1ZJ0A

Crystal structure of human galactosyltransferase (gtb) complexed with lactose
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
284
structure length
265
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABO blood group (transferase A, alpha 1-3-N-acetylgalactosam
publication title Differential Recognition of the Type I and II H Antigen Acceptors by the Human ABO(H) Blood Group A and B Glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 265
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2005-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zj0A00
4HO8A 3V8ZA 1LZJA 3K8EA 1ZHJA 3V91A 1H7GA 2RJ6A 1G95A 1JV3A 1ZI3A 4B4GA 2Y4JA 3KIAA 3JTJA 1O7QA 2E3DA 3BRKX 4M2BA 1XZ6A 5CMHA 1LL0A 4KC4A 3RSBA 1ZCUA 2WVMA 1EYRA 1ZJOA 2JCLA 2W0VA 4P00A 4Y7TA 4MNDA 1H5SD 2FYBA 1LL2A 4NALA 5DDTA 4AAWA 1I52A 1LZ0A 3SX3A 4FRBA 3IOJA 3HL3A 5IDSA 3I0DA 1QGSA 3CKQA 4AYLA 1INJA 4Y63A 1G9RA 1H4EA 4G3SA 4KC2A 1G23A 4ZDQA 1FXJA 5FYEA 3OH2A 1GA8A 4JISA 3TZTA 5CQNX 2PGVA 2RJ0A 3IOIA 3BCVA 2OI6A 2FYAA 3V8YA 2AM3A 1GWWA 5FTVA 1FRWA 4B2WA 1H7TA 1LZIA 2Y7AA 4KXOA 3LW6A 1MP3A 2QGIA 1VGTA 1LVWA 1QG8A 1S4OA 4FRQA 4FRMA 1ZIZA 4B3UA 4D11C 2V0JA 3SXCA 4EEGA 4EE4A 3ZF8A 5C36A 5IFYA 1W55A 3U0YA 4EEOA 4B4MA 1ZDFA 3I0FA 1VH1A 2WGZA 2QKXA 1FXOA 2V0LA 1INIA 2BO6A 1ZCVA 1FZWA 2P73A 2DPWA 3CGXA 1R82A 1YP4A 4AYJA 3ZLLA 5CMFX 2APCA 5CMIA 4HG6A 1PZTA 2FFVA 5C3DA 2RJ1A 3ZGGA 4FCUA 1FR9A 2WAWA 4Y9XA 1FG5N 1G2VA 2I7BA 3FWWA 4AC3A 3DUVA 2VXLA 2VD4A 2YCMA 4K6RA 1FGXA 1G93A 5C4BA 5HS2A 2D0JA 3CKOA 4Y7GA 1WT3A 1NMMB 1WT1A 1HM0A 2I5EA 1GX4A 1G3LA 1WT2A 4G3PA 1MP4A 3V90A 2OEGA 4HO9A 3QVBA 1ZCYA 2WVLA 2RIXA 4J18A 1VGWA 5C8RA 2O1HA 5AJNA 2AM5A 2AGDA 5FV9A 1MP5A 4IRQA 3SX8A 1H4DA 5AJPA 1FR8A 1ON6A 5BXCA 1VZXA 2NXVA 1S4PA 5CQLX 3R3IA 3SXDA 4LW6A 1TVYA 3T7NA 1VGZA 2FY7A 2OI7A 1TW5A 3SX5A 1H4CA 3I0JA 3GUEA 5CMGX 1H5SC 5C48A 1E5KA 5EIYA 3I0CA 1Z90A 2FYDB 1GQCA 1GX0A 1NWGB 3USRA 3Q4SA 4KPZA 4BQHA 3PKQA 4HCQA 1FGGA 2YQSA 3OC9A 1JYLA 1QWJA 5C3AA 5C38A 3PKPA 1W57A 1R80A 2BO8A 3D98A 2I5KA 3OH4A 1FO8A 2V0IA 1YP2A 3V0MA 5J49A 1HJJA 2YQJA 1IINA 4HO6A 2V0HA 1ON8A 4EEMA 1H7FA 1LZ7A 5C4CA 4D48A 2JCKA 4HO0A 1JV1A 1JVDA 2GGQA 1WVCA 2ZU9A 3OAMA 1G97A 1W77A 3V0LA 2RJ5A 5AJOA 1R7UA 5FTSA 1G0RA 2GGOA 3USQA 1SS9A 3JUKA 5EJ1A 5JQQA 5I1FA 4FRAA 1VGUA 1VPAA 4KNRA 1WT0A 1H7LA 1H7QA 1OMXA 2VS3A 1HJLA 4B42A 5CQMX 4ASYA 4ECMA 1QGQA 5C4DA 4MYBA 3O3PA 2A8WA 3I0KA 2YESA 1R7VA 1VICA 2X5ZA 3T7MA 2Q4JA 1G8OA 2D7RA 2VS5A 2PA4A 2PGYA 3T7OA 4EEAA 4G87A 3E25A 5C4FA 1H3MA 2JCJA 4NAKA 1NQIB 4D11A 2XWMA 5C49A 1IIMA 1V83A 4D0ZA 2CU2A 3I0HA 4Y6UA 2XWLA 5C4EA 5C1GA 1TW1A 1V82A 1VZTA 4GBPA 4HOCA 4FRLA 1OQMB 1PZYB 2MZBA 4DECA 4KRVA 3I0LA 4Y64A 1G1LA 2RIYA 1EZIA 3DJ4A 3FOQA 4FRPA 5C1HA 2P6WA 2Y4LA 1LL3A 1ZJ3A 2X65A 4YS8A 4ARWA 3OH1A 1YP3A 3SXEA 3POLA 2WE9A 3SXAA 5CQOA 3SX7A 1R7XA 3D8VA 4FRHA 3SXBA 4XWIA 2AESA 3E26A 4FROA 1GQ9A 3U2WA 2VFZA 2AE7A 1H7HA 2W0WA 2VSIA 3OH0A 3ST8A 4P02A 5EJZA 1O23B 5IDTA 2XMEA 4Y6NA 4B2XA 1V84A 1ZI1A 4M2AA 1JYKA 3U0XA 2XWNA 1R81A 4D0TA 1K4VA 1NF5B 5L6SA 3V0PA 2YQCA 1R7YA 2XMHA 2WVKA 4Y7UA 4DE7A 2YQHA 2Y4MA 3JUJA 1ZDGA 3D5NA 3PNNA 2P72A 5C1LA 3K8DA 2RJ8A 2OI5A 2BO4A 4Y62A 2AECA 1O0RA 1GWVA 1ZJ2A 2OEFA 4M4KA 1ZJ0A 1H5SA 4NAIA 4UEGA 3U2UA 4C2SA 2ZU7A 4HO4A 3CKJA 2QH5A 4HO2A 2O1GA 5FUHA 1ZI5A 1VM8A 1NKHB 2AM4A 4CJBA 4FCEA 4B5BA 2BO7A 2Y6PA 2YC3A 1O7OA 4EE3A 5FU8A 2RIZA 3RMVA 4EVWA 1ZI4A 4BMAA 1KWSA 3OGZA 1MC3A 3Q7UA 3CKNA 2V0KA 2RJ9A 4FREA 1HV9A 2X5SA 1S4NA 4CVHA 3OKRA 2ICYA 2PX7A 1ZJPA 