1LL2A

Crystal structure of rabbit muscle glycogenin complexed with udp-glucose and manganese
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
255
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRTHPQFLNVWWDIFTTSVVPLLQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGENIN-1
publication title Crystal structure of the autocatalytic initiator of glycogen biosynthesis, glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 84
structure length 255
sequence length 263
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1ll2A00
1H7LA 2VXMA 1H5RA 1S4PA 4Y62A 2FYBA 3R2WA 4Y7FA 1NHEB 4FRMA 4Y64A 5C1HA 3RMWA 1LZIA 2V0KA 4EE4A 3FOQA 1EYRA 3FWWA 4M4KA 1H7QA 4KNXA 1WT1A 3RMVA 1FZWA 2WEEA 2XMHA 2AH9A 2YQJA 5C4FA 2YQHA 3ST8A 4ARWA 4DE7A 4ECMA 2AM5A 1R7XA 1FR9A 3CKQA 4EEOA 3IOIA 1Z90A 2D7IA 2ZU8A 2JCLA 4HO2A 1VZUA 1O7QA 4JD0A 4KPXA 1O7OA 2VFZA 4DDZA 2BO4A 2E8BA 3V90A 5C4BA 3D5NA 3ZF8A 2X65A 3ZLKA 5CMJA 1ZCUA 2RIXA 3I0DA 4Y63A 1FR8A 5CQOA 1FG5N 3CKOA 1NQIB 2WVKA 2XWNA 4HO6A 2W0WA 2ICYA 3RSBA 1VGTA 4GBPA 1PZTA 1H7HA 3T7MA 5C49A 3JUJA 3DK5A 3PKQA 1FO9A 5FV9A 2O1FA 4K6RA 3GUEA 1W77A 3SX5A 1R7TA 5FTSA 4B42A 2VSHA 2WE9A 1G0RA 1E5KA 1VGUA 1ZIZA 3OH0A 3IOJA 3K8DA 4G3QA 2YCMA 1TVYA 2AESA 2O1HA 2FFUA 4FRPA 2I5KA 2BO7A 2RJ5A 2YC3A 2XWLA 1LZ7A 4P02A 2I7BA 2E3DA 4HG6A 4EEGA 4AYLA 1LZJA 5C3BA 1H4CA 4FRLA 4BMAA 1W57A 4HO5A 2Y4KA 2JCKA 4NAIA 4NAKA 1R7UA 2RJ4A 3E26A 3SXCA 4FRAA 4KXOA 2DPWA 3OAMA 1JYLA 1K4VA 1VGWA 1IINA 3SX8A 2V0JA 2VS3A 1G95A 3USRA 2X5ZA 2RIYA 5C36A 2V0IA 3O3PA 1MP5A 4FRQA 4D0ZA 4EVWA 5IDSA 4L41C 2QH5A 1H7TA 2FYDB 3V8YA 4D11A 4G87A 3USQA 2VS5A 2RJ8A 4KC2A 5FYEA 3I0CA 4C2SA 4HO8A 5CMIA 3Q80A 3I0IX 3SXAA 2WAWA 1HM8A 5CMGX 2RJ7A 2X60A 4ASJA 1FXJA 1G97A 4KT7A 1H5SA 4FCEA 5FU0A 5C47A 1IIMA 2AM4A 5JQQA 1YROB 4CJBA 1QWJA 2RITA 3CKNA 1PZYB 1ZHJA 4ASYA 1XZ6A 1VPAA 1VICA 4UEGA 3D98A 5CQPA 2JCOA 3OKRA 4B4GA 1H4DA 1G1LA 3I0HA 5DDVA 1S4NA 5CMFX 3CU0A 1ZI4A 1JYKA 1ZJ3A 1H3MA 5L6VA 3TQDA 1ZJ0A 4P00A 5L6SA 1HV9A 3F1CA 2D7RA 1TZFA 3DUVA 2P6WA 2FYAA 1XHBA 1ZDFA 4FRBA 3U0YA 3CKVA 1QG8A 3V0MA 4EE3A 4AC3A 4LW3A 1GWWA 1GWVA 5CQNX 1V84A 3OGZA 4IRPA 1GQ9A 1OMXA 1WSZA 4Y7TA 3I0KA 3SXGA 4HCQA 4NANA 1VZXA 1I52A 2XMEA 4AYJA 1G2VA 4KPZA 4E1KA 2OI6A 5IDTA 1H5RB 1QGQA 3LW6A 3SX7A 1R7YA 5FU8A 2PGYA 1H5TA 4FRHA 3K8EA 3SPTA 3OH2A 3OH3A 2Y6PA 3OC9A 4KRVA 1WT0A 5I1FA 3BRKX 1ZCVA 5EJZA 3R3IA 1G8OA 1VM8A 4G3SA 1GX4A 2PGVA 1FRWA 2Q4JA 1HM0A 4B4MA 2YESA 4EEAA 2VS4A 2NXVA 2AM3A 1ZJ1A 3NGWA 2WVLA 1G9RA 1H7FA 5C3DA 4B5BA 2XWMA 4FCUA 3F1YA 4B3UA 1R80A 2RJ0A 3CGXA 1GX0A 2Z86A 1V83A 2RJ9A 1WVCA 4FREA 2PX7A 4KQLA 2JCJA 3V0PA 1FOAA 1R82A 1S4OA 4CJ8A 2Y7AA 1MP3A 1ZI1A 4D48A 5CQMX 4Y9XA 2ICXA 1LZ0A 1JV1A 4CVHA 1ZI5A 3SXBA 5IFYA 2WVMA 3KIAA 2AECA 1NKHB 1LVWA 5FTVA 1ZDGA 3I0FA 5EIYA 2YC5A 3SXEA 1VGZA 3Q7UA 4EEMA 2AGDA 3I0GA 4Y7UA 3V0QA 5FUHA 5C1LA 3ZGGA 3PNNA 2BO8A 4YS8A 2CU2A 4NALA 1VH3A 2GGOA 2VD4A 3HL3A 2Y4MA 3D8VA 2OI7A 5HS2A 5AJPA 3SX3A 1LL2A 1W55A 2YQSA 4Y6NA 3T7NA 3POLA 3JTJA 1INJA 1ZCYA 1YP4A 1G93A 1ON8A 4Y7VA 4ZDQA 1OMZA 1ZJ2A 3BCVA 1YP2A 1WT2A 1FGXA 1ON6A 3T7OA 4EE5A 2RIZA 3U0XA 1HJJA 1NF5B 2OEFA 3CKJA 3JUKA 5CQLX 3U2UA 1FO8A 5AJNA 4FROA 1ZI3A 3V0OA 1H4EA 2ZU9A 3N9WA 2AE7A 2P73A 1MC3A 3V0NA 4CJCA 5C4EA 5C38A 2MZBA 3OH1A 5C48A 1H5SB 4M2BA 4M2AA 5AJOA 2PA4A 3SXDA 3U2XA 1GQCA 3V8ZA 3U2TA 3IOHA 2FFVA 3EE5A 1O0RA 4D0TA 4XWIA 2RJ1A 2P72A 2RJ6A 4FQWA 1YP3A 3Q4SA 4HO0A 1WT3A 4FRDA 4Y6UA 4HO3A 4HO4A 1NMMB 1QGSA 3E25A 2FY7A 4D11C 1HM9A 5DDTA 4KNRA 1TW5A 1SS9A 5C1GA 