1ZCTA

Structure of glycogenin truncated at residue 270 in a complex with udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
262
structure length
258
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSEGHDPPQFLNVWWDIFTTSVVPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Requirements for catalysis in mammalian glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 78
structure length 258
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zctA00
4M4KA 4BMAA 5C48A 1LVWA 3F1YA 2WAWA 1NHEB 3GUEA 1G1LA 5CQNX 4ARWA 4FRPA 2ZU8A 4D48A 3TZTA 5EJZA 1NF5B 2P72A 2VSHA 2RITA 2XWLA 1S4NA 1O7OA 1VICA 4LW3A 2YC5A 1VPAA 4P02A 4KPXA 3FOQA 5L6SA 2YQSA 1IIMA 3OH0A 2V0LA 2RIZA 2O1FA 2A8WA 4JD0A 2UX8A 2I5EA 3N9WA 3USRA 4M28A 4FRMA 1G93A 2O1GA 2OEFA 1VZTA 1JVDA 2AH9A 3CU0A 4D0ZA 4E1KA 4ECMA 1H5SD 1HV9A 1MP3A 2NXVA 2VS3A 2Y7AA 2ZU9A 5CMIA 1VH3A 1O0RA 4HO3A 3E25A 4Y7VA 5C3AA 1JYLA 1G3LA 2MZBA 1ZI5A 2P6WA 4FRAA 3I0FA 1TVYA 5CMJA 5C4FA 2ICYA 1V83A 3V91A 5CMFX 3SXDA 3I0EA 4J18A 5JQQA 1ZJ1A 4D0TA 1H5SA 1GX0A 2E8BA 3SXEA 1LZ7A 3RMVA 1OQMB 1ZDFA 2RIXA 2V0IA 1FRWA 1PZYB 3V0QA 4DECA 2JCKA 5FUHA 4AC3A 3OGZA 1ON6A 3CKVA 1HM9A 1YP4A 5C4DA 2VXMA 5C4EA 5IDSA 4EEAA 1VGWA 1LL3A 1S4PA 1H5SC 2XMHA 2Y4JA 1WSZA 4FROA 1ON8A 1H5TA 1H4EA 3FWWA 2VFZA 1VH1A 4KT7A 2V0KA 3BCVA 5CMGX 3Q7UA 1XHBA 1K4VA 5C47A 5FV9A 2JCLA 3I0HA 1JV3A 2WGZA 4HO4A 3SXAA 5C4CA 1G23A 4HG6A 3BRKX 2I5KA 3U2UA 1NQIB 4IRQA 3IOHA 1FXJA 2Z87A 5HS2A 5FU0A 5C36A 4B4MA 4Y62A 3V0LA 3PKPA 4NAIA 5FTSA 3DUVA 4BQHA 2Y6PA 1HJLA 4FRBA 4AAWA 2X60A 2WE9A 1LZIA 2FFUA 4ASJA 1TZFA 2RJ9A 1ZDGA 2WVLA 5FU8A 2W0WA 3SX5A 1JVGA 3I0DA 1XZ6A 1FR9A 4EVWA 3Q80A 2Z86A 2AM5A 2APCA 1ZI4A 1NMMB 5DDTA 1QGSA 5CMHA 1R7VA 4KC1A 1LZJA 1O7QA 4AYJA 