A;  3V0O A;  4EEO A;  5FYE A;  4BQH A;  1VGT A;  2RJ0 A;  2WE9 A;  2XMH A;  1TW5 A;  3SXB A;  4EEA A;  3GUE A;  4AC3 A;  2VXL A;  2A8U A;  2I5E A;  1XZ6 A;  2RIT A;  2ZU8 A;  5IDT A;  4M4K A;  4Q7C A;  2RJ5 A;  5D92 A;  2ICY A;  2XME A;  4UEG A;  4NAI A;  4FIY A;  2YQS A;  5CMF X;  3TZT A;  5FV9 A;  1G2V A;  3R2W A;  3I0I X;  1H3M A;  1ZI5 A;  1K4V A;  1W57 A;  4M2B A;  1S4P A;  1PZT A;  2Y4L A;  5C1H A;  1ON8 A;  4KRV A;  4D48 A;  4FRM A;  2WVK A;  1JVG A;  1G0R A;  4KC1 A;  4CJ8 A;  4G3S A;  1ZI3 A;  3U0Y A;  1R80 A;  4E1K A;  3V90 A;  1ZHJ A;  1EZI A;  1TW1 A;  3V8Y A;  2D7R A;  1LL2 A;  4EVW A;  1R7U A;  3U0X A;  3JUK A;  1H7G A;  1WT0 A;  1OMX A;  4Y6U A;  1ZJ1 A;  4FRE A;  5L6V A;  5FU0 A;  3OGZ A;  1H7F A;  1INI A;  4HOC A;  4FRA A;  1TVY A;  3CGX A;  1JVD A;  2D7I A;  3OH2 A;  1YRO B;  2DPW A;  2FYB A;  4HG6 A;  2AH9 A;  4HO5 A;  5C4D A;  4LW3 A;  3RMV A;  1H5S D;  1GQC A;  2JCO A;  3OH0 A;  3K8D A;  1ZI1 A;  2AM5 A;  1ZJP A;  4P02 A;  4GBP A;  1NKH B;  1H4D A;  5IFY A;  4XWI A;  2RIX A;  4O6M A;  5FTS A;  3CKJ A;  2QH5 A;  3ST8 A;  2VS3 A;  1H4E A;  2Y4J A;  1GX0 A;  1WVC A;  2P72 A;  3I0E A;  3HL3 A;  3F1Y A;  3SXC A;  5CQM X;  2FYC B;  5C49 A;  4ECM A;  1G93 A;  2W0W A;  4C2S A;  5C38 A;  2RJ9 A;  2WVL A;  2FFV A;  4NAL A;  3FOQ A;  1TZF A;  2APC A;  1FOA A;  1R7V A;  1VZU A;  5JQQ A;  3ZGF A;  4CVH A;  3D8V A;  2E8B A;  3CKN A;  3E25 A;  4Y6N A;  4KPX A;  2WEE A;  1R7T A;  3RMW A;  4M2A A;  3USR A;  1H5T B;  2RJ7 A;  2V0H A;  1LVW A;  4G3P A;  2VS5 A;  4FRB A;  5HS2 A;  2V0I A;  1FG5 N;  1HJJ A;  2Q4J A;  1G3L A;  5CQP A;  2RIZ A;  1VH3 A;  4CJC A;  3ZLK A;  4B4G A;  5L6S A;  1H5R A;  1H7H A;  3PKQ A;  1ZJ2 A;  1EYR A;  3DUV A;  1G23 A;  1W77 A;  3TQD A;  4EE5 A;  5C1L A;  1LZ0 A;  3QVB A;  1E5K A;  4MYB A;  1ON6 A;  4B4M A;  1ZCU A;  4HO3 A;  3V91 A;  5BXC A;  1WSZ A;  1QWJ A;  2OEG A;  1FXJ A;  1JYL A;  1QGQ A;  1IIM A;  1V83 A;  4KXO A;  2RJ6 A;  2Y7A A;  3CU0 A;  3V0L A;  1GA8 A;  5C8R A;  1FXO A;  1NF5 B;  1ZDG