1LL2A

Crystal structure of rabbit muscle glycogenin complexed with udp-glucose and manganese
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
255
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRTHPQFLNVWWDIFTTSVVPLLQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGENIN-1
publication title Crystal structure of the autocatalytic initiator of glycogen biosynthesis, glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 84
structure length 255
sequence length 263
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1ll2A00
3ZF8A 1H7HA 3V0PA 3U2XA 1FGGA 3POLA 1VGUA 5FV9A 5C4BA 3CKJA 2Q4JA 3R2WA 5DDTA 3V8YA 3I0GA 3F1YA 1H7FA 2O1GA 2XMEA 5CQNX 1LZ0A 2O1HA 1FG5N 2PA4A 3CKOA 3SXDA 1R7VA 5I1FA 2RJ5A 2OEFA 4FQWA 1R7YA 3T7OA 4KXOA 3OH4A 4Y9XA 1HJJA 2CU2A 3CU0A 3OAMA 2PGVA 4EEGA 2YQHA 2OI7A 4P00A 1INIA 3I0CA 1ZJ1A 2RJ0A 3N9WA 4B5BA 2AE7A 4KPXA 1H7EA 3IOHA 4Y62A 3V0OA 2I7BA 1QG8A 1GA8A 4GBPA 1VGZA 1H7LA 4B4MA 3CKQA 1TZFA 4Y6NA 3RMVA 2FFVA 1MP4A 2RJ6A 3V8ZA 2Y4KA 4EVWA 4CJ8A 2AESA 1H7QA 1QWJA 1LVWA 4M2AA 2RJ7A 1NHEB 1JVDA 2QKXA 3U2WA 1H5RB 4FRMA 2X65A 4B42A 4M28A 3DK5A 5L6SA 1FO8A 4FRQA 2JCJA 5C38A 2X5ZA 3I0JA 4LW3A 3T7NA 1R82A 1YP4A 5AJPA 4B3UA 1G9RA 2OEGA 1GQCA 2P72A 2MZBA 1JV1A 1VGTA 1ZJOA 1H5SB 4EEOA 1OMZA 5EJZA 4Y64A 1WT2A 2QH5A 2ICXA 2YQCA 5CMFX 3D98A 3U2VA 3DJ4A 1R7XA 2ZU8A 1R7TA 2AGDA 2Y4MA 3PKQA 3IOIA 1MP5A 1FWYA 2ICYA 1G2VA 1MP3A 5BXCA 3BRKX 5CMHA 5C3BA 1WSZA 3GUEA 5C1LA 5C36A 3E26A 4FRAA 4FCEA 4G3SA 4HO8A 5C1HA 3ZLLA 1ZI5A 3SPTA 3HL3A 4D48A 3I0FA 4HO5A 4Y7TA 1FR9A 3Q7UA 1ZJPA 5C4DA 1GQ9A 1ZJ3A 3K8EA 4G3QA 4BQHA 1FOAA 3SXGA 4E1KA 1H7GA 1H5TB 1HM9A 4Y7VA 1ON6A 2BO8A 4J18A 4KRVA 4FREA 5C4FA 2FYBA 1IINA 1HV9A 2E8BA 4D11C 1H4CA 1H5SD 2YC3A 4HO2A 4D0ZA 4FCUA 4IRQA 1VZXA 1Z90A 1O23B 5FTVA 1H7TA 2JCOA 3OGZA 1PZTA 3ZGFA 1HM8A 4HO3A 1VICA 4EEAA 2O1FA 3F1CA 5HS2A 3Q4SA 2FYCB 2YESA 5CQOA 4EE4A 2WEEA 2XWNA 1GWVA 4JISA 4B4BA 2RIZA 3TZTA 2YQJA 4G3PA 3V0NA 3IOJA 2RITA 1G23A 2RJ9A 1FO9A 3USQA 2BO6A 1ZHJA 3U2UA 5IFYA 1VZTA 1VH3A 4C2SA 1H3MA 4G87A 2YCMA 5FU0A 1ZIZA 3PNNA 1PZYB 1V84A 4B2WA 3JTJA 3OH0A 4FRBA 4KQLA 2VS5A 2WAWA 2P73A 1O7OA 1ZI1A 1OQMB 3I0EA 3OC9A 2VS3A 1G97A 3RMWA 4FRPA 2V0HA 3LW6A 1LZ7A 3DUVA 1YP3A 3U2TA 1H4EA 1H5SC 3SX3A 3I0IX 1I52A 3NGWA 4KC1A 3ST8A 2A8WA 4HO4A 3SX5A 1E5KA 3U0YA 1GX0A 5CQMX 3V0QA 3KIAA 1SS9A 4MYBA 3V0MA 1VPAA 4AYLA 1XZ6A 3OH1A 1R81A 2A8UA 2X5SA 3OH2A 4AYJA 3Q80A 4M4KA 2V0JA 2P6WA 1ZI4A 1NKHB 4FRDA 4P02A 2RJ8A 4ARWA 2APCA 4M2BA 4NAIA 4YS8A 3TQDA 1HJLA 4FROA 2VSIA 2W0VA 1ZDFA 4L41C 5IDSA 5EIYA 5CQLX 2Z86A 1LL3A 2BO4A 2ZU7A 2E3DA 4JD0A 5FYEA 4BMAA 4ASJA 1S4PA 4HO9A 5C47A 4D0TA 3V91A 4Y6UA 4FRHA 3SXCA 5C4EA 1V82A 1R7UA 3QVBA 1G93A 5J49A 2W0WA 2WVKA 5C8RA 4AAWA 2PX7A 4HO6A 1INJA 3SX7A 1ZCYA 3I0LA 4KNRA 3T7MA 2RJ4A 2X60A 1GWWA 2Z87A 1KWSA 2JCKA 1TVYA 2FFUA 3FOQA 1ON8A 1R80A 2WVMA 4D11A 4KPZA 4DDZA 1NWGB 3RSBA 3I0DA 1EYRA 1YROB 3JUJA 5CMJA 3D8VA 2GGQA 3FWWA 3K8DA 2D0JA 1FRWA 1VZUA 1FZWA 2VFZA 4NANA 1FXJA 1TW5A 2OI6A 3R3IA 4Y7UA 2PGYA 1G95A 2YQSA 1VGWA 5CMIA 2VS4A 1W55A 4Y7FA 4Y7GA 4IRPA 1QGSA 4CJBA 3V90A 1WVCA 2AM3A 4B4GA 4ASYA 4B2XA 2V0LA 1WT1A 3CKVA 3E25A 1G8OA 2RJ1A 4R7PA 4EEMA 1NF5B 3D5NA 4KC2A 3SXBA 2NXVA 2XMHA 1WT0A 1ZJ2A 1LL2A 1W77A 1H5RA 5C3AA 4ZDQA 4ECMA 3JUKA 3I0KA 1ZCVA 2V0KA 5C4CA 2XWMA 2Y6PA 4HCQA 1G0RA 4CJCA 3V0LA 2V0IA 2Y4LA 1NQIB 2XWLA 2YC5A 2DPWA 1V83A 3CKNA 2QGIA 1S4OA 5FUHA 1YP2A 1LL0A 1H5SA 1VH1A 1HM0A 4NAKA 2WVLA 2Y7AA 3CGXA 4HOCA 4KNXA 4KT7A 2JCLA 1O7QA 1NMMB 1GX4A 4KC4A 