2PX7A 4M2BA 1V84A 2P73A 4KRVA 2W0VA 4Y9XA 1I52A 3V8ZA 1H7EA 2RIYA 3V0OA 3SXBA 4GBPA 2VD4A 3U2TA 1WT1A 2OI6A 5C1GA 1QWJA 4M2AA 3CKNA 5EJ1A 5C49A 3NGWA 1JV1A 3T7OA 1ZCTA 1H7FA 1S4OA 3IOIA 1WT3A 3OC9A 5C4BA 4HO5A 3K8DA 1EZIA 2ICXA 4AYLA 2WVMA 2QH5A 2RJ8A 1NKHB 4B42A 1ZCYA 1SS9A 1OMZA 3PKQA 2Y4LA 4MYBA 2D7RA 1H7QA 3D98A 3SXGA 2Y4MA 2RJ5A 1GQ9A 3KIAA 3RSBA 3I0IX 2XWMA 1LL0A 4ASYA 1ZJ3A 2FFVA 2JCOA 4HO6A 1EYRA 1R7XA 5DDVA 2ZU7A 4HOCA 1H5RA 4EE5A 2O1HA 1H4CA 2YESA 2AESA 3JUKA 1R7YA 4FRHA 3R2WA 4R7PA 3ST8A 2VSIA 1W55A 4NANA 3DJ4A 3ZGGA 1INJA 2V0HA 1ZHJA 1ZJOA 2OI7A 4HCQA 1GQCA 2AM3A 1H7GA 4G3PA 3SPTA 1KWSA 3OH1A 1H7HA 3HL3A 5CQOA 5AJOA 1ZCVA 3USQA 3V90A 4EE3A 1OMXA 2XMEA 1R82A 2D0JA 3IOJA 4KQLA 3ZLLA 1INIA 2FYBA 2FYCB 1HM8A 1ZJPA 1VGTA 2DPWA 1JYKA 2FYDB 1PZTA 4G3SA 1FGXA 2BO8A 4KPZA 1ZI3A 4YS8A 3SX7A 1FO9A 1TW1A 2YQCA 1YROB 1FG5N 5FYEA 3QVBA 4FRLA 1FGGA 3I0CA 1G2VA 4KXOA 1H5SB 4Y7GA 1FOAA 4Y63A 5IDTA 4HO8A 4Y7TA 2XWNA 4Y6UA 3I0JA 4LW6A 5C1HA 2OEGA 2WEEA 3ZLKA 4KC4A 1W57A 4B2XA 4B4GA 2OI5A 4HO9A 3K8EA 1GX4A 4G87A 2AE7A 2BO6A 4KNXA 4XWIA 1FZWA 1FO8A 1H5TB 1VZXA 4FRQA 4ZDQA 4UEGA 3OH3A 5FTVA 4JISA 2WVKA 3U2WA 2RJ0A 4KC2A 1O23B 3T7NA 2D7IA 2JCJA 2BO7A 3OH2A 4KNRA 2AGDA 4P00A 2BO4A 5J49A 3SX3A 4B4BA 3Q4SA 4DDZA 1TW5A 3CKOA 1HM0A 2RJ7A 1R81A 4B2WA 3V0PA 4CJCA 5AJPA 1ZIZA 1ZCUA 1GWWA 3OKRA 3CKJA 1G9RA 2FYAA 1QGQA 5CQPA 1G0RA 2V0JA 3RMWA 2GGQA 4CJBA 1FR8A 1G97A 4NALA 1ZJ2A 1MP5A 1HJJA 1ZI1A 4Y6NA 1YP2A 5C8RA 4C2SA 1H7LA 5BXCA 1GA8A 3U2XA 1FWYA 1H3MA 2YCMA 2X5SA 3I0KA 1LL2A 3SXCA 3T7MA 2YC3A 3D8VA 4DE7A 2FY7A 1WT2A 4EEOA 4B3UA 4D11A 1YP3A 1E5KA 5C3DA 1H4DA 2A8UA 5L6VA 2PGYA 1R7TA 5C3BA 2PGVA 2X5ZA 3V0MA 4MNDA 1VM8A 1G8OA 1QG8A 3R3IA 4CVHA 2QKXA 2CU2A 2QGIA 3OH4A 4FQWA 