2VSIA 3PKPA 2QGIA 4LW6A 2APCA 1EZIA 1JVGA 3I0EA 2O1GA 4JISA 1OQMB 3ZGFA 2FYCB 1GA8A 2A8WA 1H7EA 1LL0A 1ZJPA 5CMHA 3QVBA 4J18A 1H5SC 3TZTA 4KC4A 2W0VA 4B2WA 5BXCA 2A8UA 1H5TB 1ZJOA 3I0LA 1FGGA 3U2WA 5C4DA 1VZTA 1TW1A 2OI5A 4IRQA 2GGQA 5C3AA 5EJ1A 1INIA 1FXOA 4KC1A 2ZU7A 4BQHA 2Y4LA 2OEGA 1VH1A 3OH4A 2WGZA 1NWGB 1G3LA 2V0LA 4HOCA 2D0JA 3DJ4A 3V0LA 4DECA 1FWYA 1LL3A 1R81A 4MYBA 1HJLA 4AAWA 3I0JA 5J49A 1MP4A 1H7GA 2VXLA 2BO6A 2Z87A 5C4CA 2I5EA 1O23B 2YQCA 1V82A 1JVDA 4B4BA 1H5SD 4G3PA 1R7VA 1KWSA 2UX8A 1ZCTA 1G23A 2Y4JA 4MNDA 2X5SA 4Y7GA 5C8RA 3U2VA 4M28A 3V91A 2QKXA 4B2XA 4HO9A 1JV3A 3ZLLA 2V0HA 4R7PA
chains in the Genus database with same CATH superfamily
1H7LA 2VXMA 1H5RA 1S4PA 4Y62A 2FYBA 3R2WA 4Y7FA 1NHEB 4FRMA 4Y64A 5C1HA 3RMWA 1LZIA 2V0KA 4EE4A 3FOQA 1EYRA 3FWWA 4M4KA 1H7QA 4KNXA 1WT1A 3RMVA 1FZWA 2WEEA 2XMHA 2AH9A 2YQJA 5C4FA 2YQHA 3ST8A 4ARWA 4DE7A 4ECMA 2AM5A 1R7XA 1FR9A 3CKQA 4EEOA 3IOIA 1Z90A 2D7IA 2ZU8A 2JCLA 4HO2A 1VZUA 1O7QA 4JD0A 2J0AA 4KPXA 1O7OA 2VFZA 4DDZA 2BO4A 2E8BA 3V90A 5C4BA 3D5NA 3ZF8A 2X65A 3ZLKA 5CMJA 1ZCUA 2RIXA 3I0DA 4Y63A 1FR8A 5CQOA 1FG5N 3CKOA 1NQIB 2WVKA 2XWNA 4HO6A 2W0WA 2ICYA 3RSBA 1VGTA 4GBPA 1PZTA 1H7HA 4O6MA 3T7MA 5C49A 3JUJA 3DK5A 3PKQA 1FO9A 5FV9A 2O1FA 4K6RA 3GUEA 1W77A 3SX5A 1R7TA 5FTSA 4B42A 2VSHA 2WE9A 1G0RA 1E5KA 1VGUA 1ZIZA 3OH0A 3IOJA 3K8DA 4G3QA 2YCMA 1TVYA 2AESA 2O1HA 2FFUA 4FRPA 2I5KA 2BO7A 2RJ5A 2YC3A 2XWLA 1LZ7A 4P02A 2I7BA 2E3DA 4HG6A 4EEGA 2C0NA 1LZJA 4AYLA 5C3BA 1H4CA 4FRLA 4BMAA 1W57A 4HO5A 2Y4KA 2JCKA 4NAIA 4NAKA 1R7UA 2RJ4A 3E26A 3SXCA 4FRAA 4KXOA 2DPWA 3OAMA 1JYLA 1K4VA 1VGWA 1IINA 3SX8A 2V0JA 2VS3A 1G95A 3USRA 2X5ZA 2RIYA 5C36A 2V0IA 3O3PA 1MP5A 4FRQA 4D0ZA 4EVWA 5IDSA 4L41C 2QH5A 2J0BA 1H7TA 2FYDB 3V8YA 4D11A 4G87A 3USQA 2VS5A 2RJ8A 4KC2A 5FYEA 3I0CA 4C2SA 4HO8A 5CMIA 3Q80A 3I0IX 3SXAA 2WAWA 1HM8A 5CMGX 2RJ7A 2X60A 4FIYA 4ASJA 1FXJA 1G97A 4KT7A 1H5SA 4FCEA 5FU0A 5C47A 1IIMA 2AM4A 5JQQA 1YROB 4CJBA 1QWJA 2RITA 3CKNA 1PZYB 1ZHJA 4ASYA 1XZ6A 1VPAA 1VICA 4UEGA 3D98A 5CQPA 2JCOA 3OKRA 4B4GA 1H4DA 1G1LA 3I0HA 2VK9A 5DDVA 1S4NA 5CMFX 3CU0A 1ZI4A 1JYKA 1ZJ3A 1H3MA 5L6VA 3TQDA 1ZJ0A 4P00A 5L6SA 1HV9A 3F1CA 2D7RA 1TZFA 3DUVA 2P6WA 2FYAA 1XHBA 1ZDFA 5D91A 4FRBA 3U0YA 5D92A 3CKVA 1QG8A 3V0MA 4EE3A 4AC3A 4LW3A 1GWWA 1GWVA 5CQNX 4Q7CA 1V84A 3OGZA 4IRPA 1GQ9A 1OMXA 1WSZA 4Y7TA 3I0KA 3SXGA 4HCQA 4NANA 1VZXA 1I52A 2XMEA 4AYJA 1G2VA 4KPZA 4E1KA 2OI6A 5IDTA 1H5RB 1QGQA 3LW6A 3SX7A 1R7YA 5FU8A 2PGYA 1H5TA 4FRHA 3K8EA 3SPTA 3OH2A 3OH3A 2Y6PA 3OC9A 4KRVA 1WT0A 5I1FA 3BRKX 1ZCVA 5EJZA 3R3IA 1G8OA 1VM8A 4G3SA 4FIXA 1GX4A 2PGVA 1FRWA 2Q4JA 1HM0A 4B4MA 2YESA 4EEAA 2VS4A 2NXVA 2AM3A 1ZJ1A 3NGWA 2WVLA 1G9RA 1H7FA 5C3DA 4B5BA 2XWMA 4FCUA 3F1YA 4B3UA 1R80A 2RJ0A 3CGXA 1GX0A 2Z86A 1V83A 2RJ9A 1WVCA 4FREA 2PX7A 4KQLA 2JCJA 3V0PA 1FOAA 1R82A 1S4OA 4CJ8A 2Y7AA 1MP3A 1ZI1A 4D48A 5CQMX 4Y9XA 2ICXA 1LZ0A 1JV1A 4CVHA 1ZI5A 3SXBA 5IFYA 2WVMA 3KIAA 2AECA 1NKHB 1LVWA 5FTVA 1ZDGA 3I0FA 5EIYA 2YC5A 3SXEA 1VGZA 3Q7UA 4EEMA 2AGDA 3I0GA 4Y7UA 3V0QA 5FUHA 5C1LA 3ZGGA 3PNNA 2BO8A 4YS8A 4MIXA 2CU2A 4NALA 1VH3A 2GGOA 2VD4A 3HL3A 2Y4MA 3D8VA 2OI7A 5HS2A 5AJPA 3SX3A 1LL2A 1W55A 2YQSA 4Y6NA 3T7NA 3POLA 3JTJA 1INJA 1ZCYA 1YP4A 1G93A 1ON8A 4Y7VA 4ZDQA 1OMZA 1ZJ2A 3BCVA 1YP2A 1WT2A 1FGXA 1ON6A 3T7OA 4EE5A 2RIZA 3U0XA 1HJJA 1NF5B 2OEFA 3CKJA 3JUKA 5CQLX 3U2UA 1FO8A 5AJNA 4FROA 1ZI3A 3V0OA 1H4EA 2ZU9A 3N9WA 2AE7A 2P73A 1MC3A 3V0NA 4CJCA 5C4EA 5C38A 2MZBA 3OH1A 5C48A 1H5SB 4M2BA 4M2AA 5AJOA 2PA4A 3SXDA 3U2XA 1GQCA 