1MC3A 5C48A 1G1LA 2WGZA 1QGQA 2ZU9A 2I5KA 4UEGA 4K6RA 1W57A 1TW1A 4HG6A 4XWIA 4HO0A 3OH3A 2FY7A 5CMGX 4Y63A 5C3DA 2WE9A 3ZLKA 2UX8A 5L6VA 3O3PA 3SX8A 4EE3A 1FGXA 1FR8A 1O0RA 2VXMA 5C49A 2VSHA 1XHBA 3BCVA 1ZDGA 2Y4JA 2D7RA 3PKPA 3I0HA 5FTSA 1ZI3A 1H5TA 3EE5A 2VXLA 1JVGA 4LW6A 5DDVA 1ZJ0A 2OI5A 3ZGGA 4CVHA 4DECA 3U0XA 1JYLA 1FXOA 1K4VA 2FYAA 2GGOA 4AC3A 4MNDA 5IDTA 5FU8A 3USRA 2BO7A 1JYKA 2AECA 5CQPA 3OKRA 1S4NA 2AH9A 2I5EA 2AM4A 1ZCTA 1VM8A 1JV3A 5C1GA 2FYDB 5AJNA 4DE7A 4EE5A 2RIYA 2D7IA 3SXAA 5JQQA 1G3LA 4NALA 1H4DA 2VD4A 1EZIA 4FRLA 5AJOA 3SXEA 1OMXA 2RIXA 1LZJA 2AM5A 5EJ1A 1ZCUA 1WT3A 1LZIA 1IIMA
chains in the Genus database with same CATH superfamily
3ZF8A 1H7HA 3V0PA 3U2XA 1FGGA 3POLA 1VGUA 5FV9A 5C4BA 3CKJA 2Q4JA 3R2WA 5DDTA 3V8YA 3I0GA 3F1YA 1H7FA 2O1GA 2XMEA 5CQNX 1LZ0A 2O1HA 1FG5N 2PA4A 3CKOA 3SXDA 1R7VA 5I1FA 2RJ5A 2OEFA 4FQWA 1R7YA 2C0NA 3T7OA 4KXOA 3OH4A 2VK9A 4Y9XA 1HJJA 2CU2A 3CU0A 3OAMA 2PGVA 4EEGA 2YQHA 2OI7A 4P00A 1INIA 3I0CA 1ZJ1A 2RJ0A 3N9WA 4B5BA 2AE7A 4KPXA 1H7EA 3IOHA 4Y62A 3V0OA 2I7BA 1QG8A 1GA8A 4GBPA 1VGZA 1H7LA 4B4MA 3CKQA 1TZFA 4Y6NA 3RMVA 2FFVA 4MIXA 1MP4A 2RJ6A 3V8ZA 2Y4KA 4EVWA 4CJ8A 2AESA 1H7QA 1QWJA 1LVWA 4M2AA 2RJ7A 1NHEB 1JVDA 2QKXA 3U2WA 1H5RB 4FRMA 2X65A 4B42A 4M28A 3DK5A 5L6SA 1FO8A 4FRQA 2JCJA 5C38A 2X5ZA 3I0JA 4LW3A 3T7NA 1R82A 1YP4A 5AJPA 4B3UA 1G9RA 2OEGA 1GQCA 2P72A 2MZBA 1JV1A 1VGTA 1ZJOA 1H5SB 4EEOA 1OMZA 5EJZA 4Y64A 1WT2A 2QH5A 2ICXA 2YQCA 5CMFX 3D98A 3U2VA 3DJ4A 1R7XA 2ZU8A 1R7TA 2AGDA 2Y4MA 3PKQA 3IOIA 1MP5A 1FWYA 2ICYA 1G2VA 1MP3A 5BXCA 3BRKX 5CMHA 5C3BA 1WSZA 3GUEA 5C1LA 5C36A 3E26A 4FRAA 4FCEA 4G3SA 4HO8A 5C1HA 3ZLLA 1ZI5A 4FIYA 3SPTA 3HL3A 4D48A 3I0FA 4HO5A 4Y7TA 1FR9A 3Q7UA 1ZJPA 5C4DA 1GQ9A 1ZJ3A 3K8EA 4G3QA 4BQHA 1FOAA 3SXGA 4E1KA 1H7GA 1H5TB 1HM9A 4Y7VA 1ON6A 2BO8A 4J18A 4KRVA 4FREA 5C4FA 2FYBA 1IINA 1HV9A 2E8BA 4D11C 1H4CA 1H5SD 2YC3A 4HO2A 4D0ZA 4FCUA 4IRQA 1VZXA 1Z90A 1O23B 5FTVA 1H7TA 2JCOA 3OGZA 1PZTA 3ZGFA 1HM8A 4HO3A 1VICA 4EEAA 2O1FA 3F1CA 5HS2A 3Q4SA 2FYCB 2YESA 5CQOA 4EE4A 2WEEA 2XWNA 1GWVA 4JISA 4B4BA 2RIZA 3TZTA 2YQJA 4G3PA 3V0NA 3IOJA 2RITA 1G23A 2RJ9A 1FO9A 3USQA 2BO6A 1ZHJA 3U2UA 5IFYA 1VZTA 1VH3A 4C2SA 1H3MA 4G87A 2YCMA 5FU0A 1ZIZA 3PNNA 1PZYB 1V84A 4B2WA 3JTJA 3OH0A 4FRBA 4KQLA 2VS5A 2WAWA 2P73A 4Q7CA 1O7OA 1ZI1A 1OQMB 3I0EA 3OC9A 2VS3A 1G97A 3RMWA 4FRPA 2V0HA 3LW6A 1LZ7A 3DUVA 1YP3A 3U2TA 1H4EA 1H5SC 3SX3A 3I0IX 1I52A 3NGWA 4KC1A 3ST8A 2A8WA 4HO4A 3SX5A 1E5KA 3U0YA 1GX0A 5CQMX 3V0QA 3KIAA 1SS9A 4MYBA 3V0MA 1VPAA 4AYLA 1XZ6A 3OH1A 1R81A 2A8UA 2X5SA 3OH2A 4AYJA 3Q80A 4M4KA 2V0JA 2P6WA 1ZI4A 1NKHB 4FRDA 4P02A 2RJ8A 4ARWA 2APCA 4M2BA 4NAIA 4YS8A 3TQDA 1HJLA 4FROA 2VSIA 2W0VA 1ZDFA 4L41C 5IDSA 5EIYA 5CQLX 2Z86A 2J0BA 1LL3A 5D92A 2BO4A 2ZU7A 2E3DA 4JD0A 5FYEA 4BMAA 4ASJA 1S4PA 4HO9A 5C47A 4D0TA 3V91A 4Y6UA 4FRHA 3SXCA 5C4EA 1V82A 1R7UA 3QVBA 1G93A 5J49A 2W0WA 2WVKA 5C8RA 4AAWA 2PX7A 4HO6A 1INJA 3SX7A 1ZCYA 3I0LA 4KNRA 3T7MA 2RJ4A 2X60A 1GWWA 2Z87A 1KWSA 2JCKA 1TVYA 2FFUA 3FOQA 1ON8A 1R80A 2WVMA 4D11A 4KPZA 4DDZA 1NWGB 3RSBA 3I0DA 1EYRA 1YROB 3JUJA 5CMJA 3D8VA 2GGQA 3FWWA 3K8DA 2D0JA 1FRWA 1VZUA 1FZWA 2VFZA 4NANA 1FXJA 1TW5A 2OI6A 3R3IA 4Y7UA 2PGYA 1G95A 5D91A 2YQSA 1VGWA 5CMIA 2VS4A 1W55A 4Y7FA 4Y7GA 4IRPA 1QGSA 4CJBA 3V90A 1WVCA 2AM3A 4B4GA 4ASYA 4B2XA 2V0LA 1WT1A 3CKVA 3E25A 1G8OA 2RJ1A 4R7PA 4EEMA 1NF5B 3D5NA 4KC2A 3SXBA 2NXVA 2XMHA 1WT0A 1ZJ2A 1LL2A 1W77A 1H5RA 5C3AA 4ZDQA 4ECMA 3JUKA 3I0KA 2J0AA 1ZCVA 2V0KA 5C4CA 2XWMA 2Y6PA 4HCQA 1G0RA 4CJCA 