A;  1FRW A;  3SX8 A;  1MP3 A;  4KQL A;  1FZW A;  1HM8 A;  1Z90 A;  4Y7V A;  3OH3 A;  2JCJ A;  3SXA A;  2BO6 A;  4B2W A;  4ASJ A;  3I0L A;  4HO6 A;  1JV1 A;  5C4F A;  2Y6P A;  2Y4K A;  3BCV A;  3SXD A;  1H5S B;  1O0R A;  4NAN A;  1R82 A;  5AJO A;  2JCL A;  4B42 A;  2X5S A;  3CKQ A;  4KPZ A;  4D11 C;  1YP4 A;  1HV9 A;  3FWW A;  1QG8 A;  3SXG A;  2RJ4 A;  1YP3 A;  5CMJ A;  3NGW A;  3U2W A;  5IDS A;  1H7Q A;  3K8E A;  3SPT A;  1R81 A;  5C3A A;  1VGU A;  2OI5 A;  2YES A;  2VSH A;  4EE4 A;  1MP5 A;  2FYA A;  1ZI4 A;  2WVM A;  2YQH A;  3V8Z A;  2QKX A;  3CKV A;  1FGX A;  4FRH A;  5EJZ A;  3ZLL A;  1SS9 A;  2O1F A;  2VXM A;  4G3Q A;  3IOJ A;  3Q7U A;  3U2T A;  4CJB A;  3PKP A;  3EE5 A;  3Q4S A;  3OAM A;  2OI6 A;  4FCU A;  2AM4 A;  2W0V A;  4B4B A;  4D11 A;  4DEC A;  2VD4 A;  2XWL A;  3OC9 A;  5J49 A;  5C4B A;  3DK5 A;  1NMM B;  1H4C A;  2BO4 A;  4FCE A;  5CMI A;  4D0T A;  2BO7 A;  4ZDQ A;  4D0Z A;  1H7T A;  1XHB A;  4FQW A;  4MIX A;  5CQL X;  2NXV A;  3R3I A;  4HO0 A;  1INJ A;  1OQM B;  2UX8 A;  4FRO A;  2RJ1 A;  1VIC A;  3JTJ A;  2C0N A;  3USQ A;  4Y7F A;  4EEM A;  1G9R A;  3ZGG A;  4Y7U A;  2OI7 A;  1VZX A;  4JD0 A;  4MND A;  1ZCV A;  1HM0 A;  2I5K A;  4HO9 A;  3ZF8 A;  1GWW A;  1WT1 A;  2V0L A;  3OKR A;  4Y62 A;  4B5B A;  2AGD A;  4KC4 A;  4HO2 A;  3D5N A;  4P00 A;  2AE7 A;  1MP4 A;  5AJP A;  3T7O A;  2FFU A;  2YC5 A;  4ARW A;  1NQI B;  1V82 A;  2Z87 A;  2Y4M A;  3I0G A;  3F1C A;  5DDV A;  4FRL A;  3IOI A;  5C36 A;  2GGO A;  1ZIZ A;  5FTV A;  5C3D A;  5EJ1 A;  2AM3 A;  3I0K A;  5DDT A;  1VH1 A;  2ICX A;  2VFZ A;  5CQO A;  4ASY A;  5C1G A;  2XWN A;  1IIN A;  1LL3 A;  1MC3 A;  1WT2 A;  4YS8 A;  2AES A;  1VM8 A;  3T7M A;  3OH4 A;  1FGG A;  1G97 A;  1YP2 A;  4R7P A;  3DJ4 A;  4Y63 A;  2O1H A;  2PGY A;  5EIY A;  1GWV A;  1WT3 A;  4L41 C;  3RSB A;  4Y7G A;  4BMA A;  5CQN X;  1GX4 A;  3V0P A;  3U2U A;  3I0H A;  3Q80 A;  2ZU7 A;  1H5T A;  5C3B A;  5I1F A;  3N9W A;  3V0N A;  3PNN A;  3D98 A;  1NHE B;  4DE7 A;  2WGZ A;  2AEC A;  4IRP A;  