5IFYA 2X65A 3D5NA 1MC3A 3ZGFA 3ZF8A 3E26A 2Y4KA 4L41C 4FCUA 4D11C 5AJNA 1W77A 5CQLX 5EIYA 3V0NA 1R7UA 1V82A 3SX8A 1G95A 2RJ6A 1VZUA 4FRDA 4HO2A 4FREA 3JUJA 3U0XA 2Q4JA 3O3PA 4EE4A 4HO0A 2AM4A 2GGOA 1GWVA 3U2VA 3POLA 4Y64A 1R80A 1Z90A 4EEMA 3CGXA 3EE5A 1WVCA 1IINA 5CQMX 3V8YA 3LW6A 2VS4A 3I0LA 3JTJA 4Y7FA 3I0GA 3CKQA 1ZJ0A 4CJ8A 5I1FA 4FCEA 1VGZA 2E3DA 1H7TA 2I7BA 2RJ4A 2YQJA 3OAMA 5C1LA 4NAKA 1H5RB 1VGUA 2PA4A 4B5BA 1MP4A 2VS5A 3U0YA 2YQHA 4EEGA 2VXLA 2AECA 3DK5A 1FXOA 3TQDA 1WT0A 1NWGB 3PNNA 4G3QA 1LZ0A 4IRPA 4Y7UA 4K6RA 5C38A 2RJ1A 3F1CA
chains in the Genus database with same CATH superfamily
4M4KA 4BMAA 5C48A 1LVWA 3F1YA 2WAWA 1NHEB 3GUEA 1G1LA 5CQNX 4ARWA 4FRPA 2ZU8A 4D48A 3TZTA 5EJZA 1NF5B 2P72A 2VSHA 2RITA 2XWLA 1S4NA 1O7OA 1VICA 4LW3A 2YC5A 1VPAA 4P02A 4KPXA 3FOQA 5L6SA 2YQSA 1IIMA 3OH0A 2V0LA 2RIZA 2O1FA 2A8WA 4JD0A 2UX8A 2I5EA 3N9WA 3USRA 4M28A 4FRMA 1G93A 2O1GA 2OEFA 1VZTA 1JVDA 2AH9A 3CU0A 4D0ZA 4E1KA 4ECMA 1H5SD 1HV9A 1MP3A 2NXVA 2VS3A 2Y7AA 2ZU9A 5CMIA 1VH3A 1O0RA 5D92A 4HO3A 3E25A 4Y7VA 5C3AA 1JYLA 1G3LA 2MZBA 1ZI5A 2P6WA 4FRAA 3I0FA 1TVYA 5CMJA 5C4FA 2ICYA 1V83A 3V91A 5CMFX 3SXDA 3I0EA 4J18A 5JQQA 1ZJ1A 4D0TA 1H5SA 1GX0A 2E8BA 3SXEA 1LZ7A 3RMVA 2J0AA 1OQMB 1ZDFA 2RIXA 2V0IA 1FRWA 1PZYB 3V0QA 4DECA 2JCKA 5FUHA 4AC3A 3OGZA 1ON6A 3CKVA 1HM9A 1YP4A 5C4DA 2VXMA 5C4EA 5IDSA 4EEAA 1VGWA 1LL3A 1S4PA 1H5SC 2XMHA 2Y4JA 1WSZA 4FROA 1ON8A 1H5TA 1H4EA 3FWWA 2VFZA 1VH1A 4KT7A 2V0KA 2C0NA 3BCVA 5CMGX 3Q7UA 1XHBA 1K4VA 5C47A 5FV9A 2JCLA 3I0HA 1JV3A 2WGZA 4HO4A 3SXAA 5C4CA 1G23A 4HG6A 3BRKX 2I5KA 3U2UA 1NQIB 4IRQA 3IOHA 1FXJA 2Z87A 5HS2A 5FU0A 5C36A 4B4MA 4Y62A 3V0LA 3PKPA 4NAIA 5FTSA 3DUVA 4BQHA 2Y6PA 1HJLA 4FRBA 4AAWA 2X60A 2WE9A 1LZIA 2FFUA 4ASJA 1TZFA 