3V0LA 2V0IA 2Y4LA 1NQIB 2XWLA 2YC5A 2DPWA 1V83A 3CKNA 2QGIA 1S4OA 5FUHA 1YP2A 1LL0A 1H5SA 1VH1A 1HM0A 4NAKA 2WVLA 2Y7AA 3CGXA 4HOCA 4KNXA 4KT7A 2JCLA 1O7QA 4O6MA 1NMMB 1GX4A 4KC4A 1MC3A 5C48A 1G1LA 2WGZA 1QGQA 2ZU9A 2I5KA 4UEGA 4K6RA 1W57A 1TW1A 4HG6A 4XWIA 4HO0A 3OH3A 2FY7A 5CMGX 4Y63A 5C3DA 2WE9A 3ZLKA 2UX8A 5L6VA 3O3PA 3SX8A 4EE3A 1FGXA 1FR8A 1O0RA 2VXMA 5C49A 2VSHA 1XHBA 3BCVA 1ZDGA 2Y4JA 2D7RA 3PKPA 3I0HA 5FTSA 1ZI3A 4O6NA 1H5TA 3EE5A 2VXLA 1JVGA 4LW6A 5DDVA 1ZJ0A 2OI5A 3ZGGA 4CVHA 4DECA 3U0XA 1JYLA 1FXOA 1K4VA 2FYAA 2GGOA 4AC3A 4MNDA 5IDTA 5FU8A 3USRA 2BO7A 1JYKA 2AECA 5CQPA 3OKRA 1S4NA 2AH9A 2I5EA 2AM4A 1ZCTA 1VM8A 1JV3A 5C1GA 2FYDB 5AJNA 4DE7A 4EE5A 2RIYA 2D7IA 3SXAA 5JQQA 1G3LA 4NALA 1H4DA 2VD4A 1EZIA 4FRLA 5AJOA 3SXEA 1OMXA 2RIXA 1LZJA 2AM5A 5EJ1A 1ZCUA 1WT3A 4FIXA 1LZIA 1IIMA
chains in the Genus database with same CATH topology
3ZF8A 1H7HA 3V0PA 3U2XA 1FGGA 3POLA 1VGUA 5FV9A 5C4BA 3CKJA 2Q4JA 3R2WA 5DDTA 3V8YA 3I0GA 3F1YA 1H7FA 2O1GA 2XMEA 5CQNX 1LZ0A 2O1HA 1FG5N 2PA4A 3CKOA 3SXDA 1R7VA 5I1FA 2RJ5A 2OEFA 4FQWA 1R7YA 2C0NA 3T7OA 4KXOA 3OH4A 2VK9A 4Y9XA 1HJJA 2CU2A 3CU0A 3OAMA 2PGVA 4EEGA 2YQHA 2OI7A 4P00A 1INIA 3I0CA 1ZJ1A 2RJ0A 3N9WA 4B5BA 2AE7A 4KPXA 1H7EA 3IOHA 4Y62A 3V0OA 2I7BA 1QG8A 1GA8A 4GBPA 1VGZA 1H7LA 4B4MA 3CKQA 1TZFA 4Y6NA 3RMVA 2FFVA 4MIXA 1MP4A 2RJ6A 3V8ZA 2Y4KA 4EVWA 4CJ8A 2AESA 1H7QA 1QWJA 1LVWA 4M2AA 2RJ7A 1NHEB 1JVDA 2QKXA 3U2WA 1H5RB 4FRMA 2X65A 4B42A 4M28A 3DK5A 5L6SA 1FO8A 4FRQA 2JCJA 5C38A 2X5ZA 3I0JA 4LW3A 3T7NA 1R82A 1YP4A 5AJPA 4B3UA 1G9RA 2OEGA 1GQCA 2P72A 2MZBA 1JV1A 1VGTA 1ZJOA 1H5SB 4EEOA 1OMZA 5EJZA 4Y64A 1WT2A 2QH5A 2ICXA 2YQCA 5CMFX 3D98A 3U2VA 3DJ4A 1R7XA 2ZU8A 1R7TA 2AGDA 2Y4MA 3PKQA 3IOIA 1MP5A 1FWYA 2ICYA 1G2VA 1MP3A 5BXCA 3BRKX 5CMHA 5C3BA 1WSZA 3GUEA 5C1LA 5C36A 3E26A 4FRAA 4FCEA 4G3SA 4HO8A 5C1HA 3ZLLA 1ZI5A 4FIYA 3SPTA 3HL3A 4D48A 3I0FA 4HO5A 4Y7TA 1FR9A 3Q7UA 1ZJPA 5C4DA 1GQ9A 1ZJ3A 3K8EA 4G3QA 4BQHA 1FOAA 3SXGA 4E1KA 1H7GA 1H5TB 1HM9A 4Y7VA 1ON6A 2BO8A 4J18A 4KRVA 4FREA 5C4FA 2FYBA 1IINA 1HV9A 2E8BA 4D11C 1H4CA 1H5SD 2YC3A 4HO2A 4D0ZA 4FCUA 4IRQA 1VZXA 1Z90A 1O23B 5FTVA 1H7TA 2JCOA 3OGZA 1PZTA 3ZGFA 1HM8A 4HO3A 1VICA 4EEAA 2O1FA 3F1CA 5HS2A 3Q4SA 2FYCB 2YESA 5CQOA 4EE4A 2WEEA 2XWNA 1GWVA 4JISA 4B4BA 2RIZA 3TZTA 2YQJA 4G3PA 3V0NA 3IOJA 2RITA 1G23A 2RJ9A 1FO9A 3USQA 2BO6A 1ZHJA 3U2UA 5IFYA 1VZTA 1VH3A 4C2SA 1H3MA 4G87A 2YCMA 5FU0A 1ZIZA 3PNNA 1PZYB 1V84A 4B2WA 3JTJA 3OH0A 4FRBA 4KQLA 2VS5A 2WAWA 2P73A 4Q7CA 1O7OA 1ZI1A 1OQMB 3I0EA 3OC9A 2VS3A 1G97A 3RMWA 4FRPA 2V0HA 3LW6A 1LZ7A 3DUVA 1YP3A 3U2TA 1H4EA 1H5SC 3SX3A 3I0IX 1I52A 3NGWA 4KC1A 3ST8A 2A8WA 4HO4A 3SX5A 1E5KA 3U0YA 1GX0A 5CQMX 3V0QA 3KIAA 1SS9A 4MYBA 3V0MA 1VPAA 4AYLA 1XZ6A 3OH1A 1R81A 2A8UA 2X5SA 3OH2A 4AYJA 3Q80A 4M4KA 2V0JA 2P6WA 1ZI4A 1NKHB 4FRDA 4P02A 2RJ8A 4ARWA 2APCA 4M2BA 4NAIA 4YS8A 3TQDA 1HJLA 4FROA 2VSIA 2W0VA 1ZDFA 4L41C 5IDSA 5EIYA 5CQLX 2Z86A 2J0BA 1LL3A 5D92A 2BO4A 2ZU7A 2E3DA 4JD0A 5FYEA 4BMAA 4ASJA 1S4PA 4HO9A 5C47A 4D0TA 3V91A 4Y6UA 4FRHA 3SXCA 5C4EA 1V82A 1R7UA 3QVBA 1G93A 5J49A 2W0WA 2WVKA 5C8RA 4AAWA 2PX7A 4HO6A 1INJA 3SX7A 1ZCYA 3I0LA 4KNRA 3T7MA 2RJ4A 2X60A 1GWWA 2Z87A 1KWSA 2JCKA 1TVYA 2FFUA 3FOQA 1ON8A 1R80A 2WVMA 4D11A 4KPZA 4DDZA 1NWGB 3RSBA 3I0DA 1EYRA 1YROB 3JUJA 5CMJA 3D8VA 2GGQA 3FWWA 3K8DA 2D0JA 1FRWA 1VZUA 1FZWA 2VFZA 4NANA 1FXJA 1TW5A 2OI6A 3R3IA 4Y7UA 2PGYA 1G95A 5D91A 2YQSA 1VGWA 5CMIA 2VS4A 1W55A 4Y7FA 4Y7GA 4IRPA 1QGSA 4CJBA 3V90A 1WVCA 2AM3A 4B4GA 4ASYA 4B2XA 2V0LA 1WT1A 