1FWY A;  2FYD B;  1JV3 A;  4Y64 A;  2FY7 A;  1O7O A;  4HO8 A;  1OMZ A;  2YCM A;  1ZDF A;  2V0J A;  2Z86 A;  5D91 A;  5FUH A;  4B2X A;  4Y9X A;  1H5S C;  2A8W A;  1PZY B;  1ZCT A;  2ZU9 A;  1FO8 A;  1ZJ0 A;  1VPA A;  1LL0 A;  3KIA A;  4FIX A;  4M28 A;  3O3P A;  4KNR A;  2XWM A;  2I7B A;  2OEF A;  3SXE A;  5AJN A;  2RIY A;  2VSI A;  4DDZ A;  4G87 A;  1G8O A;  5C47 A;  2VK9 A;  4KNX A;  1S4O A;  1GQ9 A;  3E26 A;  1LZ7 A;  1W55 A;  4O6N A;  2J0B A;  4IRQ A;  1G1L A;  1VZT A;  1FO9 A;  2J0A A;  1H7L A;  3V0Q A; 
#chains in the Genus database with same CATH homology
 2YQC A;  4FRQ A;  4AYL A;  2V0K A;  4K6R A;  1HM9 A;  1H7E A;  1O23 B;  1H5S A;  3OH1 A;  3U2V A;  1O7Q A;  4JIS A;  1VGZ A;  1H5R B;  3U2X A;  3SX7 A;  5FU8 A;  5C48 A;  4B3U A;  1S4N A;  2RJ8 A;  2X5Z A;  2YQJ A;  3IOH A;  2P6W A;  3SX5 A;  1LZI A;  2GGQ A;  1I52 A;  1LZJ A;  4FRD A;  2JCK A;  3BRK X;  1ZJ3 A;  4AYJ A;  4FRP A;  4Y7T A;  1G95 A;  1V84 A;  5CMH A;  2QGI A;  1HJL A;  1VGW A;  1QGS A;  2P73 A;  4EE3 A;  4KC2 A;  2X65 A;  3I0F A;  1R7X A;  2MZB A;  3T7N A;  4NAK A;  1NWG B;  2E3D A;  3I0J A;  5C4E A;  1ZCY A;  2WAW A;  3I0D A;  2CU2 A;  4AAW A;  3CKO A;  3I0C A;  3POL A;  1R7Y A;  5C4C A;  1JYK A;  1FR8 A;  4KT7 A;  3LW6 A;  1KWS A;  3V0M A;  3JUJ A;  1ZJO A;  4HO4 A;  2PA4 A;  5CMG X;  2D0J A;  2PX7 A;  4J18 A;  1FR9 A;  2VS4 A;  4EEG A;  4HCQ A;  4LW6 A;  2X60 A;  3SX3 A;  2O1G A;  2BO8 A;  2PGV A;  2YC3 A;  3V0O A;  4EEO A;  5FYE A;  4BQH A;  1VGT A;  2RJ0 A;  2WE9 A;  2XMH A;  1TW5 A;  3SXB A;  4EEA A;  3GUE A;  4AC3 A;  2VXL A;  2A8U A;  2I5E A;  1XZ6 A;  2RIT A;  2ZU8 A;  5IDT A;  4M4K A;  4Q7C A;  2RJ5 A;  5D92 A;  2ICY A;  2XME A;  4UEG A;  4NAI A;  4FIY A;  2YQS A;  5CMF X;  3TZT A;  5FV9 A;  1G2V A;  3R2W A;  3I0I X;  1H3M A;  1ZI5 A;  1K4V A;  1W57 A;  4M2B A;  1S4P A;  1PZT A;  2Y4L A;  5C1H A;  1ON8 A;  4KRV A;  4D48 A;  4FRM A;  2WVK A;  1JVG A;  1G0R A;  4KC1 A;  4CJ8 A;  4G3S A;  1ZI3 A;  3U0Y A;  1R80 A;  4E1K A;  3V90 A;  1ZHJ A;  1EZI A;  