3ZGFA 4NANA 1H7EA 4HO5A 1H5TA 3U2TA 3TQDA 5DDVA 2ICXA 1VZUA 3I0EA 1H5SB 2UX8A 2Z87A 3F1CA 4LW3A 3V0NA 3N9WA 1NHEB 2VS4A 3V0QA 1FO9A 2ZU8A 2YC5A 3U2XA 1H5RA 1OMZA 3CKVA 4R7PA 1TZFA 1YROB 5C47A 4L41C 2RJ4A 1FWYA 3ZLKA 1ZCTA 2AH9A 3SPTA 1WSZA 2WEEA 3EE5A 4EE5A 5CQPA 2VSHA 2Z86A 2D7IA 4G3QA 2FFUA 3CU0A 4CJ8A 1H5TB 1VH3A 1HM9A 3R2WA 4FRDA 4KNXA 4E1KA 3DK5A 2FYCB 2RJ7A 1ZJ1A 2JCOA 4Y7FA 3I0IX 3OH3A 3RMWA 4Y7VA 1H5RB 5C3BA 4IRPA 2E8BA 4KC1A 2X60A 4B4BA 4M28A 1FOAA 1XHBA 5L6VA 3F1YA 3U2VA 3V0OA 2A8UA 2Y4KA 3NGWA 2O1FA 5FU0A 1HM8A 4KPXA 4CJCA 1R7TA 4KQLA 4HO3A 3IOHA 3SXGA 4KT7A 1JVGA 3Q80A 2RITA 4DDZA 4ASJA 2VXMA 4FQWA 3I0GA 4JD0A 5CMJA
chains in the Genus database with same CATH superfamily
4HO8A 3V8ZA 1LZJA 3K8EA 1ZHJA 3V91A 1H7GA 2RJ6A 1G95A 1JV3A 1ZI3A 4B4GA 2Y4JA 3KIAA 3JTJA 1O7QA 2E3DA 3BRKX 4M2BA 1XZ6A 5CMHA 1LL0A 4KC4A 3RSBA 1ZCUA 2WVMA 1EYRA 1ZJOA 2JCLA 2W0VA 4P00A 4Y7TA 4MNDA 1H5SD 2FYBA 1LL2A 4NALA 5D91A 5DDTA 1I52A 1LZ0A 4AAWA 3SX3A 4FRBA 3IOJA 3HL3A 5IDSA 3I0DA 1QGSA 3CKQA 4MIXA 4AYLA 1INJA 4Y63A 1G9RA 1H4EA 4G3SA 4KC2A 1G23A 4ZDQA 1FXJA 5FYEA 3OH2A 1GA8A 4JISA 3TZTA 5CQNX 2PGVA 2RJ0A 3IOIA 3BCVA 2OI6A 2FYAA 3V8YA 2AM3A 1GWWA 5FTVA 1FRWA 4B2WA 1H7TA 1LZIA 2Y7AA 4KXOA 3LW6A 1MP3A 2QGIA 1VGTA 1LVWA 1QG8A 1S4OA 4FRQA 4FRMA 1ZIZA 4B3UA 4D11C 2V0JA 3SXCA 4EEGA 4EE4A 3ZF8A 5C36A 5IFYA 1W55A 3U0YA 4EEOA 4B4MA 1ZDFA 3I0FA 1VH1A 2WGZA 2QKXA 1FXOA 2V0LA 1INIA 2BO6A 1ZCVA 1FZWA 2P73A 2DPWA 3CGXA 1R82A 1YP4A 4AYJA 3ZLLA 5CMFX 2APCA 5CMIA 4HG6A 1PZTA 2FFVA 5C3DA 2RJ1A 3ZGGA 4FCUA 1FR9A 2WAWA 4Y9XA 1FG5N 1G2VA 2I7BA 3FWWA 4AC3A 3DUVA 2VXLA 2VD4A 2YCMA 4K6RA 1FGXA 1G93A 5C4BA 5HS2A 2D0JA 3CKOA 4Y7GA 1WT3A 1NMMB 1WT1A 1HM0A 2I5EA 1GX4A 1G3LA 1WT2A 4G3PA 1MP4A 3V90A 2OEGA 4HO9A 3QVBA 1ZCYA 2WVLA 2RIXA 4J18A 1VGWA 5C8RA 2O1HA 5AJNA 2AM5A 2AGDA 5FV9A 1MP5A 4IRQA 3SX8A 1H4DA 5AJPA 1FR8A 1ON6A 5BXCA 1VZXA 2NXVA 1S4PA 5CQLX 3R3IA 4FIYA 3SXDA 4LW6A 1TVYA 3T7NA 1VGZA 2FY7A 2OI7A 1TW5A 3SX5A 1H4CA 3I0JA 3GUEA 5CMGX 1H5SC 5C48A 1E5KA 5EIYA 3I0CA 1Z90A 2FYDB 1GQCA 1GX0A 1NWGB 3USRA 3Q4SA 4KPZA 4BQHA 3PKQA 4HCQA 1FGGA 2YQSA 3OC9A 1JYLA 1QWJA 5C3AA 2C0NA 5C38A 3PKPA 1W57A 1R80A 2BO8A 3D98A 2I5KA 3OH4A 1FO8A 2V0IA 1YP2A 3V0MA 5J49A 1HJJA 2YQJA 1IINA 4HO6A 2V0HA 1ON8A 4EEMA 1H7FA 1LZ7A 5C4CA 4D48A 2JCKA 4HO0A 1JV1A 1JVDA 2GGQA 4O6NA 1WVCA 2ZU9A 3OAMA 1G97A 1W77A 3V0LA 2RJ5A 5AJOA 1R7UA 5FTSA 1G0RA 2GGOA 3USQA 1SS9A 3JUKA 5EJ1A 5JQQA 5I1FA 4FRAA 1VGUA 1VPAA 4KNRA 1WT0A 1H7LA 1H7QA 1OMXA 2VS3A 1HJLA 4B42A 5CQMX 4ASYA 4ECMA 1QGQA 5C4DA 4MYBA 3O3PA 2A8WA 3I0KA 2YESA 1R7VA 1VICA 2X5ZA 3T7MA 2Q4JA 1G8OA 2D7RA 2VS5A 2PA4A 2PGYA 3T7OA 4EEAA 4G87A 3E25A 5C4FA 1H3MA 2JCJA 4NAKA 1NQIB 4D11A 2XWMA 5C49A 1IIMA 1V83A 4D0ZA 2CU2A 3I0HA 4Y6UA 2XWLA 5C4EA 5C1GA 1TW1A 1V82A 1VZTA 4GBPA 4HOCA 4FRLA 1OQMB 1PZYB 2MZBA 4DECA 4KRVA 3I0LA 4Y64A 1G1LA 2RIYA 1EZIA 3DJ4A 3FOQA 4FRPA 5C1HA 2P6WA 2Y4LA 1LL3A 1ZJ3A 2X65A 4YS8A 4ARWA 3OH1A 1YP3A 3SXEA 3POLA 2WE9A 3SXAA 5CQOA 3SX7A 1R7XA 3D8VA 4FRHA 3SXBA 4XWIA 2AESA 2J0BA 3E26A 4FROA 1GQ9A 2VK9A 3U2WA 2VFZA 2AE7A 1H7HA 2W0WA 2VSIA 3OH0A 3ST8A 4P02A 5EJZA 1O23B 4O6MA 5IDTA 2XMEA 4Y6NA 4B2XA 1V84A 1ZI1A 4M2AA 1JYKA 3U0XA 2XWNA 1R81A 4D0TA 1K4VA 1NF5B 5L6SA 3V0PA 5D92A 2YQCA 1R7YA 2XMHA 2WVKA 4Y7UA 4DE7A 2YQHA 2Y4MA 3JUJA 1ZDGA 3D5NA 3PNNA 2P72A 5C1LA 3K8DA 2RJ8A 2OI5A 2BO4A 4Y62A 2AECA 1O0RA 1GWVA 1ZJ2A 2OEFA 4M4KA 1ZJ0A 1H5SA 4NAIA 4UEGA 3U2UA 4C2SA 2ZU7A 4HO4A 3CKJA 2QH5A 4HO2A 2O1GA 5FUHA 1ZI5A 1VM8A 1NKHB 2AM4A 4CJBA 4FCEA 