3CKVA 3E25A 1G8OA 2RJ1A 4R7PA 4EEMA 1NF5B 3D5NA 4KC2A 3SXBA 2NXVA 2XMHA 1WT0A 1ZJ2A 1LL2A 1W77A 1H5RA 5C3AA 4ZDQA 4ECMA 3JUKA 3I0KA 2J0AA 1ZCVA 2V0KA 5C4CA 2XWMA 2Y6PA 4HCQA 1G0RA 4CJCA 3V0LA 2V0IA 2Y4LA 1NQIB 2XWLA 2YC5A 2DPWA 1V83A 3CKNA 2QGIA 1S4OA 5FUHA 1YP2A 1LL0A 1H5SA 1VH1A 1HM0A 4NAKA 2WVLA 2Y7AA 3CGXA 4HOCA 4KNXA 4KT7A 2JCLA 1O7QA 4O6MA 1NMMB 1GX4A 4KC4A 1MC3A 5C48A 1G1LA 2WGZA 1QGQA 2ZU9A 2I5KA 4UEGA 4K6RA 1W57A 1TW1A 4HG6A 4XWIA 4HO0A 3OH3A 2FY7A 5CMGX 4Y63A 5C3DA 2WE9A 3ZLKA 2UX8A 5L6VA 3O3PA 3SX8A 4EE3A 1FGXA 1FR8A 1O0RA 2VXMA 5C49A 2VSHA 1XHBA 3BCVA 1ZDGA 2Y4JA 2D7RA 3PKPA 3I0HA 5FTSA 1ZI3A 4O6NA 1H5TA 3EE5A 2VXLA 1JVGA 4LW6A 5DDVA 1ZJ0A 2OI5A 3ZGGA 4CVHA 4DECA 3U0XA 1JYLA 1FXOA 1K4VA 2FYAA 2GGOA 4AC3A 4MNDA 5IDTA 5FU8A 3USRA 2BO7A 1JYKA 2AECA 5CQPA 3OKRA 1S4NA 2AH9A 2I5EA 2AM4A 1ZCTA 1VM8A 1JV3A 5C1GA 2FYDB 5AJNA 4DE7A 4EE5A 2RIYA 2D7IA 3SXAA 5JQQA 1G3LA 4NALA 1H4DA 2VD4A 1EZIA 4FRLA 5AJOA 3SXEA 1OMXA 2RIXA 1LZJA 2AM5A 5EJ1A 1ZCUA 1WT3A 4FIXA 1LZIA 1IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZF8 A;  1H7H A;  3V0P A;  3U2X A;  1FGG A;  3POL A;  1VGU A;  5FV9 A;  5C4B A;  3CKJ A;  2Q4J A;  3R2W A;  5DDT A;  3V8Y A;  3I0G A;  3F1Y A;  1H7F A;  2O1G A;  2XME A;  5CQN X;  1LZ0 A;  2O1H A;  1FG5 N;  2PA4 A;  3CKO A;  3SXD A;  1R7V A;  5I1F A;  2RJ5 A;  2OEF A;  4FQW A;  1R7Y A;  3T7O A;  4KXO A;  3OH4 A;  4Y9X A;  1HJJ A;  2CU2 A;  3CU0 A;  3OAM A;  2PGV A;  4EEG A;  2YQH A;  2OI7 A;  4P00 A;  1INI A;  3I0C A;  1ZJ1 A;  2RJ0 A;  3N9W A;  4B5B A;  2AE7 A;  4KPX A;  1H7E A;  3IOH A;  4Y62 A;  3V0O A;  2I7B A;  1QG8 A;  1GA8 A;  4GBP A;  1VGZ A;  1H7L A;  4B4M A;  3CKQ A;  1TZF A;  4Y6N A;  3RMV A;  2FFV A;  1MP4 A;  2RJ6 A;  3V8Z A;  2Y4K A;  4EVW A;  4CJ8 A;  2AES A;  1H7Q A;  1QWJ A;  1LVW A;  4M2A A;  2RJ7 A;  1NHE B;  1JVD A;  2QKX A;  3U2W A;  1H5R B;  4FRM A;  2X65 A;  4B42 A;  4M28 A;  3DK5 A;  5L6S A;  1FO8 A;  4FRQ A;  2JCJ A;  5C38 A;  2X5Z A;  3I0J A;  4LW3 A;  3T7N A;  1R82 A;  1YP4 A;  5AJP A;  4B3U A;  1G9R A;  2OEG A;  1GQC A;  2P72 A;  2MZB A;  1JV1 A;  1VGT A;  1ZJO A;  1H5S B;  4EEO A;  1OMZ A;  5EJZ A;  4Y64 A;  1WT2 A;  2QH5 A;  2ICX A;  2YQC A;  5CMF X;  3D98 A;  3U2V A;  3DJ4 A;  1R7X A;  2ZU8 A;  1R7T A;  2AGD A;  2Y4M A;  3PKQ A;  3IOI A;  1MP5 A;  1FWY A;  2ICY A;  1G2V A;  1MP3 A;  5BXC A;  3BRK X;  5CMH A;  5C3B A;  1WSZ A;  3GUE A;  5C1L A;  5C36 A;  3E26 A;  4FRA A;  4FCE A;  4G3S A;  4HO8 A;  5C1H A;  3ZLL A;  1ZI5 A;  3SPT A;  3HL3 A;  4D48 A;  3I0F A;  4HO5 A;  4Y7T A;  1FR9 A;  3Q7U A;  1ZJP A;  5C4D A;  1GQ9 A;  1ZJ3 A;  3K8E A;  4G3Q A;  4BQH A;  1FOA A;  3SXG A;  4E1K A;  1H7G A;  1H5T B;  1HM9 A;  4Y7V A;  1ON6 A;  2BO8 A;  4J18 A;  4KRV A;  4FRE A;  5C4F A;  2FYB A;  1IIN A;  1HV9 A;  2E8B A;  4D11 C;  1H4C A;  1H5S D;  2YC3 A;  4HO2 A;  4D0Z A;  4FCU A;  4IRQ A;  1VZX A;  1Z90 A;  1O23 B;  5FTV A;  1H7T A;  2JCO A;  3OGZ A;  1PZT A;  3ZGF A;  1HM8 A;  4HO3 A;  1VIC A;  4EEA A;  2O1F A;  3F1C A;  5HS2 A;  3Q4S A;  2FYC B;  2YES A;  5CQO A;  4EE4 A;  2WEE A;  2XWN A;  1GWV A;  4JIS A;  4B4B A;  2RIZ A;  3TZT A;  2YQJ A;  4G3P A;  3V0N A;  3IOJ A;  2RIT A;  1G23 A;  2RJ9 A;  1FO9 A;  3USQ A;  2BO6 A;  1ZHJ A;  3U2U A;  5IFY A;  1VZT A;  1VH3 A;  4C2S A;  1H3M A;  4G87 A;  2YCM A;  5FU0 A;  1ZIZ A;  3PNN A;  1PZY B;  1V84 A;  4B2W A;  3JTJ A;  3OH0 A;  4FRB A;  4KQL A;  2VS5 A;  2WAW A;  2P73 A;  1O7O A;  1ZI1 A;  1OQM B;  3I0E A;  3OC9 A;  2VS3 A;  1G97 A;  3RMW