1TW1 A;  3V8Y A;  2D7R A;  1LL2 A;  4EVW A;  1R7U A;  3U0X A;  3JUK A;  1H7G A;  1WT0 A;  1OMX A;  4Y6U A;  1ZJ1 A;  4FRE A;  5L6V A;  5FU0 A;  3OGZ A;  1H7F A;  1INI A;  4HOC A;  4FRA A;  1TVY A;  3CGX A;  1JVD A;  2D7I A;  3OH2 A;  1YRO B;  2DPW A;  2FYB A;  4HG6 A;  2AH9 A;  4HO5 A;  5C4D A;  4LW3 A;  3RMV A;  1H5S D;  1GQC A;  2JCO A;  3OH0 A;  3K8D A;  1ZI1 A;  2AM5 A;  1ZJP A;  4P02 A;  4GBP A;  1NKH B;  1H4D A;  5IFY A;  4XWI A;  2RIX A;  4O6M A;  5FTS A;  3CKJ A;  2QH5 A;  3ST8 A;  2VS3 A;  1H4E A;  2Y4J A;  1GX0 A;  1WVC A;  2P72 A;  3I0E A;  3HL3 A;  3F1Y A;  3SXC A;  5CQM X;  2FYC B;  5C49 A;  4ECM A;  1G93 A;  2W0W A;  4C2S A;  5C38 A;  2RJ9 A;  2WVL A;  2FFV A;  4NAL A;  3FOQ A;  1TZF A;  2APC A;  1FOA A;  1R7V A;  1VZU A;  5JQQ A;  3ZGF A;  4CVH A;  3D8V A;  2E8B A;  3CKN A;  3E25 A;  4Y6N A;  4KPX A;  2WEE A;  1R7T A;  3RMW A;  4M2A A;  3USR A;  1H5T B;  2RJ7 A;  2V0H A;  1LVW A;  4G3P A;  2VS5 A;  4FRB A;  5HS2 A;  2V0I A;  1FG5 N;  1HJJ A;  2Q4J A;  1G3L A;  5CQP A;  2RIZ A;  1VH3 A;  4CJC A;  3ZLK A;  4B4G A;  5L6S A;  1H5R A;  1H7H A;  3PKQ A;  1ZJ2 A;  1EYR A;  3DUV A;  1G23 A;  1W77 A;  3TQD A;  4EE5 A;  5C1L A;  1LZ0 A;  3QVB A;  1E5K A;  4MYB A;  1ON6 A;  4B4M A;  1ZCU A;  4HO3 A;  3V91 A;  5BXC A;  1WSZ A;  1QWJ A;  2OEG A;  1FXJ A;  1JYL A;  1QGQ A;  1IIM A;  1V83 A;  4KXO A;  2RJ6 A;  2Y7A A;  3CU0 A;  3V0L A;  1GA8 A;  5C8R A;  1FXO A;  1NF5 B;  1ZDG A;  1FRW A;  3SX8 A;  1MP3 A;  4KQL A;  1FZW A;  1HM8 A;  1Z90 A;  4Y7V A;  3OH3 A;  2JCJ A;  3SXA A;  2BO6 A;  4B2W A;  4ASJ A;  3I0L A;  4HO6 A;  1JV1 A;  5C4F A;  2Y6P A;  2Y4K A;  3BCV A;  3SXD A;  1H5S B;  1O0R A;  4NAN A;  1R82 A;  5AJO A;  2JCL A;  4B42 A;  2X5S A;  3CKQ A;  4KPZ A;  4D11 C;  1YP4 A;  1HV9 A;  3FWW A;  1QG8 A;  3SXG A;  2RJ4 A;  1YP3 A;  5CMJ A;  3NGW A;  3U2W A;  5IDS A;  1H7Q A;  3K8E A;  3SPT A;  1R81 A;  5C3A A;  1VGU A;  2OI5 A;  2YES A;  2VSH A;  4EE4 A;  1MP5 A;  2FYA A;  1ZI4 A;  2WVM A;  2YQH A;  3V8Z A;  2QKX A;  3CKV