3V8ZA 3U2TA 3IOHA 2FFVA 3EE5A 1O0RA 4D0TA 4XWIA 2RJ1A 2P72A 2RJ6A 4FQWA 1YP3A 3Q4SA 4HO0A 1WT3A 4FRDA 4Y6UA 4HO3A 4HO4A 1NMMB 1QGSA 3E25A 2FY7A 4D11C 1HM9A 5DDTA 4KNRA 1TW5A 1SS9A 5C1GA 2VSIA 3PKPA 2QGIA 4LW6A 2APCA 1EZIA 1JVGA 3I0EA 2O1GA 4JISA 1OQMB 3ZGFA 2FYCB 1GA8A 2A8WA 1H7EA 1LL0A 1ZJPA 5CMHA 3QVBA 4J18A 1H5SC 3TZTA 4KC4A 2W0VA 4B2WA 5BXCA 2A8UA 1H5TB 1ZJOA 3I0LA 1FGGA 3U2WA 5C4DA 1VZTA 1TW1A 2OI5A 4IRQA 2GGQA 5C3AA 5EJ1A 1INIA 1FXOA 4KC1A 2ZU7A 4BQHA 2Y4LA 2OEGA 1VH1A 3OH4A 2WGZA 1NWGB 1G3LA 2V0LA 4O6NA 4HOCA 2D0JA 3DJ4A 3V0LA 4DECA 1FWYA 1LL3A 1R81A 4MYBA 1HJLA 4AAWA 3I0JA 5J49A 1MP4A 1H7GA 2VXLA 2BO6A 2Z87A 5C4CA 2I5EA 1O23B 2YQCA 1V82A 1JVDA 4B4BA 1H5SD 4G3PA 1R7VA 1KWSA 2UX8A 1ZCTA 1G23A 2Y4JA 4MNDA 2X5SA 4Y7GA 5C8RA 3U2VA 4M28A 3V91A 2QKXA 4B2XA 4HO9A 1JV3A 3ZLLA 2V0HA 4R7PA
chains in the Genus database with same CATH topology
1H7LA 2VXMA 1H5RA 1S4PA 4Y62A 2FYBA 3R2WA 4Y7FA 1NHEB 4FRMA 4Y64A 5C1HA 3RMWA 1LZIA 2V0KA 4EE4A 3FOQA 1EYRA 3FWWA 4M4KA 1H7QA 4KNXA 1WT1A 3RMVA 1FZWA 2WEEA 2XMHA 2AH9A 2YQJA 5C4FA 2YQHA 3ST8A 4ARWA 4DE7A 4ECMA 2AM5A 1R7XA 1FR9A 3CKQA 4EEOA 3IOIA 1Z90A 2D7IA 2ZU8A 2JCLA 4HO2A 1VZUA 1O7QA 4JD0A 2J0AA 4KPXA 1O7OA 2VFZA 4DDZA 2BO4A 2E8BA 3V90A 5C4BA 3D5NA 3ZF8A 2X65A 3ZLKA 5CMJA 1ZCUA 2RIXA 3I0DA 4Y63A 1FR8A 5CQOA 1FG5N 3CKOA 1NQIB 2WVKA 2XWNA 4HO6A 2W0WA 2ICYA 3RSBA 1VGTA 4GBPA 1PZTA 1H7HA 4O6MA 3T7MA 5C49A 3JUJA 3DK5A 3PKQA 1FO9A 5FV9A 2O1FA 4K6RA 3GUEA 1W77A 3SX5A 1R7TA 5FTSA 4B42A 2VSHA 2WE9A 1G0RA 1E5KA 1VGUA 1ZIZA 3OH0A 3IOJA 3K8DA 4G3QA 2YCMA 1TVYA 2AESA 2O1HA 2FFUA 4FRPA 2I5KA 2BO7A 2RJ5A 2YC3A 2XWLA 1LZ7A 4P02A 2I7BA 2E3DA 4HG6A 4EEGA 2C0NA 1LZJA 4AYLA 5C3BA 1H4CA 4FRLA 4BMAA 1W57A 4HO5A 2Y4KA 2JCKA 4NAIA 4NAKA 1R7UA 2RJ4A 3E26A 3SXCA 4FRAA 4KXOA 2DPWA 3OAMA 1JYLA 1K4VA 1VGWA 1IINA 3SX8A 2V0JA 2VS3A 1G95A 3USRA 2X5ZA 2RIYA 5C36A 2V0IA 3O3PA 1MP5A 4FRQA 4D0ZA 4EVWA 5IDSA 4L41C 2QH5A 2J0BA 1H7TA 2FYDB 3V8YA 4D11A 4G87A 3USQA 2VS5A 2RJ8A 4KC2A 5FYEA 3I0CA 4C2SA 4HO8A 5CMIA 3Q80A 3I0IX 3SXAA 2WAWA 1HM8A 5CMGX 2RJ7A 2X60A 4FIYA 4ASJA 1FXJA 1G97A 4KT7A 1H5SA 4FCEA 5FU0A 5C47A 1IIMA 2AM4A 5JQQA 1YROB 4CJBA 1QWJA 2RITA 3CKNA 1PZYB 1ZHJA 4ASYA 1XZ6A 1VPAA 1VICA 4UEGA 3D98A 5CQPA 2JCOA 3OKRA 4B4GA 1H4DA 1G1LA 3I0HA 2VK9A 5DDVA 1S4NA 5CMFX 3CU0A 1ZI4A 1JYKA 1ZJ3A 1H3MA 5L6VA 3TQDA 1ZJ0A 4P00A 5L6SA 1HV9A 3F1CA 2D7RA 1TZFA 3DUVA 2P6WA 2FYAA 1XHBA 1ZDFA 5D91A 4FRBA 3U0YA 5D92A 3CKVA 1QG8A 3V0MA 4EE3A 4AC3A 4LW3A 1GWWA 1GWVA 5CQNX 4Q7CA 1V84A 3OGZA 4IRPA 1GQ9A 1OMXA 1WSZA 4Y7TA 3I0KA 3SXGA 4HCQA 4NANA 1VZXA 1I52A 2XMEA 4AYJA 1G2VA 4KPZA 4E1KA 2OI6A 5IDTA 1H5RB 1QGQA 3LW6A 3SX7A 1R7YA 5FU8A 2PGYA 1H5TA 4FRHA 3K8EA 3SPTA 3OH2A 3OH3A 2Y6PA 3OC9A 4KRVA 1WT0A 5I1FA 3BRKX 1ZCVA 5EJZA 3R3IA 1G8OA 1VM8A 4G3SA 4FIXA 1GX4A 2PGVA 1FRWA 2Q4JA 1HM0A 4B4MA 2YESA 4EEAA 2VS4A 2NXVA 2AM3A 1ZJ1A 3NGWA 2WVLA 1G9RA 1H7FA 5C3DA 4B5BA 2XWMA 4FCUA 3F1YA 4B3UA 1R80A 2RJ0A 3CGXA 1GX0A 2Z86A 1V83A 2RJ9A 1WVCA 4FREA 2PX7A 4KQLA 2JCJA 3V0PA 1FOAA 1R82A 1S4OA 4CJ8A 2Y7AA 1MP3A 1ZI1A 4D48A 5CQMX 4Y9XA 2ICXA 1LZ0A 1JV1A 4CVHA 1ZI5A 3SXBA 5IFYA 2WVMA 3KIAA 2AECA 1NKHB 1LVWA 5FTVA 1ZDGA 3I0FA 5EIYA 2YC5A 3SXEA 1VGZA 3Q7UA 4EEMA 2AGDA 3I0GA 4Y7UA 3V0QA 5FUHA 5C1LA 3ZGGA 3PNNA 2BO8A 4YS8A 4MIXA 2CU2A 4NALA 1VH3A 2GGOA 2VD4A 3HL3A 2Y4MA 3D8VA 2OI7A 5HS2A 5AJPA 3SX3A 1LL2A 1W55A 2YQSA 4Y6NA 3T7NA 3POLA 3JTJA 1INJA 1ZCYA 1YP4A 1G93A 1ON8A 4Y7VA 4ZDQA 1OMZA 1ZJ2A 3BCVA 1YP2A 1WT2A 1FGXA 1ON6A 3T7OA 4EE5A 2RIZA 3U0XA 1HJJA 1NF5B 