2RJ9A 1ZDGA 2WVLA 5FU8A 2W0WA 3SX5A 1JVGA 3I0DA 1XZ6A 1FR9A 4EVWA 3Q80A 2Z86A 2AM5A 2APCA 1ZI4A 1NMMB 5DDTA 1QGSA 5CMHA 1R7VA 4KC1A 1LZJA 1O7QA 4AYJA 2PX7A 4M2BA 1V84A 2P73A 4KRVA 2W0VA 4Y9XA 1I52A 3V8ZA 1H7EA 2RIYA 3V0OA 3SXBA 4GBPA 2VD4A 3U2TA 1WT1A 2OI6A 5C1GA 1QWJA 4M2AA 3CKNA 5EJ1A 5C49A 3NGWA 1JV1A 3T7OA 1ZCTA 1H7FA 1S4OA 3IOIA 1WT3A 3OC9A 5C4BA 4HO5A 3K8DA 1EZIA 2ICXA 4AYLA 2WVMA 2QH5A 2RJ8A 1NKHB 4B42A 1ZCYA 1SS9A 1OMZA 3PKQA 2Y4LA 4MYBA 2D7RA 1H7QA 3D98A 3SXGA 2Y4MA 2RJ5A 1GQ9A 3KIAA 2J0BA 3RSBA 3I0IX 4FIXA 2XWMA 1LL0A 4ASYA 1ZJ3A 2FFVA 2JCOA 4HO6A 1EYRA 1R7XA 5DDVA 2ZU7A 4HOCA 1H5RA 4EE5A 2O1HA 1H4CA 2YESA 2AESA 3JUKA 1R7YA 4FRHA 3R2WA 4R7PA 3ST8A 2VSIA 1W55A 4NANA 3DJ4A 3ZGGA 1INJA 2V0HA 1ZHJA 1ZJOA 2OI7A 4HCQA 1GQCA 2AM3A 1H7GA 4G3PA 3SPTA 1KWSA 3OH1A 1H7HA 3HL3A 5CQOA 5AJOA 1ZCVA 3USQA 3V90A 4EE3A 1OMXA 2XMEA 1R82A 2D0JA 3IOJA 4KQLA 4MIXA 1INIA 3ZLLA 2FYBA 2FYCB 1HM8A 1ZJPA 1VGTA 2DPWA 1JYKA 2FYDB 1PZTA 4G3SA 1FGXA 2BO8A 4KPZA 1ZI3A 4YS8A 3SX7A 1FO9A 1TW1A 2YQCA 1YROB 1FG5N 5FYEA 3QVBA 4FRLA 4Q7CA 1FGGA 3I0CA 1G2VA 4KXOA 1H5SB 4Y7GA 1FOAA 4Y63A 5IDTA 4HO8A 4Y7TA 2XWNA 4Y6UA 3I0JA 4LW6A 5C1HA 2OEGA 2WEEA 3ZLKA 4KC4A 1W57A 4B2XA 4B4GA 2OI5A 4HO9A 3K8EA 1GX4A 4G87A 2AE7A 2BO6A 4KNXA 4XWIA 1FZWA 1FO8A 1H5TB 1VZXA 4FRQA 4ZDQA 4UEGA 3OH3A 5FTVA 4JISA 2WVKA 3U2WA 2RJ0A 4KC2A 1O23B 3T7NA 2D7IA 2JCJA 2BO7A 3OH2A 4KNRA 2AGDA 4P00A 2BO4A 5J49A 3SX3A 4B4BA 3Q4SA 4DDZA 1TW5A 3CKOA 1HM0A 2RJ7A 1R81A 4B2WA 3V0PA 4CJCA 5AJPA 1ZIZA 1ZCUA 1GWWA 3OKRA 3CKJA 1G9RA 2FYAA 1QGQA 5CQPA 1G0RA 2V0JA 3RMWA 2GGQA 4CJBA 1FR8A 1G97A 4NALA 1ZJ2A 1MP5A 1HJJA 1ZI1A 4O6MA 4Y6NA 1YP2A 5C8RA 4C2SA 1H7LA 5BXCA 1GA8A 3U2XA 1FWYA 1H3MA 2YCMA 2X5SA 3I0KA 1LL2A 3SXCA 3T7MA 