A;  4FRP A;  2V0H A;  3LW6 A;  1LZ7 A;  3DUV A;  1YP3 A;  3U2T A;  1H4E A;  1H5S C;  3SX3 A;  3I0I X;  1I52 A;  3NGW A;  4KC1 A;  3ST8 A;  2A8W A;  4HO4 A;  3SX5 A;  1E5K A;  3U0Y A;  1GX0 A;  5CQM X;  3V0Q A;  3KIA A;  1SS9 A;  4MYB A;  3V0M A;  1VPA A;  4AYL A;  1XZ6 A;  3OH1 A;  1R81 A;  2A8U A;  2X5S A;  3OH2 A;  4AYJ A;  3Q80 A;  4M4K A;  2V0J A;  2P6W A;  1ZI4 A;  1NKH B;  4FRD A;  4P02 A;  2RJ8 A;  4ARW A;  2APC A;  4M2B A;  4NAI A;  4YS8 A;  3TQD A;  1HJL A;  4FRO A;  2VSI A;  2W0V A;  1ZDF A;  4L41 C;  5IDS A;  5EIY A;  5CQL X;  2Z86 A;  1LL3 A;  2BO4 A;  2ZU7 A;  2E3D A;  4JD0 A;  5FYE A;  4BMA A;  4ASJ A;  1S4P A;  4HO9 A;  5C47 A;  4D0T A;  3V91 A;  4Y6U A;  4FRH A;  3SXC A;  5C4E A;  1V82 A;  1R7U A;  3QVB A;  1G93 A;  5J49 A;  2W0W A;  2WVK A;  5C8R A;  4AAW A;  2PX7 A;  4HO6 A;  1INJ A;  3SX7 A;  1ZCY A;  3I0L A;  4KNR A;  3T7M A;  2RJ4 A;  2X60 A;  1GWW A;  2Z87 A;  1KWS A;  2JCK A;  1TVY A;  2FFU A;  3FOQ A;  1ON8 A;  1R80 A;  2WVM A;  4D11 A;  4KPZ A;  4DDZ A;  1NWG B;  3RSB A;  3I0D A;  1EYR A;  1YRO B;  3JUJ A;  5CMJ A;  3D8V A;  2GGQ A;  3FWW A;  3K8D A;  2D0J A;  1FRW A;  1VZU A;  1FZW A;  2VFZ A;  4NAN A;  1FXJ A;  1TW5 A;  2OI6 A;  3R3I A;  4Y7U A;  2PGY A;  1G95 A;  2YQS A;  1VGW A;  5CMI A;  2VS4 A;  1W55 A;  4Y7F A;  4Y7G A;  4IRP A;  1QGS A;  4CJB A;  3V90 A;  1WVC A;  2AM3 A;  4B4G A;  4ASY A;  4B2X A;  2V0L A;  1WT1 A;  3CKV A;  3E25 A;  1G8O A;  2RJ1 A;  4R7P A;  4EEM A;  1NF5 B;  3D5N A;  4KC2 A;  3SXB A;  2NXV A;  2XMH A;  1WT0 A;  1ZJ2 A;  1LL2 A;  1W77 A;  1H5R A;  5C3A A;  4ZDQ A;  4ECM A;  3JUK A;  3I0K A;  1ZCV A;  2V0K A;  5C4C A;  2XWM A;  2Y6P A;  4HCQ A;  1G0R A;  4CJC A;  3V0L A;  2V0I A;  2Y4L A;  1NQI B;  2XWL A;  2YC5 A;  2DPW A;  1V83 A;  3CKN A;  2QGI A;  1S4O A;  5FUH A;  1YP2 A;  1LL0 A;  1H5S A;  1VH1 A;  1HM0 A;  4NAK A;  2WVL A;  2Y7A A;  3CGX A;  4HOC A;  4KNX A;  4KT7 A;  2JCL A;  1O7Q A;  1NMM B;  1GX4 A;  4KC4 A;  1MC3 A;  5C48 A;  1G1L A;  2WGZ A;  1QGQ A;  2ZU9 A;  2I5K A;  4UEG A;  4K6R A;  1W57 A;  1TW1 A;  4HG6 A;  4XWI A;  4HO0 A;  3OH3 A;  2FY7 A;  5CMG X;  4Y63 A;  5C3D A;  2WE9 A;  3ZLK A;  2UX8 A;  5L6V A;  3O3P A;  3SX8 A;  4EE3 A;  1FGX A;  1FR8 A;  1O0R A;  2VXM A;  5C49 A;  2VSH A;  1XHB A;  3BCV A;  1ZDG A;  2Y4J A;  2D7R A;  3PKP A;  3I0H A;  5FTS A;  1ZI3 A;  1H5T A;  3EE5 A;  2VXL A;  1JVG A;  4LW6 A;  5DDV A;  1ZJ0 A;  2OI5 A;  3ZGG A;  4CVH A;  4DEC A;  3U0X A;  1JYL A;  1FXO A;  1K4V A;  2FYA A;  2GGO A;  4AC3 A;  4MND A;  5IDT A;  5FU8 A;  3USR A;  2BO7 A;  1JYK A;  2AEC A;  5CQP A;  3OKR A;  1S4N A;  2AH9 A;  2I5E A;  2AM4 A;  1ZCT A;  1VM8 A;  1JV3 A;  5C1G A;  2FYD B;  5AJN A;  4DE7 A;  4EE5 A;  2RIY A;  2D7I A;  3SXA A;  5JQQ A;  1G3L A;  4NAL A;  1H4D A;  2VD4 A;  1EZI A;  4FRL A;  5AJO A;  3SXE A;  1OMX A;  2RIX A;  1LZJ A;  2AM5 A;  5EJ1 A;  1ZCU A;  1WT3 A;  1LZI A;  1IIM A; 
#chains in the Genus database with same CATH topology
 3ZF8 A;  1H7H A;  3V0P A;  3U2X A;  1FGG A;  3POL A;  1VGU A;  5FV9 A;  5C4B A;  3CKJ A;  2Q4J A;  3R2W A;  5DDT A;  3V8Y A;  3I0G A;  3F1Y A;  1H7F A;  2O1G A;  2XME A;  5CQN X;  1LZ0 A;  2O1H A;  1FG5 N;  2PA4 A;  3CKO A;  3SXD A;  1R7V A;  5I1F A;  2RJ5 A;  2OEF A;  4FQW A;  1R7Y A;  2C0N A;  3T7O A;  4KXO A;  3OH4 A;  2VK9 A;  4Y9X A;  1HJJ A;  2CU2 A;  3CU0 A;  3OAM A;  2PGV A;  4EEG A;  2YQH A;  2OI7 A;  4P00 A;  1INI A;  3I0C A;  1ZJ1 A;  2RJ0 A;  3N9W A;  4B5B A;  2AE7 A;  4KPX A;  1H7E A;  3IOH