4B5BA 2BO7A 2Y6PA 2YC3A 1O7OA 4EE3A 5FU8A 2RIZA 3RMVA 4EVWA 1ZI4A 4BMAA 1KWSA 3OGZA 1MC3A 3Q7UA 3CKNA 2V0KA 2RJ9A 4FREA 1HV9A 2X5SA 1S4NA 4CVHA 3OKRA 2ICYA 2PX7A 1ZJPA 3ZGFA 4NANA 1H7EA 4HO5A 1H5TA 3U2TA 3TQDA 5DDVA 2ICXA 1VZUA 3I0EA 1H5SB 2UX8A 2Z87A 3F1CA 4LW3A 3V0NA 3N9WA 1NHEB 2VS4A 3V0QA 1FO9A 2ZU8A 2YC5A 3U2XA 1H5RA 1OMZA 3CKVA 4R7PA 1TZFA 1YROB 5C47A 4L41C 2RJ4A 1FWYA 3ZLKA 1ZCTA 4Q7CA 2AH9A 3SPTA 1WSZA 2WEEA 3EE5A 4EE5A 5CQPA 2VSHA 2Z86A 2D7IA 4G3QA 2FFUA 3CU0A 4CJ8A 1H5TB 1VH3A 1HM9A 3R2WA 4FRDA 4KNXA 4E1KA 3DK5A 2FYCB 2RJ7A 1ZJ1A 2JCOA 4Y7FA 3I0IX 3OH3A 3RMWA 4FIXA 4Y7VA 1H5RB 5C3BA 4IRPA 2E8BA 4KC1A 2X60A 4B4BA 4M28A 1FOAA 1XHBA 5L6VA 3F1YA 3U2VA 3V0OA 2A8UA 2Y4KA 3NGWA 2O1FA 5FU0A 1HM8A 4KPXA 4CJCA 1R7TA 4KQLA 4HO3A 3IOHA 3SXGA 4KT7A 2J0AA 1JVGA 3Q80A 2RITA 4DDZA 4ASJA 2VXMA 4FQWA 3I0GA 4JD0A 5CMJA
chains in the Genus database with same CATH topology
4HO8A 3V8ZA 1LZJA 3K8EA 1ZHJA 3V91A 1H7GA 2RJ6A 1G95A 1JV3A 1ZI3A 4B4GA 2Y4JA 3KIAA 3JTJA 1O7QA 2E3DA 3BRKX 4M2BA 1XZ6A 5CMHA 1LL0A 4KC4A 3RSBA 1ZCUA 2WVMA 1EYRA 1ZJOA 2JCLA 2W0VA 4P00A 4Y7TA 4MNDA 1H5SD 2FYBA 1LL2A 4NALA 5D91A 5DDTA 1I52A 1LZ0A 4AAWA 3SX3A 4FRBA 3IOJA 3HL3A 5IDSA 3I0DA 1QGSA 3CKQA 4MIXA 4AYLA 1INJA 4Y63A 1G9RA 1H4EA 4G3SA 4KC2A 1G23A 4ZDQA 1FXJA 5FYEA 3OH2A 1GA8A 4JISA 3TZTA 5CQNX 2PGVA 2RJ0A 3IOIA 3BCVA 2OI6A 2FYAA 3V8YA 2AM3A 1GWWA 5FTVA 1FRWA 4B2WA 1H7TA 1LZIA 2Y7AA 4KXOA 3LW6A 1MP3A 2QGIA 1VGTA 1LVWA 1QG8A 1S4OA 4FRQA 4FRMA 1ZIZA 4B3UA 4D11C 2V0JA 3SXCA 4EEGA 4EE4A 3ZF8A 5C36A 5IFYA 1W55A 3U0YA 4EEOA 4B4MA 1ZDFA 3I0FA 1VH1A 2WGZA 2QKXA 1FXOA 2V0LA 1INIA 2BO6A 1ZCVA 1FZWA 2P73A 2DPWA 3CGXA 1R82A 1YP4A 4AYJA 3ZLLA 5CMFX 2APCA 5CMIA 4HG6A 1PZTA 2FFVA 5C3DA 2RJ1A 3ZGGA 4FCUA 1FR9A 2WAWA 4Y9XA 1FG5N 1G2VA 2I7BA 3FWWA 4AC3A 3DUVA 2VXLA 2VD4A 2YCMA 4K6RA 1FGXA 1G93A 5C4BA 5HS2A 2D0JA 3CKOA 4Y7GA 1WT3A 1NMMB 1WT1A 1HM0A 2I5EA 1GX4A 1G3LA 1WT2A 4G3PA 1MP4A 3V90A 2OEGA 4HO9A 3QVBA 1ZCYA 2WVLA 2RIXA 4J18A 1VGWA 5C8RA 2O1HA 5AJNA 2AM5A 2AGDA 5FV9A 1MP5A 4IRQA 3SX8A 1H4DA 5AJPA 1FR8A 1ON6A 5BXCA 1VZXA 2NXVA 1S4PA 5CQLX 3R3IA 4FIYA 3SXDA 4LW6A 1TVYA 3T7NA 1VGZA 2FY7A 2OI7A 1TW5A 3SX5A 1H4CA 3I0JA 3GUEA 5CMGX 1H5SC 5C48A 1E5KA 5EIYA 3I0CA 1Z90A 2FYDB 1GQCA 1GX0A 1NWGB 3USRA 3Q4SA 4KPZA 4BQHA 3PKQA 4HCQA 1FGGA 2YQSA 3OC9A 1JYLA 1QWJA 5C3AA 2C0NA 5C38A 3PKPA 1W57A 1R80A 2BO8A 3D98A 2I5KA 3OH4A 1FO8A 2V0IA 1YP2A 3V0MA 5J49A 1HJJA 2YQJA 1IINA 4HO6A 2V0HA 1ON8A 4EEMA 1H7FA 1LZ7A 5C4CA 4D48A 2JCKA 4HO0A 1JV1A 1JVDA 2GGQA 4O6NA 1WVCA 2ZU9A 3OAMA 1G97A 1W77A 3V0LA 2RJ5A 5AJOA 1R7UA 5FTSA 1G0RA 2GGOA 3USQA 1SS9A 3JUKA 5EJ1A 5JQQA 5I1FA 4FRAA 1VGUA 1VPAA 4KNRA 1WT0A 1H7LA 1H7QA 1OMXA 2VS3A 1HJLA 4B42A 5CQMX 4ASYA 4ECMA 1QGQA 5C4DA 4MYBA 3O3PA 2A8WA 3I0KA 2YESA 1R7VA 1VICA 2X5ZA 3T7MA 2Q4JA 1G8OA 2D7RA 2VS5A 2PA4A 2PGYA 3T7OA 4EEAA 4G87A 3E25A 5C4FA 1H3MA 2JCJA 4NAKA 1NQIB 4D11A 2XWMA 5C49A 1IIMA 1V83A 4D0ZA 2CU2A 3I0HA 4Y6UA 2XWLA 5C4EA 5C1GA 1TW1A 1V82A 1VZTA 4GBPA 4HOCA 4FRLA 1OQMB 1PZYB 2MZBA 4DECA 4KRVA 3I0LA 4Y64A 1G1LA 2RIYA 1EZIA 3DJ4A 3FOQA 4FRPA 5C1HA 2P6WA 2Y4LA 1LL3A 1ZJ3A 2X65A 4YS8A 4ARWA 3OH1A 1YP3A 3SXEA 3POLA 2WE9A 3SXAA 5CQOA 3SX7A 1R7XA 3D8VA 4FRHA 3SXBA 4XWIA 2AESA 2J0BA 3E26A 4FROA 1GQ9A 2VK9A 3U2WA 2VFZA 2AE7A 1H7HA 2W0WA 2VSIA 3OH0A 3ST8A 4P02A 5EJZA 1O23B 4O6MA 5IDTA 2XMEA 4Y6NA 4B2XA 1V84A 1ZI1A 4M2AA 1JYKA 3U0XA 2XWNA 1R81A 4D0TA 1K4VA 1NF5B 5L6SA 3V0PA 5D92A 2YQCA 1R7YA 2XMHA 2WVKA 4Y7UA 4DE7A 2YQHA 2Y4MA 3JUJA 1ZDGA 3D5NA 3PNNA 2P72A 