2OEFA 3CKJA 3JUKA 5CQLX 3U2UA 1FO8A 5AJNA 4FROA 1ZI3A 3V0OA 1H4EA 2ZU9A 3N9WA 2AE7A 2P73A 1MC3A 3V0NA 4CJCA 5C4EA 5C38A 2MZBA 3OH1A 5C48A 1H5SB 4M2BA 4M2AA 5AJOA 2PA4A 3SXDA 3U2XA 1GQCA 3V8ZA 3U2TA 3IOHA 2FFVA 3EE5A 1O0RA 4D0TA 4XWIA 2RJ1A 2P72A 2RJ6A 4FQWA 1YP3A 3Q4SA 4HO0A 1WT3A 4FRDA 4Y6UA 4HO3A 4HO4A 1NMMB 1QGSA 3E25A 2FY7A 4D11C 1HM9A 5DDTA 4KNRA 1TW5A 1SS9A 5C1GA 2VSIA 3PKPA 2QGIA 4LW6A 2APCA 1EZIA 1JVGA 3I0EA 2O1GA 4JISA 1OQMB 3ZGFA 2FYCB 1GA8A 2A8WA 1H7EA 1LL0A 1ZJPA 5CMHA 3QVBA 4J18A 1H5SC 3TZTA 4KC4A 2W0VA 4B2WA 5BXCA 2A8UA 1H5TB 1ZJOA 3I0LA 1FGGA 3U2WA 5C4DA 1VZTA 1TW1A 2OI5A 4IRQA 2GGQA 5C3AA 5EJ1A 1INIA 1FXOA 4KC1A 2ZU7A 4BQHA 2Y4LA 2OEGA 1VH1A 3OH4A 2WGZA 1NWGB 1G3LA 2V0LA 4O6NA 4HOCA 2D0JA 3DJ4A 3V0LA 4DECA 1FWYA 1LL3A 1R81A 4MYBA 1HJLA 4AAWA 3I0JA 5J49A 1MP4A 1H7GA 2VXLA 2BO6A 2Z87A 5C4CA 2I5EA 1O23B 2YQCA 1V82A 1JVDA 4B4BA 1H5SD 4G3PA 1R7VA 1KWSA 2UX8A 1ZCTA 1G23A 2Y4JA 4MNDA 2X5SA 4Y7GA 5C8RA 3U2VA 4M28A 3V91A 2QKXA 4B2XA 4HO9A 1JV3A 3ZLLA 2V0HA 4R7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7L A;  2VXM A;  1H5R A;  1S4P A;  4Y62 A;  2FYB A;  3R2W A;  4Y7F A;  1NHE B;  4FRM A;  4Y64 A;  5C1H A;  3RMW A;  1LZI A;  2V0K A;  4EE4 A;  3FOQ A;  1EYR A;  3FWW A;  4M4K A;  1H7Q A;  4KNX A;  1WT1 A;  3RMV A;  1FZW A;  2WEE A;  2XMH A;  2AH9 A;  2YQJ A;  5C4F A;  2YQH A;  3ST8 A;  4ARW A;  4DE7 A;  4ECM A;  2AM5 A;  1R7X A;  1FR9 A;  3CKQ A;  4EEO A;  3IOI A;  1Z90 A;  2D7I A;  2ZU8 A;  2JCL A;  4HO2 A;  1VZU A;  1O7Q A;  4JD0 A;  4KPX A;  1O7O A;  2VFZ A;  4DDZ A;  2BO4 A;  2E8B A;  3V90 A;  5C4B A;  3D5N A;  3ZF8 A;  2X65 A;  3ZLK A;  5CMJ A;  1ZCU A;  2RIX A;  3I0D A;  4Y63 A;  1FR8 A;  5CQO A;  1FG5 N;  3CKO A;  1NQI B;  2WVK A;  2XWN A;  4HO6 A;  2W0W A;  2ICY A;  3RSB A;  1VGT A;  4GBP A;  1PZT A;  1H7H A;  3T7M A;  5C49 A;  3JUJ A;  3DK5 A;  3PKQ A;  1FO9 A;  5FV9 A;  2O1F A;  4K6R A;  3GUE A;  1W77 A;  3SX5 A;  1R7T A;  5FTS A;  4B42 A;  2VSH A;  2WE9 A;  1G0R A;  1E5K A;  1VGU A;  1ZIZ A;  3OH0 A;  3IOJ A;  3K8D A;  4G3Q A;  2YCM A;  1TVY A;  2AES A;  2O1H A;  2FFU A;  4FRP A;  2I5K A;  2BO7 A;  2RJ5 A;  2YC3 A;  2XWL A;  1LZ7 A;  4P02 A;  2I7B A;  2E3D A;  4HG6 A;  4EEG A;  4AYL A;  1LZJ A;  5C3B A;  1H4C A;  4FRL A;  4BMA A;  1W57 A;  4HO5 A;  2Y4K A;  2JCK A;  4NAI A;  4NAK A;  1R7U A;  2RJ4 A;  3E26 A;  3SXC A;  4FRA A;  4KXO A;  2DPW A;  3OAM A;  1JYL A;  1K4V A;  1VGW A;  1IIN A;  3SX8 A;  2V0J A;  2VS3 A;  1G95 A;  3USR A;  2X5Z A;  2RIY A;  5C36 A;  2V0I A;  3O3P A;  1MP5 A;  4FRQ A;  4D0Z A;  4EVW A;  5IDS A;  4L41 C;  2QH5 A;  1H7T A;  2FYD B;  3V8Y A;  4D11 A;  4G87 A;  3USQ A;  2VS5 A;  2RJ8 A;  4KC2 A;  5FYE A;  3I0C A;  4C2S A;  4HO8 A;  5CMI A;  3Q80 A;  3I0I X;  3SXA A;  2WAW A;  1HM8 A;  5CMG X;  2RJ7 A;  2X60 A;  4ASJ A;  1FXJ A;  1G97 A;  4KT7 A;  1H5S A;  4FCE A;  5FU0 A;  5C47 A;  1IIM A;  2AM4 A;  5JQQ A;  1YRO B;  4CJB A;  1QWJ A;  2RIT A;  3CKN A;  1PZY B;  1ZHJ A;  4ASY A;  1XZ6 A;  1VPA A;  1VIC A;  4UEG A;  3D98 A;  5CQP A;  2JCO A;  3OKR A;  4B4G A;  1H4D A;  1G1L A;  3I0H A;  5DDV A;  1S4N A;  5CMF X;  3CU0 A;  1ZI4 A;  1JYK A;  1ZJ3 A;  1H3M A;  5L6V A;  3TQD A;  1ZJ0 A;  4P00 A;  5L6S A;  1HV9 A;  3F1C A;  2D7R A;  1TZF A;  3DUV A;  2P6W A;  2FYA A;  1XHB A;  1ZDF A;  4FRB A;  3U0Y A;  3CKV A;  1QG8 A;  3V0M A;  4EE3 A;  4AC3 A;  4LW3 A;  1GWW A;  1GWV A;  5CQN X;  1V84 A;  3OGZ A;  4IRP A;  1GQ9 A;  1OMX A;  1WSZ A;  4Y7T A;  3I0K A;  3SXG A;  4HCQ A;  4NAN