2YC3A 3D8VA 4DE7A 2FY7A 4FIYA 1WT2A 4EEOA 4B3UA 4D11A 1YP3A 1E5KA 5C3DA 1H4DA 2A8UA 5L6VA 2PGYA 1R7TA 5C3BA 2PGVA 2X5ZA 3V0MA 4MNDA 1VM8A 1G8OA 1QG8A 3R3IA 4CVHA 2QKXA 2CU2A 2QGIA 3OH4A 4FQWA 5IFYA 2X65A 3D5NA 1MC3A 3ZGFA 3ZF8A 3E26A 2Y4KA 4L41C 4FCUA 4D11C 5AJNA 1W77A 5CQLX 5EIYA 3V0NA 1R7UA 1V82A 3SX8A 1G95A 2RJ6A 1VZUA 4FRDA 4HO2A 4FREA 4O6NA 3JUJA 3U0XA 2Q4JA 3O3PA 4EE4A 4HO0A 2AM4A 2GGOA 1GWVA 3U2VA 3POLA 4Y64A 1R80A 1Z90A 4EEMA 3CGXA 3EE5A 1WVCA 1IINA 5CQMX 3V8YA 3LW6A 2VS4A 3I0LA 3JTJA 4Y7FA 3I0GA 3CKQA 1ZJ0A 4CJ8A 5I1FA 4FCEA 1VGZA 2E3DA 1H7TA 2I7BA 2RJ4A 2YQJA 3OAMA 5C1LA 4NAKA 1H5RB 1VGUA 2PA4A 5D91A 4B5BA 1MP4A 2VS5A 3U0YA 2YQHA 4EEGA 2VXLA 2AECA 3DK5A 2VK9A 1FXOA 3TQDA 1WT0A 1NWGB 3PNNA 4G3QA 1LZ0A 4IRPA 4Y7UA 4K6RA 5C38A 2RJ1A 3F1CA
chains in the Genus database with same CATH topology
4M4KA 4BMAA 5C48A 1LVWA 3F1YA 2WAWA 1NHEB 3GUEA 1G1LA 5CQNX 4ARWA 4FRPA 2ZU8A 4D48A 3TZTA 5EJZA 1NF5B 2P72A 2VSHA 2RITA 2XWLA 1S4NA 1O7OA 1VICA 4LW3A 2YC5A 1VPAA 4P02A 4KPXA 3FOQA 5L6SA 2YQSA 1IIMA 3OH0A 2V0LA 2RIZA 2O1FA 2A8WA 4JD0A 2UX8A 2I5EA 3N9WA 3USRA 4M28A 4FRMA 1G93A 2O1GA 2OEFA 1VZTA 1JVDA 2AH9A 3CU0A 4D0ZA 4E1KA 4ECMA 1H5SD 1HV9A 1MP3A 2NXVA 2VS3A 2Y7AA 2ZU9A 5CMIA 1VH3A 1O0RA 5D92A 4HO3A 3E25A 4Y7VA 5C3AA 1JYLA 1G3LA 2MZBA 1ZI5A 2P6WA 4FRAA 3I0FA 1TVYA 5CMJA 5C4FA 2ICYA 1V83A 3V91A 5CMFX 3SXDA 3I0EA 4J18A 5JQQA 1ZJ1A 4D0TA 1H5SA 1GX0A 2E8BA 3SXEA 1LZ7A 3RMVA 2J0AA 1OQMB 1ZDFA 2RIXA 2V0IA 1FRWA 1PZYB 3V0QA 4DECA 2JCKA 5FUHA 4AC3A 3OGZA 1ON6A 3CKVA 1HM9A 1YP4A 5C4DA 2VXMA 5C4EA 5IDSA 4EEAA 1VGWA 1LL3A 1S4PA 1H5SC 2XMHA 2Y4JA 1WSZA 4FROA 1ON8A 1H5TA 1H4EA 3FWWA 2VFZA 1VH1A 4KT7A 2V0KA 2C0NA 3BCVA 5CMGX 3Q7UA 1XHBA 1K4VA 5C47A 5FV9A 2JCLA 3I0HA 1JV3A 