5C1LA 3K8DA 2RJ8A 2OI5A 2BO4A 4Y62A 2AECA 1O0RA 1GWVA 1ZJ2A 2OEFA 4M4KA 1ZJ0A 1H5SA 4NAIA 4UEGA 3U2UA 4C2SA 2ZU7A 4HO4A 3CKJA 2QH5A 4HO2A 2O1GA 5FUHA 1ZI5A 1VM8A 1NKHB 2AM4A 4CJBA 4FCEA 4B5BA 2BO7A 2Y6PA 2YC3A 1O7OA 4EE3A 5FU8A 2RIZA 3RMVA 4EVWA 1ZI4A 4BMAA 1KWSA 3OGZA 1MC3A 3Q7UA 3CKNA 2V0KA 2RJ9A 4FREA 1HV9A 2X5SA 1S4NA 4CVHA 3OKRA 2ICYA 2PX7A 1ZJPA 3ZGFA 4NANA 1H7EA 4HO5A 1H5TA 3U2TA 3TQDA 5DDVA 2ICXA 1VZUA 3I0EA 1H5SB 2UX8A 2Z87A 3F1CA 4LW3A 3V0NA 3N9WA 1NHEB 2VS4A 3V0QA 1FO9A 2ZU8A 2YC5A 3U2XA 1H5RA 1OMZA 3CKVA 4R7PA 1TZFA 1YROB 5C47A 4L41C 2RJ4A 1FWYA 3ZLKA 1ZCTA 4Q7CA 2AH9A 3SPTA 1WSZA 2WEEA 3EE5A 4EE5A 5CQPA 2VSHA 2Z86A 2D7IA 4G3QA 2FFUA 3CU0A 4CJ8A 1H5TB 1VH3A 1HM9A 3R2WA 4FRDA 4KNXA 4E1KA 3DK5A 2FYCB 2RJ7A 1ZJ1A 2JCOA 4Y7FA 3I0IX 3OH3A 3RMWA 4FIXA 4Y7VA 1H5RB 5C3BA 4IRPA 2E8BA 4KC1A 2X60A 4B4BA 4M28A 1FOAA 1XHBA 5L6VA 3F1YA 3U2VA 3V0OA 2A8UA 2Y4KA 3NGWA 2O1FA 5FU0A 1HM8A 4KPXA 4CJCA 1R7TA 4KQLA 4HO3A 3IOHA 3SXGA 4KT7A 2J0AA 1JVGA 3Q80A 2RITA 4DDZA 4ASJA 2VXMA 4FQWA 3I0GA 4JD0A 5CMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO8 A;  3V8Z A;  1LZJ A;  3K8E A;  1ZHJ A;  3V91 A;  1H7G A;  2RJ6 A;  1G95 A;  1JV3 A;  1ZI3 A;  4B4G A;  2Y4J A;  3KIA A;  3JTJ A;  1O7Q A;  2E3D A;  3BRK X;  4M2B A;  1XZ6 A;  5CMH A;  1LL0 A;  4KC4 A;  3RSB A;  1ZCU A;  2WVM A;  1EYR A;  1ZJO A;  2JCL A;  2W0V A;  4P00 A;  4Y7T A;  4MND A;  1H5S D;  2FYB A;  1LL2 A;  4NAL A;  5DDT A;  4AAW A;  1I52 A;  1LZ0 A;  3SX3 A;  4FRB A;  3IOJ A;  3HL3 A;  5IDS A;  3I0D A;  1QGS A;  3CKQ A;  4AYL A;  1INJ A;  4Y63 A;  1G9R A;  1H4E A;  4G3S A;  4KC2 A;  1G23 A;  4ZDQ A;  1FXJ A;  5FYE A;  3OH2 A;  1GA8 A;  4JIS A;  3TZT A;  5CQN X;  2PGV A;  2RJ0 A;  3IOI A;  3BCV A;  2OI6 A;  2FYA A;  3V8Y A;  2AM3 A;  1GWW A;  5FTV A;  1FRW A;  4B2W A;  1H7T A;  1LZI A;  2Y7A A;  4KXO A;  3LW6 A;  1MP3 A;  2QGI A;  1VGT A;  1LVW A;  1QG8 A;  1S4O A;  4FRQ A;  4FRM A;  1ZIZ A;  4B3U A;  4D11 C;  2V0J A;  3SXC A;  4EEG A;  4EE4 A;  3ZF8 A;  5C36 A;  5IFY A;  1W55 A;  3U0Y A;  4EEO A;  4B4M A;  1ZDF A;  3I0F A;  1VH1 A;  2WGZ A;  2QKX A;  1FXO A;  2V0L A;  1INI A;  2BO6 A;  1ZCV A;  1FZW A;  2P73 A;  2DPW A;  3CGX A;  1R82 A;  1YP4 A;  4AYJ A;  3ZLL A;  5CMF X;  2APC A;  5CMI A;  4HG6 A;  1PZT A;  2FFV A;  5C3D A;  2RJ1 A;  3ZGG A;  4FCU A;  1FR9 A;  2WAW A;  4Y9X A;  1FG5 N;  1G2V A;  2I7B A;  3FWW A;  4AC3 A;  3DUV A;  2VXL A;  2VD4 A;  2YCM A;  4K6R A;  1FGX A;  1G93 A;  5C4B A;  5HS2 A;  2D0J A;  3CKO A;  4Y7G A;  1WT3 A;  1NMM B;  1WT1 A;  1HM0 A;  2I5E A;  1GX4 A;  1G3L A;  1WT2 A;  4G3P A;  1MP4 A;  3V90 A;  2OEG A;  4HO9 A;  3QVB A;  1ZCY A;  2WVL A;  2RIX A;  4J18 A;  1VGW A;  5C8R A;  2O1H A;  5AJN A;  2AM5 A;  2AGD A;  5FV9 A;  1MP5 A;  4IRQ A;  3SX8 A;  1H4D A;  5AJP A;  1FR8 A;  1ON6 A;  5BXC A;  1VZX A;  2NXV A;  1S4P A;  5CQL X;  3R3I A;  3SXD A;  4LW6 A;  1TVY A;  3T7N A;  1VGZ A;  2FY7 A;  2OI7 A;  1TW5 A;  3SX5 A;  1H4C A;  3I0J A;  3GUE A;  5CMG X;  1H5S C;  5C48 A;  1E5K A;  5EIY A;  3I0C A;  1Z90 A;  2FYD B;  1GQC A;  1GX0 A;  1NWG B;  3USR A;  3Q4S A;  4KPZ A;  4BQH A;  3PKQ A;  4HCQ A;  1FGG A;  2YQS A;  3OC9 A;  1JYL A;  1QWJ A;  5C3A A;  5C38 A;  3PKP A;  1W57 A;  1R80 A;  2BO8 A;  3D98 A;  2I5K A;  3OH4 A;  1FO8 A;  2V0I A;  1YP2 A;  3V0M A;  5J49 A;  1HJJ A;  2YQJ A;  1IIN A;  4HO6 A;  2V0H A;  1ON8 A;  4EEM A;  1H7F A;  1LZ7 A;  5C4C A;  4D48 A;  2JCK A;  4HO0 A;  1JV1 A;  1JVD A;  2GGQ A;  1WVC A;  2ZU9 A;  3OAM A;  1G97 A;  1W77 