A;  1VZX A;  1I52 A;  2XME A;  4AYJ A;  1G2V A;  4KPZ A;  4E1K A;  2OI6 A;  5IDT A;  1H5R B;  1QGQ A;  3LW6 A;  3SX7 A;  1R7Y A;  5FU8 A;  2PGY A;  1H5T A;  4FRH A;  3K8E A;  3SPT A;  3OH2 A;  3OH3 A;  2Y6P A;  3OC9 A;  4KRV A;  1WT0 A;  5I1F A;  3BRK X;  1ZCV A;  5EJZ A;  3R3I A;  1G8O A;  1VM8 A;  4G3S A;  1GX4 A;  2PGV A;  1FRW A;  2Q4J A;  1HM0 A;  4B4M A;  2YES A;  4EEA A;  2VS4 A;  2NXV A;  2AM3 A;  1ZJ1 A;  3NGW A;  2WVL A;  1G9R A;  1H7F A;  5C3D A;  4B5B A;  2XWM A;  4FCU A;  3F1Y A;  4B3U A;  1R80 A;  2RJ0 A;  3CGX A;  1GX0 A;  2Z86 A;  1V83 A;  2RJ9 A;  1WVC A;  4FRE A;  2PX7 A;  4KQL A;  2JCJ A;  3V0P A;  1FOA A;  1R82 A;  1S4O A;  4CJ8 A;  2Y7A A;  1MP3 A;  1ZI1 A;  4D48 A;  5CQM X;  4Y9X A;  2ICX A;  1LZ0 A;  1JV1 A;  4CVH A;  1ZI5 A;  3SXB A;  5IFY A;  2WVM A;  3KIA A;  2AEC A;  1NKH B;  1LVW A;  5FTV A;  1ZDG A;  3I0F A;  5EIY A;  2YC5 A;  3SXE A;  1VGZ A;  3Q7U A;  4EEM A;  2AGD A;  3I0G A;  4Y7U A;  3V0Q A;  5FUH A;  5C1L A;  3ZGG A;  3PNN A;  2BO8 A;  4YS8 A;  2CU2 A;  4NAL A;  1VH3 A;  2GGO A;  2VD4 A;  3HL3 A;  2Y4M A;  3D8V A;  2OI7 A;  5HS2 A;  5AJP A;  3SX3 A;  1LL2 A;  1W55 A;  2YQS A;  4Y6N A;  3T7N A;  3POL A;  3JTJ A;  1INJ A;  1ZCY A;  1YP4 A;  1G93 A;  1ON8 A;  4Y7V A;  4ZDQ A;  1OMZ A;  1ZJ2 A;  3BCV A;  1YP2 A;  1WT2 A;  1FGX A;  1ON6 A;  3T7O A;  4EE5 A;  2RIZ A;  3U0X A;  1HJJ A;  1NF5 B;  2OEF A;  3CKJ A;  3JUK A;  5CQL X;  3U2U A;  1FO8 A;  5AJN A;  4FRO A;  1ZI3 A;  3V0O A;  1H4E A;  2ZU9 A;  3N9W A;  2AE7 A;  2P73 A;  1MC3 A;  3V0N A;  4CJC A;  5C4E A;  5C38 A;  2MZB A;  3OH1 A;  5C48 A;  1H5S B;  4M2B A;  4M2A A;  5AJO A;  2PA4 A;  3SXD A;  3U2X A;  1GQC A;  3V8Z A;  3U2T A;  3IOH A;  2FFV A;  3EE5 A;  1O0R A;  4D0T A;  4XWI A;  2RJ1 A;  2P72 A;  2RJ6 A;  4FQW A;  1YP3 A;  3Q4S A;  4HO0 A;  1WT3 A;  4FRD A;  4Y6U A;  4HO3 A;  4HO4 A;  1NMM B;  1QGS A;  3E25 A;  2FY7 A;  4D11 C;  1HM9 A;  5DDT A;  4KNR A;  1TW5 A;  1SS9 A;  5C1G A;  2VSI A;  3PKP A;  2QGI A;  4LW6 A;  2APC A;  1EZI A;  1JVG A;  3I0E A;  2O1G A;  4JIS A;  1OQM B;  3ZGF A;  2FYC B;  1GA8 A;  2A8W A;  1H7E A;  1LL0 A;  1ZJP A;  5CMH A;  3QVB A;  4J18 A;  1H5S C;  3TZT A;  4KC4 A;  2W0V A;  4B2W A;  5BXC A;  2A8U A;  1H5T B;  1ZJO A;  3I0L A;  1FGG A;  3U2W A;  5C4D A;  1VZT A;  1TW1 A;  2OI5 A;  4IRQ A;  2GGQ A;  5C3A A;  5EJ1 A;  1INI A;  1FXO A;  4KC1 A;  2ZU7 A;  4BQH A;  2Y4L A;  2OEG A;  1VH1 A;  3OH4 A;  2WGZ A;  1NWG B;  1G3L A;  2V0L A;  4HOC A;  2D0J A;  3DJ4 A;  3V0L A;  4DEC A;  1FWY A;  1LL3 A;  1R81 A;  4MYB A;  1HJL A;  4AAW A;  3I0J A;  5J49 A;  1MP4 A;  1H7G A;  2VXL A;  2BO6 A;  2Z87 A;  5C4C A;  2I5E A;  1O23 B;  2YQC A;  1V82 A;  1JVD A;  4B4B A;  1H5S D;  4G3P A;  1R7V A;  1KWS A;  2UX8 A;  1ZCT A;  1G23 A;  2Y4J A;  4MND A;  2X5S A;  4Y7G A;  5C8R A;  3U2V A;  4M28 A;  3V91 A;  2QKX A;  4B2X A;  4HO9 A;  1JV3 A;  3ZLL A;  2V0H A;  4R7P A; 
#chains in the Genus database with same CATH topology
 1H7L A;  2VXM A;  1H5R A;  1S4P A;  4Y62 A;  2FYB A;  3R2W A;  4Y7F A;  1NHE B;  4FRM A;  4Y64 A;  5C1H A;  3RMW A;  1LZI A;  2V0K A;  4EE4 A;  3FOQ A;  1EYR A;  3FWW A;  4M4K A;  1H7Q A;  4KNX A;  1WT1 A;  3RMV A;  1FZW A;  2WEE A;  2XMH A;  2AH9 A;  2YQJ A;  5C4F A;  2YQH A;  3ST8 A;  4ARW A;  4DE7 A;  4ECM A;  2AM5 A;  1R7X A;  1FR9 A;  3CKQ A;  4EEO A;  3IOI A;  1Z90 A;  2D7I A;  2ZU8 A;  2JCL A;  4HO2 A;  1VZU A;  1O7Q A;  4JD0 A;  2J0A A;  4KPX A;  1O7O A;  2VFZ A;  4DDZ A;  2BO4 A;  2E8B A;  3V90 