2WGZA 4HO4A 3SXAA 5C4CA 1G23A 4HG6A 3BRKX 2I5KA 3U2UA 1NQIB 4IRQA 3IOHA 1FXJA 2Z87A 5HS2A 5FU0A 5C36A 4B4MA 4Y62A 3V0LA 3PKPA 4NAIA 5FTSA 3DUVA 4BQHA 2Y6PA 1HJLA 4FRBA 4AAWA 2X60A 2WE9A 1LZIA 2FFUA 4ASJA 1TZFA 2RJ9A 1ZDGA 2WVLA 5FU8A 2W0WA 3SX5A 1JVGA 3I0DA 1XZ6A 1FR9A 4EVWA 3Q80A 2Z86A 2AM5A 2APCA 1ZI4A 1NMMB 5DDTA 1QGSA 5CMHA 1R7VA 4KC1A 1LZJA 1O7QA 4AYJA 2PX7A 4M2BA 1V84A 2P73A 4KRVA 2W0VA 4Y9XA 1I52A 3V8ZA 1H7EA 2RIYA 3V0OA 3SXBA 4GBPA 2VD4A 3U2TA 1WT1A 2OI6A 5C1GA 1QWJA 4M2AA 3CKNA 5EJ1A 5C49A 3NGWA 1JV1A 3T7OA 1ZCTA 1H7FA 1S4OA 3IOIA 1WT3A 3OC9A 5C4BA 4HO5A 3K8DA 1EZIA 2ICXA 4AYLA 2WVMA 2QH5A 2RJ8A 1NKHB 4B42A 1ZCYA 1SS9A 1OMZA 3PKQA 2Y4LA 4MYBA 2D7RA 1H7QA 3D98A 3SXGA 2Y4MA 2RJ5A 1GQ9A 3KIAA 2J0BA 3RSBA 3I0IX 4FIXA 2XWMA 1LL0A 4ASYA 1ZJ3A 2FFVA 2JCOA 4HO6A 1EYRA 1R7XA 5DDVA 2ZU7A 4HOCA 1H5RA 4EE5A 2O1HA 1H4CA 2YESA 2AESA 3JUKA 1R7YA 4FRHA 3R2WA 4R7PA 3ST8A 2VSIA 1W55A 4NANA 3DJ4A 3ZGGA 1INJA 2V0HA 1ZHJA 1ZJOA 2OI7A 4HCQA 1GQCA 2AM3A 1H7GA 4G3PA 3SPTA 1KWSA 3OH1A 1H7HA 3HL3A 5CQOA 5AJOA 1ZCVA 3USQA 3V90A 4EE3A 1OMXA 2XMEA 1R82A 2D0JA 3IOJA 4KQLA 4MIXA 1INIA 3ZLLA 2FYBA 2FYCB 1HM8A 1ZJPA 1VGTA 2DPWA 1JYKA 2FYDB 1PZTA 4G3SA 1FGXA 2BO8A 4KPZA 1ZI3A 4YS8A 3SX7A 1FO9A 1TW1A 2YQCA 1YROB 1FG5N 5FYEA 3QVBA 4FRLA 4Q7CA 1FGGA 3I0CA 1G2VA 4KXOA 1H5SB 4Y7GA 1FOAA 4Y63A 5IDTA 4HO8A 4Y7TA 2XWNA 4Y6UA 3I0JA 4LW6A 5C1HA 2OEGA 2WEEA 3ZLKA 4KC4A 1W57A 4B2XA 4B4GA 2OI5A 4HO9A 3K8EA 1GX4A 4G87A 2AE7A 2BO6A 4KNXA 4XWIA 1FZWA 1FO8A 1H5TB 1VZXA 4FRQA 4ZDQA 4UEGA 3OH3A 5FTVA 4JISA 2WVKA 3U2WA 2RJ0A 4KC2A 1O23B 3T7NA 2D7IA 2JCJA 2BO7A 3OH2A 4KNRA 2AGDA 4P00A 2BO4A 5J49A 3SX3A 4B4BA 3Q4SA 4DDZA 1TW5A 3CKOA 1HM0A 2RJ7A 1R81A 4B2WA 3V0PA 4CJCA 5AJPA 1ZIZA 1ZCUA 1GWWA 3OKRA 