A;  3V0L A;  2RJ5 A;  5AJO A;  1R7U A;  5FTS A;  1G0R A;  2GGO A;  3USQ A;  1SS9 A;  3JUK A;  5EJ1 A;  5JQQ A;  5I1F A;  4FRA A;  1VGU A;  1VPA A;  4KNR A;  1WT0 A;  1H7L A;  1H7Q A;  1OMX A;  2VS3 A;  1HJL A;  4B42 A;  5CQM X;  4ASY A;  4ECM A;  1QGQ A;  5C4D A;  4MYB A;  3O3P A;  2A8W A;  3I0K A;  2YES A;  1R7V A;  1VIC A;  2X5Z A;  3T7M A;  2Q4J A;  1G8O A;  2D7R A;  2VS5 A;  2PA4 A;  2PGY A;  3T7O A;  4EEA A;  4G87 A;  3E25 A;  5C4F A;  1H3M A;  2JCJ A;  4NAK A;  1NQI B;  4D11 A;  2XWM A;  5C49 A;  1IIM A;  1V83 A;  4D0Z A;  2CU2 A;  3I0H A;  4Y6U A;  2XWL A;  5C4E A;  5C1G A;  1TW1 A;  1V82 A;  1VZT A;  4GBP A;  4HOC A;  4FRL A;  1OQM B;  1PZY B;  2MZB A;  4DEC A;  4KRV A;  3I0L A;  4Y64 A;  1G1L A;  2RIY A;  1EZI A;  3DJ4 A;  3FOQ A;  4FRP A;  5C1H A;  2P6W A;  2Y4L A;  1LL3 A;  1ZJ3 A;  2X65 A;  4YS8 A;  4ARW A;  3OH1 A;  1YP3 A;  3SXE A;  3POL A;  2WE9 A;  3SXA A;  5CQO A;  3SX7 A;  1R7X A;  3D8V A;  4FRH A;  3SXB A;  4XWI A;  2AES A;  3E26 A;  4FRO A;  1GQ9 A;  3U2W A;  2VFZ A;  2AE7 A;  1H7H A;  2W0W A;  2VSI A;  3OH0 A;  3ST8 A;  4P02 A;  5EJZ A;  1O23 B;  5IDT A;  2XME A;  4Y6N A;  4B2X A;  1V84 A;  1ZI1 A;  4M2A A;  1JYK A;  3U0X A;  2XWN A;  1R81 A;  4D0T A;  1K4V A;  1NF5 B;  5L6S A;  3V0P A;  2YQC A;  1R7Y A;  2XMH A;  2WVK A;  4Y7U A;  4DE7 A;  2YQH A;  2Y4M A;  3JUJ A;  1ZDG A;  3D5N A;  3PNN A;  2P72 A;  5C1L A;  3K8D A;  2RJ8 A;  2OI5 A;  2BO4 A;  4Y62 A;  2AEC A;  1O0R A;  1GWV A;  1ZJ2 A;  2OEF A;  4M4K A;  1ZJ0 A;  1H5S A;  4NAI A;  4UEG A;  3U2U A;  4C2S A;  2ZU7 A;  4HO4 A;  3CKJ A;  2QH5 A;  4HO2 A;  2O1G A;  5FUH A;  1ZI5 A;  1VM8 A;  1NKH B;  2AM4 A;  4CJB A;  4FCE A;  4B5B A;  2BO7 A;  2Y6P A;  2YC3 A;  1O7O A;  4EE3 A;  5FU8 A;  2RIZ A;  3RMV A;  4EVW A;  1ZI4 A;  4BMA A;  1KWS A;  3OGZ A;  1MC3 A;  3Q7U A;  3CKN A;  2V0K A;  2RJ9 A;  4FRE A;  1HV9 A;  2X5S A;  1S4N A;  4CVH A;  3OKR A;  2ICY A;  2PX7 A;  1ZJP A;  3ZGF A;  4NAN A;  1H7E A;  4HO5 A;  1H5T A;  3U2T A;  3TQD A;  5DDV A;  2ICX A;  1VZU A;  3I0E A;  1H5S B;  2UX8 A;  2Z87 A;  3F1C A;  4LW3 A;  3V0N A;  3N9W A;  1NHE B;  2VS4 A;  3V0Q A;  1FO9 A;  2ZU8 A;  2YC5 A;  3U2X A;  1H5R A;  1OMZ A;  3CKV A;  4R7P A;  1TZF A;  1YRO B;  5C47 A;  4L41 C;  2RJ4 A;  1FWY A;  3ZLK A;  1ZCT A;  2AH9 A;  3SPT A;  1WSZ A;  2WEE A;  3EE5 A;  4EE5 A;  5CQP A;  2VSH A;  2Z86 A;  2D7I A;  4G3Q A;  2FFU A;  3CU0 A;  4CJ8 A;  1H5T B;  1VH3 A;  1HM9 A;  3R2W A;  4FRD A;  4KNX A;  4E1K A;  3DK5 A;  2FYC B;  2RJ7 A;  1ZJ1 A;  2JCO A;  4Y7F A;  3I0I X;  3OH3 A;  3RMW A;  4Y7V A;  1H5R B;  5C3B A;  4IRP A;  2E8B A;  4KC1 A;  2X60 A;  4B4B A;  4M28 A;  1FOA A;  1XHB A;  5L6V A;  3F1Y A;  3U2V A;  3V0O A;  2A8U A;  2Y4K A;  3NGW A;  2O1F A;  5FU0 A;  1HM8 A;  4KPX A;  4CJC A;  1R7T A;  4KQL A;  4HO3 A;  3IOH A;  3SXG A;  4KT7 A;  1JVG A;  3Q80 A;  2RIT A;  4DDZ A;  4ASJ A;  2VXM A;  4FQW A;  3I0G A;  4JD0 A;  5CMJ A; 
#chains in the Genus database with same CATH topology