A;  5C4B A;  3D5N A;  3ZF8 A;  2X65 A;  3ZLK A;  5CMJ A;  1ZCU A;  2RIX A;  3I0D A;  4Y63 A;  1FR8 A;  5CQO A;  1FG5 N;  3CKO A;  1NQI B;  2WVK A;  2XWN A;  4HO6 A;  2W0W A;  2ICY A;  3RSB A;  1VGT A;  4GBP A;  1PZT A;  1H7H A;  4O6M A;  3T7M A;  5C49 A;  3JUJ A;  3DK5 A;  3PKQ A;  1FO9 A;  5FV9 A;  2O1F A;  4K6R A;  3GUE A;  1W77 A;  3SX5 A;  1R7T A;  5FTS A;  4B42 A;  2VSH A;  2WE9 A;  1G0R A;  1E5K A;  1VGU A;  1ZIZ A;  3OH0 A;  3IOJ A;  3K8D A;  4G3Q A;  2YCM A;  1TVY A;  2AES A;  2O1H A;  2FFU A;  4FRP A;  2I5K A;  2BO7 A;  2RJ5 A;  2YC3 A;  2XWL A;  1LZ7 A;  4P02 A;  2I7B A;  2E3D A;  4HG6 A;  4EEG A;  2C0N A;  1LZJ A;  4AYL A;  5C3B A;  1H4C A;  4FRL A;  4BMA A;  1W57 A;  4HO5 A;  2Y4K A;  2JCK A;  4NAI A;  4NAK A;  1R7U A;  2RJ4 A;  3E26 A;  3SXC A;  4FRA A;  4KXO A;  2DPW A;  3OAM A;  1JYL A;  1K4V A;  1VGW A;  1IIN A;  3SX8 A;  2V0J A;  2VS3 A;  1G95 A;  3USR A;  2X5Z A;  2RIY A;  5C36 A;  2V0I A;  3O3P A;  1MP5 A;  4FRQ A;  4D0Z A;  4EVW A;  5IDS A;  4L41 C;  2QH5 A;  2J0B A;  1H7T A;  2FYD B;  3V8Y A;  4D11 A;  4G87 A;  3USQ A;  2VS5 A;  2RJ8 A;  4KC2 A;  5FYE A;  3I0C A;  4C2S A;  4HO8 A;  5CMI A;  3Q80 A;  3I0I X;  3SXA A;  2WAW A;  1HM8 A;  5CMG X;  2RJ7 A;  2X60 A;  4FIY A;  4ASJ A;  1FXJ A;  1G97 A;  4KT7 A;  1H5S A;  4FCE A;  5FU0 A;  5C47 A;  1IIM A;  2AM4 A;  5JQQ A;  1YRO B;  4CJB A;  1QWJ A;  2RIT A;  3CKN A;  1PZY B;  1ZHJ A;  4ASY A;  1XZ6 A;  1VPA A;  1VIC A;  4UEG A;  3D98 A;  5CQP A;  2JCO A;  3OKR A;  4B4G A;  1H4D A;  1G1L A;  3I0H A;  2VK9 A;  5DDV A;  1S4N A;  5CMF X;  3CU0 A;  1ZI4 A;  1JYK A;  1ZJ3 A;  1H3M A;  5L6V A;  3TQD A;  1ZJ0 A;  4P00 A;  5L6S A;  1HV9 A;  3F1C A;  2D7R A;  1TZF A;  3DUV A;  2P6W A;  2FYA A;  1XHB A;  1ZDF A;  5D91 A;  4FRB A;  3U0Y A;  5D92 A;  3CKV A;  1QG8 A;  3V0M A;  4EE3 A;  4AC3 A;  4LW3 A;  1GWW A;  1GWV A;  5CQN X;  4Q7C A;  1V84 A;  3OGZ A;  4IRP A;  1GQ9 A;  1OMX A;  1WSZ A;  4Y7T A;  3I0K A;  3SXG A;  4HCQ A;  4NAN A;  1VZX A;  1I52 A;  2XME A;  4AYJ A;  1G2V A;  4KPZ A;  4E1K A;  2OI6 A;  5IDT A;  1H5R B;  1QGQ A;  3LW6 A;  3SX7 A;  1R7Y A;  5FU8 A;  2PGY A;  1H5T A;  4FRH A;  3K8E A;  3SPT A;  3OH2 A;  3OH3 A;  2Y6P A;  3OC9 A;  4KRV A;  1WT0 A;  5I1F A;  3BRK X;  1ZCV A;  5EJZ A;  3R3I A;  1G8O A;  1VM8 A;  4G3S A;  4FIX A;  1GX4 A;  2PGV A;  1FRW A;  2Q4J A;  1HM0 A;  4B4M A;  2YES A;  4EEA A;  2VS4 A;  2NXV A;  2AM3 A;  1ZJ1 A;  3NGW A;  2WVL A;  1G9R A;  1H7F A;  5C3D A;  4B5B A;  2XWM A;  4FCU A;  3F1Y A;  4B3U A;  1R80 A;  2RJ0 A;  3CGX A;  1GX0 A;  2Z86 A;  1V83 A;  2RJ9 A;  1WVC A;  4FRE A;  2PX7 A;  4KQL A;  2JCJ A;  3V0P A;  1FOA A;  1R82 A;  1S4O A;  4CJ8 A;  2Y7A A;  1MP3 A;  1ZI1 A;  4D48 A;  5CQM X;  4Y9X A;  2ICX A;  1LZ0 A;  1JV1 A;  4CVH A;  1ZI5 A;  3SXB A;  5IFY A;  2WVM A;  3KIA A;  2AEC A;  1NKH B;  1LVW A;  5FTV A;  1ZDG A;  3I0F A;  5EIY A;  2YC5 A;  3SXE A;  1VGZ A;  3Q7U A;  4EEM A;  2AGD A;  3I0G A;  4Y7U A;  3V0Q A;  5FUH A;  5C1L A;  3ZGG A;  3PNN A;  2BO8 A;  4YS8 A;  4MIX A;  2CU2 A;  4NAL A;  1VH3 A;  2GGO A;  2VD4 A;  3HL3 A;  2Y4M A;  3D8V A;  2OI7 A;  5HS2 A;  5AJP A;  3SX3 A;  1LL2 A;  1W55 A;  2YQS A;  4Y6N A;  3T7N A;  3POL A;  3JTJ A;  1INJ A;  1ZCY A;  1YP4 A;  1G93 A;  1ON8 A;  4Y7V A;  4ZDQ A;  1OMZ A;  1ZJ2 A;  3BCV A;  1YP2 A;  1WT2 A;  1FGX A;  1ON6 A;  3T7O A;  4EE5 A;  2RIZ A;  3U0X A;  1HJJ A;  1NF5 B;  2OEF A;  3CKJ A;  3JUK A;  5CQL X;  3U2U A;  1FO8 A;  5AJN A;  4FRO A;  1ZI3 A;  3V0O A;  1H4E