A;  4Y62 A;  3V0O A;  2I7B A;  1QG8 A;  1GA8 A;  4GBP A;  1VGZ A;  1H7L A;  4B4M A;  3CKQ A;  1TZF A;  4Y6N A;  3RMV A;  2FFV A;  4MIX A;  1MP4 A;  2RJ6 A;  3V8Z A;  2Y4K A;  4EVW A;  4CJ8 A;  2AES A;  1H7Q A;  1QWJ A;  1LVW A;  4M2A A;  2RJ7 A;  1NHE B;  1JVD A;  2QKX A;  3U2W A;  1H5R B;  4FRM A;  2X65 A;  4B42 A;  4M28 A;  3DK5 A;  5L6S A;  1FO8 A;  4FRQ A;  2JCJ A;  5C38 A;  2X5Z A;  3I0J A;  4LW3 A;  3T7N A;  1R82 A;  1YP4 A;  5AJP A;  4B3U A;  1G9R A;  2OEG A;  1GQC A;  2P72 A;  2MZB A;  1JV1 A;  1VGT A;  1ZJO A;  1H5S B;  4EEO A;  1OMZ A;  5EJZ A;  4Y64 A;  1WT2 A;  2QH5 A;  2ICX A;  2YQC A;  5CMF X;  3D98 A;  3U2V A;  3DJ4 A;  1R7X A;  2ZU8 A;  1R7T A;  2AGD A;  2Y4M A;  3PKQ A;  3IOI A;  1MP5 A;  1FWY A;  2ICY A;  1G2V A;  1MP3 A;  5BXC A;  3BRK X;  5CMH A;  5C3B A;  1WSZ A;  3GUE A;  5C1L A;  5C36 A;  3E26 A;  4FRA A;  4FCE A;  4G3S A;  4HO8 A;  5C1H A;  3ZLL A;  1ZI5 A;  4FIY A;  3SPT A;  3HL3 A;  4D48 A;  3I0F A;  4HO5 A;  4Y7T A;  1FR9 A;  3Q7U A;  1ZJP A;  5C4D A;  1GQ9 A;  1ZJ3 A;  3K8E A;  4G3Q A;  4BQH A;  1FOA A;  3SXG A;  4E1K A;  1H7G A;  1H5T B;  1HM9 A;  4Y7V A;  1ON6 A;  2BO8 A;  4J18 A;  4KRV A;  4FRE A;  5C4F A;  2FYB A;  1IIN A;  1HV9 A;  2E8B A;  4D11 C;  1H4C A;  1H5S D;  2YC3 A;  4HO2 A;  4D0Z A;  4FCU A;  4IRQ A;  1VZX A;  1Z90 A;  1O23 B;  5FTV A;  1H7T A;  2JCO A;  3OGZ A;  1PZT A;  3ZGF A;  1HM8 A;  4HO3 A;  1VIC A;  4EEA A;  2O1F A;  3F1C A;  5HS2 A;  3Q4S A;  2FYC B;  2YES A;  5CQO A;  4EE4 A;  2WEE A;  2XWN A;  1GWV A;  4JIS A;  4B4B A;  2RIZ A;  3TZT A;  2YQJ A;  4G3P A;  3V0N A;  3IOJ A;  2RIT A;  1G23 A;  2RJ9 A;  1FO9 A;  3USQ A;  2BO6 A;  1ZHJ A;  3U2U A;  5IFY A;  1VZT A;  1VH3 A;  4C2S A;  1H3M A;  4G87 A;  2YCM A;  5FU0 A;  1ZIZ A;  3PNN A;  1PZY B;  1V84 A;  4B2W A;  3JTJ A;  3OH0 A;  4FRB A;  4KQL A;  2VS5 A;  2WAW A;  2P73 A;  4Q7C A;  1O7O A;  1ZI1 A;  1OQM B;  3I0E A;  3OC9 A;  2VS3 A;  1G97 A;  3RMW A;  4FRP A;  2V0H A;  3LW6 A;  1LZ7 A;  3DUV A;  1YP3 A;  3U2T A;  1H4E A;  1H5S C;  3SX3 A;  3I0I X;  1I52 A;  3NGW A;  4KC1 A;  3ST8 A;  2A8W A;  4HO4 A;  3SX5 A;  1E5K A;  3U0Y A;  1GX0 A;  5CQM X;  3V0Q A;  3KIA A;  1SS9 A;  4MYB A;  3V0M A;  1VPA A;  4AYL A;  1XZ6 A;  3OH1 A;  1R81 A;  2A8U A;  2X5S A;  3OH2 A;  4AYJ A;  3Q80 A;  4M4K A;  2V0J A;  2P6W A;  1ZI4 A;  1NKH B;  4FRD A;  4P02 A;  2RJ8 A;  4ARW A;  2APC A;  4M2B A;  4NAI A;  4YS8 A;  3TQD A;  1HJL A;  4FRO A;  2VSI A;  2W0V A;  1ZDF A;  4L41 C;  5IDS A;  5EIY A;  5CQL X;  2Z86 A;  2J0B A;  1LL3 A;  5D92 A;  2BO4 A;  2ZU7 A;  2E3D A;  4JD0 A;  5FYE A;  4BMA A;  4ASJ A;  1S4P A;  4HO9 A;  5C47 A;  4D0T A;  3V91 A;  4Y6U A;  4FRH A;  3SXC A;  5C4E A;  1V82 A;  1R7U A;  3QVB A;  1G93 A;  5J49 A;  2W0W A;  2WVK A;  5C8R A;  4AAW A;  2PX7 A;  4HO6 A;  1INJ A;  3SX7 A;  1ZCY A;  3I0L A;  4KNR A;  3T7M A;  2RJ4 A;  2X60 A;  1GWW A;  2Z87 A;  1KWS A;  2JCK A;  1TVY A;  2FFU A;  3FOQ A;  1ON8 A;  1R80 A;  2WVM A;  4D11 A;  4KPZ A;  4DDZ A;  1NWG B;  3RSB A;  3I0D A;  1EYR A;  1YRO B;  3JUJ A;  5CMJ A;  3D8V A;  2GGQ A;  3FWW A;  3K8D A;  2D0J A;  1FRW A;  1VZU A;  1FZW A;  2VFZ A;  4NAN A;  1FXJ A;  1TW5 A;  2OI6 A;  3R3I A;  4Y7U A;  2PGY A;  1G95 A;  5D91 A;  2YQS A;  1VGW A;  5CMI A;  2VS4 A;  1W55 A;  4Y7F A;  4Y7G A;  4IRP A;  1QGS A;  4CJB A;  3V90 A;  1WVC A;  2AM3 A;  4B4G A;  4ASY A;  4B2X A;  2V0L A;  1WT1 A;  3CKV A;  3E25 A;  1G8O A;  2RJ1 A;  4R7P A;  4EEM A;  1NF5 B;  3D5N A;  4KC2 A;  3SXB A;  2NXV