 4HO8 A;  3V8Z A;  1LZJ A;  3K8E A;  1ZHJ A;  3V91 A;  1H7G A;  2RJ6 A;  1G95 A;  1JV3 A;  1ZI3 A;  4B4G A;  2Y4J A;  3KIA A;  3JTJ A;  1O7Q A;  2E3D A;  3BRK X;  4M2B A;  1XZ6 A;  5CMH A;  1LL0 A;  4KC4 A;  3RSB A;  1ZCU A;  2WVM A;  1EYR A;  1ZJO A;  2JCL A;  2W0V A;  4P00 A;  4Y7T A;  4MND A;  1H5S D;  2FYB A;  1LL2 A;  4NAL A;  5D91 A;  5DDT A;  1I52 A;  1LZ0 A;  4AAW A;  3SX3 A;  4FRB A;  3IOJ A;  3HL3 A;  5IDS A;  3I0D A;  1QGS A;  3CKQ A;  4MIX A;  4AYL A;  1INJ A;  4Y63 A;  1G9R A;  1H4E A;  4G3S A;  4KC2 A;  1G23 A;  4ZDQ A;  1FXJ A;  5FYE A;  3OH2 A;  1GA8 A;  4JIS A;  3TZT A;  5CQN X;  2PGV A;  2RJ0 A;  3IOI A;  3BCV A;  2OI6 A;  2FYA A;  3V8Y A;  2AM3 A;  1GWW A;  5FTV A;  1FRW A;  4B2W A;  1H7T A;  1LZI A;  2Y7A A;  4KXO A;  3LW6 A;  1MP3 A;  2QGI A;  1VGT A;  1LVW A;  1QG8 A;  1S4O A;  4FRQ A;  4FRM A;  1ZIZ A;  4B3U A;  4D11 C;  2V0J A;  3SXC A;  4EEG A;  4EE4 A;  3ZF8 A;  5C36 A;  5IFY A;  1W55 A;  3U0Y A;  4EEO A;  4B4M A;  1ZDF A;  3I0F A;  1VH1 A;  2WGZ A;  2QKX A;  1FXO A;  2V0L A;  1INI A;  2BO6 A;  1ZCV A;  1FZW A;  2P73 A;  2DPW A;  3CGX A;  1R82 A;  1YP4 A;  4AYJ A;  3ZLL A;  5CMF X;  2APC A;  5CMI A;  4HG6 A;  1PZT A;  2FFV A;  5C3D A;  2RJ1 A;  3ZGG A;  4FCU A;  1FR9 A;  2WAW A;  4Y9X A;  1FG5 N;  1G2V A;  2I7B A;  3FWW A;  4AC3 A;  3DUV A;  2VXL A;  2VD4 A;  2YCM A;  4K6R A;  1FGX A;  1G93 A;  5C4B A;  5HS2 A;  2D0J A;  3CKO A;  4Y7G A;  1WT3 A;  1NMM B;  1WT1 A;  1HM0 A;  2I5E A;  1GX4 A;  1G3L A;  1WT2 A;  4G3P A;  1MP4 A;  3V90 A;  2OEG A;  4HO9 A;  3QVB A;  1ZCY A;  2WVL A;  2RIX A;  4J18 A;  1VGW A;  5C8R A;  2O1H A;  5AJN A;  2AM5 A;  2AGD A;  5FV9 A;  1MP5 A;  4IRQ A;  3SX8 A;  1H4D A;  5AJP A;  1FR8 A;  1ON6 A;  5BXC A;  1VZX A;  2NXV A;  1S4P A;  5CQL X;  3R3I A;  4FIY A;  3SXD A;  4LW6 A;  1TVY A;  3T7N A;  1VGZ A;  2FY7 A;  2OI7 A;  1TW5 A;  3SX5 A;  1H4C A;  3I0J A;  3GUE A;  5CMG X;  1H5S C;  5C48 A;  1E5K A;  5EIY A;  3I0C A;  1Z90 A;  2FYD B;  1GQC A;  1GX0 A;  1NWG B;  3USR A;  3Q4S A;  4KPZ A;  4BQH A;  3PKQ A;  4HCQ A;  1FGG A;  2YQS A;  3OC9 A;  1JYL A;  1QWJ A;  5C3A A;  2C0N A;  5C38 A;  3PKP A;  1W57 A;  1R80 A;  2BO8 A;  3D98 A;  2I5K A;  3OH4 A;  1FO8 A;  2V0I A;  1YP2 A;  3V0M A;  5J49 A;  1HJJ A;  2YQJ A;  1IIN A;  4HO6 A;  2V0H A;  1ON8 A;  4EEM A;  1H7F A;  1LZ7 A;  5C4C A;  4D48 A;  2JCK A;  4HO0 A;  1JV1 A;  1JVD A;  2GGQ A;  4O6N A;  1WVC A;  2ZU9 A;  3OAM A;  1G97 A;  1W77 A;  3V0L A;  2RJ5 A;  5AJO A;  1R7U A;  5FTS A;  1G0R A;  2GGO A;  3USQ A;  1SS9 A;  3JUK A;  5EJ1 A;  5JQQ A;  5I1F A;  4FRA A;  1VGU A;  1VPA A;  4KNR A;  1WT0 A;  1H7L A;  1H7Q A;  1OMX A;  2VS3 A;  1HJL A;  4B42 A;  5CQM X;  4ASY A;  4ECM A;  1QGQ A;  5C4D A;  4MYB A;  3O3P A;  2A8W A;  3I0K A;  2YES A;  1R7V A;  1VIC A;  2X5Z A;  3T7M A;  2Q4J A;  1G8O A;  2D7R A;  2VS5 A;  2PA4 A;  2PGY A;  3T7O A;  4EEA A;  4G87 A;  3E25 A;  5C4F A;  1H3M A;  2JCJ A;  4NAK A;  1NQI B;  4D11 A;  2XWM A;  5C49 A;  1IIM A;  1V83 A;  4D0Z A;  2CU2 A;  3I0H A;  4Y6U A;  2XWL A;  5C4E A;  5C1G A;  1TW1 A;  1V82 A;  1VZT A;  4GBP A;  4HOC A;  4FRL A;  1OQM B;  1PZY B;  2MZB A;  4DEC A;  4KRV A;  3I0L A;  4Y64 A;  1G1L A;  2RIY A;  1EZI A;  3DJ4 A;  3FOQ A;  4FRP A;  5C1H A;  2P6W A;  2Y4L A;  1LL3 A;  1ZJ3 A;  2X65 A;  4YS8 A;  4ARW A;  3OH1 A;  1YP3 A;  3SXE A;  3POL A;  2WE9 A;  3SXA A;  5CQO A;  3SX7 A;  1R7X A;  3D8V A;  4FRH A;  3SXB A;  4XWI A;  2AES A;  2J0B A;  3E26 A;  4FRO A;  1GQ9 A;  2VK9 A;  3U2W A;  2VFZ A;  2AE7 A;  1H7H A;  2W0W A;  2VSI A;  3OH0 A;  3ST8 A;  4P02 A;  5EJZ A;  1O23 B;  4O6M A;  5IDT A;  2XME A;  4Y6N A;  4B2X A;  1V84 A;  1ZI1 A;  4M2A A;  1JYK A;  3U0X A;  2XWN A;  1R81 A;  4D0T A;  1K4V A;  1NF5 B;  5L6S A;  3V0P A;  5D92 A;  2YQC A;  1R7Y A;  2XMH A;  2WVK A;  4Y7U A;  4DE7 A;  2YQH A;  2Y4M A;  3JUJ A;  1ZDG A;  3D5N A;  3PNN A;  2P72 A;  5C1L A;  3K8D A;  2RJ8 A;  2OI5 A;  2BO4 A;  4Y62 A;  2AEC A;  1O0R A;  1GWV A;  1ZJ2 A;  2OEF A;  4M4K A;  1ZJ0 A;  1H5S