A;  2ZU9 A;  3N9W A;  2AE7 A;  2P73 A;  1MC3 A;  3V0N A;  4CJC A;  5C4E A;  5C38 A;  2MZB A;  3OH1 A;  5C48 A;  1H5S B;  4M2B A;  4M2A A;  5AJO A;  2PA4 A;  3SXD A;  3U2X A;  1GQC A;  3V8Z A;  3U2T A;  3IOH A;  2FFV A;  3EE5 A;  1O0R A;  4D0T A;  4XWI A;  2RJ1 A;  2P72 A;  2RJ6 A;  4FQW A;  1YP3 A;  3Q4S A;  4HO0 A;  1WT3 A;  4FRD A;  4Y6U A;  4HO3 A;  4HO4 A;  1NMM B;  1QGS A;  3E25 A;  2FY7 A;  4D11 C;  1HM9 A;  5DDT A;  4KNR A;  1TW5 A;  1SS9 A;  5C1G A;  2VSI A;  3PKP A;  2QGI A;  4LW6 A;  2APC A;  1EZI A;  1JVG A;  3I0E A;  2O1G A;  4JIS A;  1OQM B;  3ZGF A;  2FYC B;  1GA8 A;  2A8W A;  1H7E A;  1LL0 A;  1ZJP A;  5CMH A;  3QVB A;  4J18 A;  1H5S C;  3TZT A;  4KC4 A;  2W0V A;  4B2W A;  5BXC A;  2A8U A;  1H5T B;  1ZJO A;  3I0L A;  1FGG A;  3U2W A;  5C4D A;  1VZT A;  1TW1 A;  2OI5 A;  4IRQ A;  2GGQ A;  5C3A A;  5EJ1 A;  1INI A;  1FXO A;  4KC1 A;  2ZU7 A;  4BQH A;  2Y4L A;  2OEG A;  1VH1 A;  3OH4 A;  2WGZ A;  1NWG B;  1G3L A;  2V0L A;  4O6N A;  4HOC A;  2D0J A;  3DJ4 A;  3V0L A;  4DEC A;  1FWY A;  1LL3 A;  1R81 A;  4MYB A;  1HJL A;  4AAW A;  3I0J A;  5J49 A;  1MP4 A;  1H7G A;  2VXL A;  2BO6 A;  2Z87 A;  5C4C A;  2I5E A;  1O23 B;  2YQC A;  1V82 A;  1JVD A;  4B4B A;  1H5S D;  4G3P A;  1R7V A;  1KWS A;  2UX8 A;  1ZCT A;  1G23 A;  2Y4J A;  4MND A;  2X5S A;  4Y7G A;  5C8R A;  3U2V A;  4M28 A;  3V91 A;  2QKX A;  4B2X A;  4HO9 A;  1JV3 A;  3ZLL A;  2V0H A;  4R7P A; 
#chains in the Genus database with same CATH homology
 1H7L A;  2VXM A;  1H5R A;  1S4P A;  4Y62 A;  2FYB A;  3R2W A;  4Y7F A;  1NHE B;  4FRM A;  4Y64 A;  5C1H A;  3RMW A;  1LZI A;  2V0K A;  4EE4 A;  3FOQ A;  1EYR A;  3FWW A;  4M4K A;  1H7Q A;  4KNX A;  1WT1 A;  3RMV A;  1FZW A;  2WEE A;  2XMH A;  2AH9 A;  2YQJ A;  5C4F A;  2YQH A;  3ST8 A;  4ARW A;  4DE7 A;  4ECM A;  2AM5 A;  1R7X A;  1FR9 A;  3CKQ A;  4EEO A;  3IOI A;  1Z90 A;  2D7I A;  2ZU8 A;  2JCL A;  4HO2 A;  1VZU A;  1O7Q A;  4JD0 A;  2J0A A;  4KPX A;  1O7O A;  2VFZ A;  4DDZ A;  2BO4 A;  2E8B A;  3V90 A;  5C4B A;  3D5N A;  3ZF8 A;  2X65 A;  3ZLK A;  5CMJ A;  1ZCU A;  2RIX A;  3I0D A;  4Y63 A;  1FR8 A;  5CQO A;  1FG5 N;  3CKO A;  1NQI B;  2WVK A;  2XWN A;  4HO6 A;  2W0W A;  2ICY A;  3RSB A;  1VGT A;  4GBP A;  1PZT A;  1H7H A;  4O6M A;  3T7M A;  5C49 A;  3JUJ A;  3DK5 A;  3PKQ A;  1FO9 A;  5FV9 A;  2O1F A;  4K6R A;  3GUE A;  1W77 A;  3SX5 A;  1R7T A;  5FTS A;  4B42 A;  2VSH A;  2WE9 A;  1G0R A;  1E5K A;  1VGU A;  1ZIZ A;  3OH0 A;  3IOJ A;  3K8D A;  4G3Q A;  2YCM A;  1TVY A;  2AES A;  2O1H A;  2FFU A;  4FRP A;  2I5K A;  2BO7 A;  2RJ5 A;  2YC3 A;  2XWL A;  1LZ7 A;  4P02 A;  2I7B A;  2E3D A;  4HG6 A;  4EEG A;  2C0N A;  1LZJ A;  4AYL A;  5C3B A;  1H4C A;  4FRL A;  4BMA A;  1W57 A;  4HO5 A;  2Y4K A;  2JCK A;  4NAI A;  4NAK A;  1R7U A;  2RJ4 A;  3E26 A;  3SXC A;  4FRA A;  4KXO A;  2DPW A;  3OAM A;  1JYL A;  1K4V A;  1VGW A;  1IIN A;  3SX8 A;  2V0J A;  2VS3 A;  1G95 A;  3USR A;  2X5Z A;  2RIY A;  5C36 A;  2V0I A;  3O3P A;  1MP5 A;  4FRQ A;  4D0Z A;  4EVW A;  5IDS A;  4L41 C;  2QH5 A;  2J0B A;  1H7T A;  2FYD B;  3V8Y A;  4D11 A;  4G87 A;  3USQ A;  2VS5 A;  2RJ8 A;  4KC2 A;  5FYE A;  3I0C A;  4C2S A;  4HO8 A;  5CMI A;  3Q80 A;  3I0I X;  3SXA A;  2WAW A;  1HM8 A;  5CMG X;  2RJ7 A;  2X60 A;  4FIY A;  4ASJ A;  1FXJ A;  1G97 A;  4KT7 A;  1H5S A;  4FCE A;  5FU0 A;  5C47 A;  1IIM A;  2AM4 A;  5JQQ A;  1YRO B;  4CJB A;  1QWJ A;  2RIT A;  3CKN A;  1PZY B;  1ZHJ A;  4ASY A;  1XZ6 A;  1VPA A;  1VIC A;  4UEG A;  3D98 A;  5CQP