A;  2XMH A;  1WT0 A;  1ZJ2 A;  1LL2 A;  1W77 A;  1H5R A;  5C3A A;  4ZDQ A;  4ECM A;  3JUK A;  3I0K A;  2J0A A;  1ZCV A;  2V0K A;  5C4C A;  2XWM A;  2Y6P A;  4HCQ A;  1G0R A;  4CJC A;  3V0L A;  2V0I A;  2Y4L A;  1NQI B;  2XWL A;  2YC5 A;  2DPW A;  1V83 A;  3CKN A;  2QGI A;  1S4O A;  5FUH A;  1YP2 A;  1LL0 A;  1H5S A;  1VH1 A;  1HM0 A;  4NAK A;  2WVL A;  2Y7A A;  3CGX A;  4HOC A;  4KNX A;  4KT7 A;  2JCL A;  1O7Q A;  4O6M A;  1NMM B;  1GX4 A;  4KC4 A;  1MC3 A;  5C48 A;  1G1L A;  2WGZ A;  1QGQ A;  2ZU9 A;  2I5K A;  4UEG A;  4K6R A;  1W57 A;  1TW1 A;  4HG6 A;  4XWI A;  4HO0 A;  3OH3 A;  2FY7 A;  5CMG X;  4Y63 A;  5C3D A;  2WE9 A;  3ZLK A;  2UX8 A;  5L6V A;  3O3P A;  3SX8 A;  4EE3 A;  1FGX A;  1FR8 A;  1O0R A;  2VXM A;  5C49 A;  2VSH A;  1XHB A;  3BCV A;  1ZDG A;  2Y4J A;  2D7R A;  3PKP A;  3I0H A;  5FTS A;  1ZI3 A;  4O6N A;  1H5T A;  3EE5 A;  2VXL A;  1JVG A;  4LW6 A;  5DDV A;  1ZJ0 A;  2OI5 A;  3ZGG A;  4CVH A;  4DEC A;  3U0X A;  1JYL A;  1FXO A;  1K4V A;  2FYA A;  2GGO A;  4AC3 A;  4MND A;  5IDT A;  5FU8 A;  3USR A;  2BO7 A;  1JYK A;  2AEC A;  5CQP A;  3OKR A;  1S4N A;  2AH9 A;  2I5E A;  2AM4 A;  1ZCT A;  1VM8 A;  1JV3 A;  5C1G A;  2FYD B;  5AJN A;  4DE7 A;  4EE5 A;  2RIY A;  2D7I A;  3SXA A;  5JQQ A;  1G3L A;  4NAL A;  1H4D A;  2VD4 A;  1EZI A;  4FRL A;  5AJO A;  3SXE A;  1OMX A;  2RIX A;  1LZJ A;  2AM5 A;  5EJ1 A;  1ZCU A;  1WT3 A;  4FIX A;  1LZI A;  1IIM A; 
#chains in the Genus database with same CATH homology
 3ZF8 A;  1H7H A;  3V0P A;  3U2X A;  1FGG A;  3POL A;  1VGU A;  5FV9 A;  5C4B A;  3CKJ A;  2Q4J A;  3R2W A;  5DDT A;  3V8Y A;  3I0G A;  3F1Y A;  1H7F A;  2O1G A;  2XME A;  5CQN X;  1LZ0 A;  2O1H A;  1FG5 N;  2PA4 A;  3CKO A;  3SXD A;  1R7V A;  5I1F A;  2RJ5 A;  2OEF A;  4FQW A;  1R7Y A;  2C0N A;  3T7O A;  4KXO A;  3OH4 A;  2VK9 A;  4Y9X A;  1HJJ A;  2CU2 A;  3CU0 A;  3OAM A;  2PGV A;  4EEG A;  2YQH A;  2OI7 A;  4P00 A;  1INI A;  3I0C A;  1ZJ1 A;  2RJ0 A;  3N9W A;  4B5B A;  2AE7 A;  4KPX A;  1H7E A;  3IOH A;  4Y62 A;  3V0O A;  2I7B A;  1QG8 A;  1GA8 A;  4GBP A;  1VGZ A;  1H7L A;  4B4M A;  3CKQ A;  1TZF A;  4Y6N A;  3RMV A;  2FFV A;  4MIX A;  1MP4 A;  2RJ6 A;  3V8Z A;  2Y4K A;  4EVW A;  4CJ8 A;  2AES A;  1H7Q A;  1QWJ A;  1LVW A;  4M2A A;  2RJ7 A;  1NHE B;  1JVD A;  2QKX A;  3U2W A;  1H5R B;  4FRM A;  2X65 A;  4B42 A;  4M28 A;  3DK5 A;  5L6S A;  1FO8 A;  4FRQ A;  2JCJ A;  5C38 A;  2X5Z A;  3I0J A;  4LW3 A;  3T7N A;  1R82 A;  1YP4 A;  5AJP A;  4B3U A;  1G9R A;  2OEG A;  1GQC A;  2P72 A;  2MZB A;  1JV1 A;  1VGT A;  1ZJO A;  1H5S B;  4EEO A;  1OMZ A;  5EJZ A;  4Y64 A;  1WT2 A;  2QH5 A;  2ICX A;  2YQC A;  5CMF X;  3D98 A;  3U2V A;  3DJ4 A;  1R7X A;  2ZU8 A;  1R7T A;  2AGD A;  2Y4M A;  3PKQ A;  3IOI A;  1MP5 A;  1FWY A;  2ICY A;  1G2V A;  1MP3 A;  5BXC A;  3BRK X;  5CMH A;  5C3B A;  1WSZ A;  3GUE A;  5C1L A;  5C36 A;  3E26 A;  4FRA A;  4FCE A;  4G3S A;  4HO8 A;  5C1H A;  3ZLL A;  1ZI5 A;  4FIY A;  3SPT A;  3HL3 A;  4D48 A;  3I0F A;  4HO5 A;  4Y7T A;  1FR9 A;  3Q7U A;  1ZJP A;  5C4D A;  1GQ9 A;  1ZJ3 A;  3K8E A;  4G3Q A;  4BQH A;  1FOA A;  3SXG A;  4E1K A;  1H7G A;  1H5T B;  1HM9 A;  4Y7V A;  1ON6 A;  2BO8 A;  4J18 A;  4KRV A;  4FRE A;  5C4F A;  2FYB A;  1IIN A;  1HV9 A;  2E8B A;  4D11 C;  1H4C A;  1H5S D;  2YC3 A;  4HO2 A;  4D0Z A;  4FCU A;  4IRQ A;  1VZX A;  1Z90 A;  1O23 B;  5FTV A;  1H7T A;  2JCO A;  3OGZ A;  1PZT A;  3ZGF A;  1HM8 A;  4HO3 A;  1VIC A;  4EEA A;  2O1F A;  3F1C A;  5HS2 A;  3Q4S A;  2FYC B;  2YES