A;  4NAI A;  4UEG A;  3U2U A;  4C2S A;  2ZU7 A;  4HO4 A;  3CKJ A;  2QH5 A;  4HO2 A;  2O1G A;  5FUH A;  1ZI5 A;  1VM8 A;  1NKH B;  2AM4 A;  4CJB A;  4FCE A;  4B5B A;  2BO7 A;  2Y6P A;  2YC3 A;  1O7O A;  4EE3 A;  5FU8 A;  2RIZ A;  3RMV A;  4EVW A;  1ZI4 A;  4BMA A;  1KWS A;  3OGZ A;  1MC3 A;  3Q7U A;  3CKN A;  2V0K A;  2RJ9 A;  4FRE A;  1HV9 A;  2X5S A;  1S4N A;  4CVH A;  3OKR A;  2ICY A;  2PX7 A;  1ZJP A;  3ZGF A;  4NAN A;  1H7E A;  4HO5 A;  1H5T A;  3U2T A;  3TQD A;  5DDV A;  2ICX A;  1VZU A;  3I0E A;  1H5S B;  2UX8 A;  2Z87 A;  3F1C A;  4LW3 A;  3V0N A;  3N9W A;  1NHE B;  2VS4 A;  3V0Q A;  1FO9 A;  2ZU8 A;  2YC5 A;  3U2X A;  1H5R A;  1OMZ A;  3CKV A;  4R7P A;  1TZF A;  1YRO B;  5C47 A;  4L41 C;  2RJ4 A;  1FWY A;  3ZLK A;  1ZCT A;  4Q7C A;  2AH9 A;  3SPT A;  1WSZ A;  2WEE A;  3EE5 A;  4EE5 A;  5CQP A;  2VSH A;  2Z86 A;  2D7I A;  4G3Q A;  2FFU A;  3CU0 A;  4CJ8 A;  1H5T B;  1VH3 A;  1HM9 A;  3R2W A;  4FRD A;  4KNX A;  4E1K A;  3DK5 A;  2FYC B;  2RJ7 A;  1ZJ1 A;  2JCO A;  4Y7F A;  3I0I X;  3OH3 A;  3RMW A;  4FIX A;  4Y7V A;  1H5R B;  5C3B A;  4IRP A;  2E8B A;  4KC1 A;  2X60 A;  4B4B A;  4M28 A;  1FOA A;  1XHB A;  5L6V A;  3F1Y A;  3U2V A;  3V0O A;  2A8U A;  2Y4K A;  3NGW A;  2O1F A;  5FU0 A;  1HM8 A;  4KPX A;  4CJC A;  1R7T A;  4KQL A;  4HO3 A;  3IOH A;  3SXG A;  4KT7 A;  2J0A A;  1JVG A;  3Q80 A;  2RIT A;  4DDZ A;  4ASJ A;  2VXM A;  4FQW A;  3I0G A;  4JD0 A;  5CMJ A; 
#chains in the Genus database with same CATH homology
 4HO8 A;  3V8Z A;  1LZJ A;  3K8E A;  1ZHJ A;  3V91 A;  1H7G A;  2RJ6 A;  1G95 A;  1JV3 A;  1ZI3 A;  4B4G A;  2Y4J A;  3KIA A;  3JTJ A;  1O7Q A;  2E3D A;  3BRK X;  4M2B A;  1XZ6 A;  5CMH A;  1LL0 A;  4KC4 A;  3RSB A;  1ZCU A;  2WVM A;  1EYR A;  1ZJO A;  2JCL A;  2W0V A;  4P00 A;  4Y7T A;  4MND A;  1H5S D;  2FYB A;  1LL2 A;  4NAL A;  5D91 A;  5DDT A;  1I52 A;  1LZ0 A;  4AAW A;  3SX3 A;  4FRB A;  3IOJ A;  3HL3 A;  5IDS A;  3I0D A;  1QGS A;  3CKQ A;  4MIX A;  4AYL A;  1INJ A;  4Y63 A;  1G9R A;  1H4E A;  4G3S A;  4KC2 A;  1G23 A;  4ZDQ A;  1FXJ A;  5FYE A;  3OH2 A;  1GA8 A;  4JIS A;  3TZT A;  5CQN X;  2PGV A;  2RJ0 A;  3IOI A;  3BCV A;  2OI6 A;  2FYA A;  3V8Y A;  2AM3 A;  1GWW A;  5FTV A;  1FRW A;  4B2W A;  1H7T A;  1LZI A;  2Y7A A;  4KXO A;  3LW6 A;  1MP3 A;  2QGI A;  1VGT A;  1LVW A;  1QG8 A;  1S4O A;  4FRQ A;  4FRM A;  1ZIZ A;  4B3U A;  4D11 C;  2V0J A;  3SXC A;  4EEG A;  4EE4 A;  3ZF8 A;  5C36 A;  5IFY A;  1W55 A;  3U0Y A;  4EEO A;  4B4M A;  1ZDF A;  3I0F A;  1VH1 A;  2WGZ A;  2QKX A;  1FXO A;  2V0L A;  1INI A;  2BO6 A;  1ZCV A;  1FZW A;  2P73 A;  2DPW A;  3CGX A;  1R82 A;  1YP4 A;  4AYJ A;  3ZLL A;  5CMF X;  2APC A;  5CMI A;  4HG6 A;  1PZT A;  2FFV A;  5C3D A;  2RJ1 A;  3ZGG A;  4FCU A;  1FR9 A;  2WAW A;  4Y9X A;  1FG5 N;  1G2V A;  2I7B A;  3FWW A;  4AC3 A;  3DUV A;  2VXL A;  2VD4 A;  2YCM A;  4K6R A;  1FGX A;  1G93 A;  5C4B A;  5HS2 A;  2D0J A;  3CKO A;  4Y7G A;  1WT3 A;  1NMM B;  1WT1 A;  1HM0 A;  2I5E A;  1GX4 A;  1G3L A;  1WT2 A;  4G3P A;  1MP4 A;  3V90 A;  2OEG A;  4HO9 A;  3QVB A;  1ZCY A;  2WVL A;  2RIX A;  4J18 A;  1VGW A;  5C8R A;  2O1H A;  5AJN A;  2AM5 A;  2AGD A;  5FV9 A;  1MP5 A;  4IRQ A;  3SX8 A;  1H4D A;  5AJP A;  1FR8 A;  1ON6 A;  5BXC A;  1VZX A;  2NXV A;  1S4P A;  5CQL X;  3R3I A;  4FIY A;  3SXD A;  4LW6 A;  1TVY A;  3T7N A;  1VGZ A;  2FY7 A;  2OI7 A;  1TW5 A;  3SX5 A;  1H4C A;  3I0J A;  3GUE A;  5CMG X;  1H5S C;  5C48 A;  1E5K A;  5EIY A;  3I0C A;  1Z90 A;  2FYD B;  1GQC A;  1GX0 A;  