A;  1FGX A;  4FRH A;  5EJZ A;  3ZLL A;  1SS9 A;  2O1F A;  2VXM A;  4G3Q A;  3IOJ A;  3Q7U A;  3U2T A;  4CJB A;  3PKP A;  3EE5 A;  3Q4S A;  3OAM A;  2OI6 A;  4FCU A;  2AM4 A;  2W0V A;  4B4B A;  4D11 A;  4DEC A;  2VD4 A;  2XWL A;  3OC9 A;  5J49 A;  5C4B A;  3DK5 A;  1NMM B;  1H4C A;  2BO4 A;  4FCE A;  5CMI A;  4D0T A;  2BO7 A;  4ZDQ A;  4D0Z A;  1H7T A;  1XHB A;  4FQW A;  4MIX A;  5CQL X;  2NXV A;  3R3I A;  4HO0 A;  1INJ A;  1OQM B;  2UX8 A;  4FRO A;  2RJ1 A;  1VIC A;  3JTJ A;  2C0N A;  3USQ A;  4Y7F A;  4EEM A;  1G9R A;  3ZGG A;  4Y7U A;  2OI7 A;  1VZX A;  4JD0 A;  4MND A;  1ZCV A;  1HM0 A;  2I5K A;  4HO9 A;  3ZF8 A;  1GWW A;  1WT1 A;  2V0L A;  3OKR A;  4Y62 A;  4B5B A;  2AGD A;  4KC4 A;  4HO2 A;  3D5N A;  4P00 A;  2AE7 A;  1MP4 A;  5AJP A;  3T7O A;  2FFU A;  2YC5 A;  4ARW A;  1NQI B;  1V82 A;  2Z87 A;  2Y4M A;  3I0G A;  3F1C A;  5DDV A;  4FRL A;  3IOI A;  5C36 A;  2GGO A;  1ZIZ A;  5FTV A;  5C3D A;  5EJ1 A;  2AM3 A;  3I0K A;  5DDT A;  1VH1 A;  2ICX A;  2VFZ A;  5CQO A;  4ASY A;  5C1G A;  2XWN A;  1IIN A;  1LL3 A;  1MC3 A;  1WT2 A;  4YS8 A;  2AES A;  1VM8 A;  3T7M A;  3OH4 A;  1FGG A;  1G97 A;  1YP2 A;  4R7P A;  3DJ4 A;  4Y63 A;  2O1H A;  2PGY A;  5EIY A;  1GWV A;  1WT3 A;  4L41 C;  3RSB A;  4Y7G A;  4BMA A;  5CQN X;  1GX4 A;  3V0P A;  3U2U A;  3I0H A;  3Q80 A;  2ZU7 A;  1H5T A;  5C3B A;  5I1F A;  3N9W A;  3V0N A;  3PNN A;  3D98 A;  1NHE B;  4DE7 A;  2WGZ A;  2AEC A;  4IRP A;  1FWY A;  2FYD B;  1JV3 A;  4Y64 A;  2FY7 A;  1O7O A;  4HO8 A;  1OMZ A;  2YCM A;  1ZDF A;  2V0J A;  2Z86 A;  5D91 A;  5FUH A;  4B2X A;  4Y9X A;  1H5S C;  2A8W A;  1PZY B;  1ZCT A;  2ZU9 A;  1FO8 A;  1ZJ0 A;  1VPA A;  1LL0 A;  3KIA A;  4FIX A;  4M28 A;  3O3P A;  4KNR A;  2XWM A;  2I7B A;  2OEF A;  3SXE A;  5AJN A;  2RIY A;  2VSI A;  4DDZ A;  4G87 A;  1G8O A;  5C47 A;  2VK9 A;  4KNX A;  1S4O A;  1GQ9 A;  3E26 A;  1LZ7 A;  1W55 A;  4O6N A;  2J0B A;  4IRQ A;  1G1L A;  1VZT A;  1FO9 A;  2J0A A;  1H7L A;  3V0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...