A;  5CQO A;  4EE4 A;  2WEE A;  2XWN A;  1GWV A;  4JIS A;  4B4B A;  2RIZ A;  3TZT A;  2YQJ A;  4G3P A;  3V0N A;  3IOJ A;  2RIT A;  1G23 A;  2RJ9 A;  1FO9 A;  3USQ A;  2BO6 A;  1ZHJ A;  3U2U A;  5IFY A;  1VZT A;  1VH3 A;  4C2S A;  1H3M A;  4G87 A;  2YCM A;  5FU0 A;  1ZIZ A;  3PNN A;  1PZY B;  1V84 A;  4B2W A;  3JTJ A;  3OH0 A;  4FRB A;  4KQL A;  2VS5 A;  2WAW A;  2P73 A;  4Q7C A;  1O7O A;  1ZI1 A;  1OQM B;  3I0E A;  3OC9 A;  2VS3 A;  1G97 A;  3RMW A;  4FRP A;  2V0H A;  3LW6 A;  1LZ7 A;  3DUV A;  1YP3 A;  3U2T A;  1H4E A;  1H5S C;  3SX3 A;  3I0I X;  1I52 A;  3NGW A;  4KC1 A;  3ST8 A;  2A8W A;  4HO4 A;  3SX5 A;  1E5K A;  3U0Y A;  1GX0 A;  5CQM X;  3V0Q A;  3KIA A;  1SS9 A;  4MYB A;  3V0M A;  1VPA A;  4AYL A;  1XZ6 A;  3OH1 A;  1R81 A;  2A8U A;  2X5S A;  3OH2 A;  4AYJ A;  3Q80 A;  4M4K A;  2V0J A;  2P6W A;  1ZI4 A;  1NKH B;  4FRD A;  4P02 A;  2RJ8 A;  4ARW A;  2APC A;  4M2B A;  4NAI A;  4YS8 A;  3TQD A;  1HJL A;  4FRO A;  2VSI A;  2W0V A;  1ZDF A;  4L41 C;  5IDS A;  5EIY A;  5CQL X;  2Z86 A;  2J0B A;  1LL3 A;  5D92 A;  2BO4 A;  2ZU7 A;  2E3D A;  4JD0 A;  5FYE A;  4BMA A;  4ASJ A;  1S4P A;  4HO9 A;  5C47 A;  4D0T A;  3V91 A;  4Y6U A;  4FRH A;  3SXC A;  5C4E A;  1V82 A;  1R7U A;  3QVB A;  1G93 A;  5J49 A;  2W0W A;  2WVK A;  5C8R A;  4AAW A;  2PX7 A;  4HO6 A;  1INJ A;  3SX7 A;  1ZCY A;  3I0L A;  4KNR A;  3T7M A;  2RJ4 A;  2X60 A;  1GWW A;  2Z87 A;  1KWS A;  2JCK A;  1TVY A;  2FFU A;  3FOQ A;  1ON8 A;  1R80 A;  2WVM A;  4D11 A;  4KPZ A;  4DDZ A;  1NWG B;  3RSB A;  3I0D A;  1EYR A;  1YRO B;  3JUJ A;  5CMJ A;  3D8V A;  2GGQ A;  3FWW A;  3K8D A;  2D0J A;  1FRW A;  1VZU A;  1FZW A;  2VFZ A;  4NAN A;  1FXJ A;  1TW5 A;  2OI6 A;  3R3I A;  4Y7U A;  2PGY A;  1G95 A;  5D91 A;  2YQS A;  1VGW A;  5CMI A;  2VS4 A;  1W55 A;  4Y7F A;  4Y7G A;  4IRP A;  1QGS A;  4CJB A;  3V90 A;  1WVC A;  2AM3 A;  4B4G A;  4ASY A;  4B2X A;  2V0L A;  1WT1 A;  3CKV A;  3E25 A;  1G8O A;  2RJ1 A;  4R7P A;  4EEM A;  1NF5 B;  3D5N A;  4KC2 A;  3SXB A;  2NXV A;  2XMH A;  1WT0 A;  1ZJ2 A;  1LL2 A;  1W77 A;  1H5R A;  5C3A A;  4ZDQ A;  4ECM A;  3JUK A;  3I0K A;  2J0A A;  1ZCV A;  2V0K A;  5C4C A;  2XWM A;  2Y6P A;  4HCQ A;  1G0R A;  4CJC A;  3V0L A;  2V0I A;  2Y4L A;  1NQI B;  2XWL A;  2YC5 A;  2DPW A;  1V83 A;  3CKN A;  2QGI A;  1S4O A;  5FUH A;  1YP2 A;  1LL0 A;  1H5S A;  1VH1 A;  1HM0 A;  4NAK A;  2WVL A;  2Y7A A;  3CGX A;  4HOC A;  4KNX A;  4KT7 A;  2JCL A;  1O7Q A;  4O6M A;  1NMM B;  1GX4 A;  4KC4 A;  1MC3 A;  5C48 A;  1G1L A;  2WGZ A;  1QGQ A;  2ZU9 A;  2I5K A;  4UEG A;  4K6R A;  1W57 A;  1TW1 A;  4HG6 A;  4XWI A;  4HO0 A;  3OH3 A;  2FY7 A;  5CMG X;  4Y63 A;  5C3D A;  2WE9 A;  3ZLK A;  2UX8 A;  5L6V A;  3O3P A;  3SX8 A;  4EE3 A;  1FGX A;  1FR8 A;  1O0R A;  2VXM A;  5C49 A;  2VSH A;  1XHB A;  3BCV A;  1ZDG A;  2Y4J A;  2D7R A;  3PKP A;  3I0H A;  5FTS A;  1ZI3 A;  4O6N A;  1H5T A;  3EE5 A;  2VXL A;  1JVG A;  4LW6 A;  5DDV A;  1ZJ0 A;  2OI5 A;  3ZGG A;  4CVH A;  4DEC A;  3U0X A;  1JYL A;  1FXO A;  1K4V A;  2FYA A;  2GGO A;  4AC3 A;  4MND A;  5IDT A;  5FU8 A;  3USR A;  2BO7 A;  1JYK A;  2AEC A;  5CQP A;  3OKR A;  1S4N A;  2AH9 A;  2I5E A;  2AM4 A;  1ZCT A;  1VM8 A;  1JV3 A;  5C1G A;  2FYD B;  5AJN A;  4DE7 A;  4EE5 A;  2RIY A;  2D7I A;  3SXA A;  5JQQ A;  1G3L A;  4NAL A;  1H4D A;  2VD4 A;  1EZI A;  4FRL A;  5AJO A;  3SXE A;  1OMX A;  2RIX A;  1LZJ A;  2AM5 A;  5EJ1 A;  1ZCU A;  1WT3 A;  4FIX A;  1LZI A;  1IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...