1NWG B;  3USR A;  3Q4S A;  4KPZ A;  4BQH A;  3PKQ A;  4HCQ A;  1FGG A;  2YQS A;  3OC9 A;  1JYL A;  1QWJ A;  5C3A A;  2C0N A;  5C38 A;  3PKP A;  1W57 A;  1R80 A;  2BO8 A;  3D98 A;  2I5K A;  3OH4 A;  1FO8 A;  2V0I A;  1YP2 A;  3V0M A;  5J49 A;  1HJJ A;  2YQJ A;  1IIN A;  4HO6 A;  2V0H A;  1ON8 A;  4EEM A;  1H7F A;  1LZ7 A;  5C4C A;  4D48 A;  2JCK A;  4HO0 A;  1JV1 A;  1JVD A;  2GGQ A;  4O6N A;  1WVC A;  2ZU9 A;  3OAM A;  1G97 A;  1W77 A;  3V0L A;  2RJ5 A;  5AJO A;  1R7U A;  5FTS A;  1G0R A;  2GGO A;  3USQ A;  1SS9 A;  3JUK A;  5EJ1 A;  5JQQ A;  5I1F A;  4FRA A;  1VGU A;  1VPA A;  4KNR A;  1WT0 A;  1H7L A;  1H7Q A;  1OMX A;  2VS3 A;  1HJL A;  4B42 A;  5CQM X;  4ASY A;  4ECM A;  1QGQ A;  5C4D A;  4MYB A;  3O3P A;  2A8W A;  3I0K A;  2YES A;  1R7V A;  1VIC A;  2X5Z A;  3T7M A;  2Q4J A;  1G8O A;  2D7R A;  2VS5 A;  2PA4 A;  2PGY A;  3T7O A;  4EEA A;  4G87 A;  3E25 A;  5C4F A;  1H3M A;  2JCJ A;  4NAK A;  1NQI B;  4D11 A;  2XWM A;  5C49 A;  1IIM A;  1V83 A;  4D0Z A;  2CU2 A;  3I0H A;  4Y6U A;  2XWL A;  5C4E A;  5C1G A;  1TW1 A;  1V82 A;  1VZT A;  4GBP A;  4HOC A;  4FRL A;  1OQM B;  1PZY B;  2MZB A;  4DEC A;  4KRV A;  3I0L A;  4Y64 A;  1G1L A;  2RIY A;  1EZI A;  3DJ4 A;  3FOQ A;  4FRP A;  5C1H A;  2P6W A;  2Y4L A;  1LL3 A;  1ZJ3 A;  2X65 A;  4YS8 A;  4ARW A;  3OH1 A;  1YP3 A;  3SXE A;  3POL A;  2WE9 A;  3SXA A;  5CQO A;  3SX7 A;  1R7X A;  3D8V A;  4FRH A;  3SXB A;  4XWI A;  2AES A;  2J0B A;  3E26 A;  4FRO A;  1GQ9 A;  2VK9 A;  3U2W A;  2VFZ A;  2AE7 A;  1H7H A;  2W0W A;  2VSI A;  3OH0 A;  3ST8 A;  4P02 A;  5EJZ A;  1O23 B;  4O6M A;  5IDT A;  2XME A;  4Y6N A;  4B2X A;  1V84 A;  1ZI1 A;  4M2A A;  1JYK A;  3U0X A;  2XWN A;  1R81 A;  4D0T A;  1K4V A;  1NF5 B;  5L6S A;  3V0P A;  5D92 A;  2YQC A;  1R7Y A;  2XMH A;  2WVK A;  4Y7U A;  4DE7 A;  2YQH A;  2Y4M A;  3JUJ A;  1ZDG A;  3D5N A;  3PNN A;  2P72 A;  5C1L A;  3K8D A;  2RJ8 A;  2OI5 A;  2BO4 A;  4Y62 A;  2AEC A;  1O0R A;  1GWV A;  1ZJ2 A;  2OEF A;  4M4K A;  1ZJ0 A;  1H5S A;  4NAI A;  4UEG A;  3U2U A;  4C2S A;  2ZU7 A;  4HO4 A;  3CKJ A;  2QH5 A;  4HO2 A;  2O1G A;  5FUH A;  1ZI5 A;  1VM8 A;  1NKH B;  2AM4 A;  4CJB A;  4FCE A;  4B5B A;  2BO7 A;  2Y6P A;  2YC3 A;  1O7O A;  4EE3 A;  5FU8 A;  2RIZ A;  3RMV A;  4EVW A;  1ZI4 A;  4BMA A;  1KWS A;  3OGZ A;  1MC3 A;  3Q7U A;  3CKN A;  2V0K A;  2RJ9 A;  4FRE A;  1HV9 A;  2X5S A;  1S4N A;  4CVH A;  3OKR A;  2ICY A;  2PX7 A;  1ZJP A;  3ZGF A;  4NAN A;  1H7E A;  4HO5 A;  1H5T A;  3U2T A;  3TQD A;  5DDV A;  2ICX A;  1VZU A;  3I0E A;  1H5S B;  2UX8 A;  2Z87 A;  3F1C A;  4LW3 A;  3V0N A;  3N9W A;  1NHE B;  2VS4 A;  3V0Q A;  1FO9 A;  2ZU8 A;  2YC5 A;  3U2X A;  1H5R A;  1OMZ A;  3CKV A;  4R7P A;  1TZF A;  1YRO B;  5C47 A;  4L41 C;  2RJ4 A;  1FWY A;  3ZLK A;  1ZCT A;  4Q7C A;  2AH9 A;  3SPT A;  1WSZ A;  2WEE A;  3EE5 A;  4EE5 A;  5CQP A;  2VSH A;  2Z86 A;  2D7I A;  4G3Q A;  2FFU A;  3CU0 A;  4CJ8 A;  1H5T B;  1VH3 A;  1HM9 A;  3R2W A;  4FRD A;  4KNX A;  4E1K A;  3DK5 A;  2FYC B;  2RJ7 A;  1ZJ1 A;  2JCO A;  4Y7F A;  3I0I X;  3OH3 A;  3RMW A;  4FIX A;  4Y7V A;  1H5R B;  5C3B A;  4IRP A;  2E8B A;  4KC1 A;  2X60 A;  4B4B A;  4M28 A;  1FOA A;  1XHB A;  5L6V A;  3F1Y A;  3U2V A;  3V0O A;  2A8U A;  2Y4K A;  3NGW A;  2O1F A;  5FU0 A;  1HM8 A;  4KPX A;  4CJC A;  1R7T A;  4KQL A;  4HO3 A;  3IOH A;  3SXG A;  4KT7 A;  2J0A A;  1JVG A;  3Q80 A;  2RIT A;  4DDZ A;  4ASJ A;  2VXM A;  4FQW A;  3I0G A;  4JD0 A;  5CMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...