A;  2JCO A;  3OKR A;  4B4G A;  1H4D A;  1G1L A;  3I0H A;  2VK9 A;  5DDV A;  1S4N A;  5CMF X;  3CU0 A;  1ZI4 A;  1JYK A;  1ZJ3 A;  1H3M A;  5L6V A;  3TQD A;  1ZJ0 A;  4P00 A;  5L6S A;  1HV9 A;  3F1C A;  2D7R A;  1TZF A;  3DUV A;  2P6W A;  2FYA A;  1XHB A;  1ZDF A;  5D91 A;  4FRB A;  3U0Y A;  5D92 A;  3CKV A;  1QG8 A;  3V0M A;  4EE3 A;  4AC3 A;  4LW3 A;  1GWW A;  1GWV A;  5CQN X;  4Q7C A;  1V84 A;  3OGZ A;  4IRP A;  1GQ9 A;  1OMX A;  1WSZ A;  4Y7T A;  3I0K A;  3SXG A;  4HCQ A;  4NAN A;  1VZX A;  1I52 A;  2XME A;  4AYJ A;  1G2V A;  4KPZ A;  4E1K A;  2OI6 A;  5IDT A;  1H5R B;  1QGQ A;  3LW6 A;  3SX7 A;  1R7Y A;  5FU8 A;  2PGY A;  1H5T A;  4FRH A;  3K8E A;  3SPT A;  3OH2 A;  3OH3 A;  2Y6P A;  3OC9 A;  4KRV A;  1WT0 A;  5I1F A;  3BRK X;  1ZCV A;  5EJZ A;  3R3I A;  1G8O A;  1VM8 A;  4G3S A;  4FIX A;  1GX4 A;  2PGV A;  1FRW A;  2Q4J A;  1HM0 A;  4B4M A;  2YES A;  4EEA A;  2VS4 A;  2NXV A;  2AM3 A;  1ZJ1 A;  3NGW A;  2WVL A;  1G9R A;  1H7F A;  5C3D A;  4B5B A;  2XWM A;  4FCU A;  3F1Y A;  4B3U A;  1R80 A;  2RJ0 A;  3CGX A;  1GX0 A;  2Z86 A;  1V83 A;  2RJ9 A;  1WVC A;  4FRE A;  2PX7 A;  4KQL A;  2JCJ A;  3V0P A;  1FOA A;  1R82 A;  1S4O A;  4CJ8 A;  2Y7A A;  1MP3 A;  1ZI1 A;  4D48 A;  5CQM X;  4Y9X A;  2ICX A;  1LZ0 A;  1JV1 A;  4CVH A;  1ZI5 A;  3SXB A;  5IFY A;  2WVM A;  3KIA A;  2AEC A;  1NKH B;  1LVW A;  5FTV A;  1ZDG A;  3I0F A;  5EIY A;  2YC5 A;  3SXE A;  1VGZ A;  3Q7U A;  4EEM A;  2AGD A;  3I0G A;  4Y7U A;  3V0Q A;  5FUH A;  5C1L A;  3ZGG A;  3PNN A;  2BO8 A;  4YS8 A;  4MIX A;  2CU2 A;  4NAL A;  1VH3 A;  2GGO A;  2VD4 A;  3HL3 A;  2Y4M A;  3D8V A;  2OI7 A;  5HS2 A;  5AJP A;  3SX3 A;  1LL2 A;  1W55 A;  2YQS A;  4Y6N A;  3T7N A;  3POL A;  3JTJ A;  1INJ A;  1ZCY A;  1YP4 A;  1G93 A;  1ON8 A;  4Y7V A;  4ZDQ A;  1OMZ A;  1ZJ2 A;  3BCV A;  1YP2 A;  1WT2 A;  1FGX A;  1ON6 A;  3T7O A;  4EE5 A;  2RIZ A;  3U0X A;  1HJJ A;  1NF5 B;  2OEF A;  3CKJ A;  3JUK A;  5CQL X;  3U2U A;  1FO8 A;  5AJN A;  4FRO A;  1ZI3 A;  3V0O A;  1H4E A;  2ZU9 A;  3N9W A;  2AE7 A;  2P73 A;  1MC3 A;  3V0N A;  4CJC A;  5C4E A;  5C38 A;  2MZB A;  3OH1 A;  5C48 A;  1H5S B;  4M2B A;  4M2A A;  5AJO A;  2PA4 A;  3SXD A;  3U2X A;  1GQC A;  3V8Z A;  3U2T A;  3IOH A;  2FFV A;  3EE5 A;  1O0R A;  4D0T A;  4XWI A;  2RJ1 A;  2P72 A;  2RJ6 A;  4FQW A;  1YP3 A;  3Q4S A;  4HO0 A;  1WT3 A;  4FRD A;  4Y6U A;  4HO3 A;  4HO4 A;  1NMM B;  1QGS A;  3E25 A;  2FY7 A;  4D11 C;  1HM9 A;  5DDT A;  4KNR A;  1TW5 A;  1SS9 A;  5C1G A;  2VSI A;  3PKP A;  2QGI A;  4LW6 A;  2APC A;  1EZI A;  1JVG A;  3I0E A;  2O1G A;  4JIS A;  1OQM B;  3ZGF A;  2FYC B;  1GA8 A;  2A8W A;  1H7E A;  1LL0 A;  1ZJP A;  5CMH A;  3QVB A;  4J18 A;  1H5S C;  3TZT A;  4KC4 A;  2W0V A;  4B2W A;  5BXC A;  2A8U A;  1H5T B;  1ZJO A;  3I0L A;  1FGG A;  3U2W A;  5C4D A;  1VZT A;  1TW1 A;  2OI5 A;  4IRQ A;  2GGQ A;  5C3A A;  5EJ1 A;  1INI A;  1FXO A;  4KC1 A;  2ZU7 A;  4BQH A;  2Y4L A;  2OEG A;  1VH1 A;  3OH4 A;  2WGZ A;  1NWG B;  1G3L A;  2V0L A;  4O6N A;  4HOC A;  2D0J A;  3DJ4 A;  3V0L A;  4DEC A;  1FWY A;  1LL3 A;  1R81 A;  4MYB A;  1HJL A;  4AAW A;  3I0J A;  5J49 A;  1MP4 A;  1H7G A;  2VXL A;  2BO6 A;  2Z87 A;  5C4C A;  2I5E A;  1O23 B;  2YQC A;  1V82 A;  1JVD A;  4B4B A;  1H5S D;  4G3P A;  1R7V A;  1KWS A;  2UX8 A;  1ZCT A;  1G23 A;  2Y4J A;  4MND A;  2X5S A;  4Y7G A;  5C8R A;  3U2V A;  4M28 A;  3V91 A;  2QKX A;  4B2X A;  4HO9 A;  1JV3 A;  3ZLL A;  2V0H A;  4R7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...