3CKJA 1G9RA 2FYAA 1QGQA 5CQPA 1G0RA 2V0JA 3RMWA 2GGQA 4CJBA 1FR8A 1G97A 4NALA 1ZJ2A 1MP5A 1HJJA 1ZI1A 4O6MA 4Y6NA 1YP2A 5C8RA 4C2SA 1H7LA 5BXCA 1GA8A 3U2XA 1FWYA 1H3MA 2YCMA 2X5SA 3I0KA 1LL2A 3SXCA 3T7MA 2YC3A 3D8VA 4DE7A 2FY7A 4FIYA 1WT2A 4EEOA 4B3UA 4D11A 1YP3A 1E5KA 5C3DA 1H4DA 2A8UA 5L6VA 2PGYA 1R7TA 5C3BA 2PGVA 2X5ZA 3V0MA 4MNDA 1VM8A 1G8OA 1QG8A 3R3IA 4CVHA 2QKXA 2CU2A 2QGIA 3OH4A 4FQWA 5IFYA 2X65A 3D5NA 1MC3A 3ZGFA 3ZF8A 3E26A 2Y4KA 4L41C 4FCUA 4D11C 5AJNA 1W77A 5CQLX 5EIYA 3V0NA 1R7UA 1V82A 3SX8A 1G95A 2RJ6A 1VZUA 4FRDA 4HO2A 4FREA 4O6NA 3JUJA 3U0XA 2Q4JA 3O3PA 4EE4A 4HO0A 2AM4A 2GGOA 1GWVA 3U2VA 3POLA 4Y64A 1R80A 1Z90A 4EEMA 3CGXA 3EE5A 1WVCA 1IINA 5CQMX 3V8YA 3LW6A 2VS4A 3I0LA 3JTJA 4Y7FA 3I0GA 3CKQA 1ZJ0A 4CJ8A 5I1FA 4FCEA 1VGZA 2E3DA 1H7TA 2I7BA 2RJ4A 2YQJA 3OAMA 5C1LA 4NAKA 1H5RB 1VGUA 2PA4A 5D91A 4B5BA 1MP4A 2VS5A 3U0YA 2YQHA 4EEGA 2VXLA 2AECA 3DK5A 2VK9A 1FXOA 3TQDA 1WT0A 1NWGB 3PNNA 4G3QA 1LZ0A 4IRPA 4Y7UA 4K6RA 5C38A 2RJ1A 3F1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4K A;  4BMA A;  5C48 A;  1LVW A;  3F1Y A;  2WAW A;  1NHE B;  3GUE A;  1G1L A;  5CQN X;  4ARW A;  4FRP A;  2ZU8 A;  4D48 A;  3TZT A;  5EJZ A;  1NF5 B;  2P72 A;  2VSH A;  2RIT A;  2XWL A;  1S4N A;  1O7O A;  1VIC A;  4LW3 A;  2YC5 A;  1VPA A;  4P02 A;  4KPX A;  3FOQ A;  5L6S A;  2YQS A;  1IIM A;  3OH0 A;  2V0L A;  2RIZ A;  2O1F A;  2A8W A;  4JD0 A;  2UX8 A;  2I5E A;  3N9W A;  3USR A;  4M28 A;  4FRM A;  1G93 A;  2O1G A;  2OEF A;  1VZT A;  1JVD A;  2AH9 A;  3CU0 A;  4D0Z A;  4E1K A;  4ECM A;  1H5S D;  1HV9 A;  1MP3 A;  2NXV A;  2VS3 A;  2Y7A A;  2ZU9 A;  5CMI A;  1VH3 A;  1O0R A;  4HO3 A;  3E25 A;  4Y7V A;  5C3A A;  1JYL A;  1G3L A;  2MZB A;  1ZI5 A;  2P6W A;  4FRA A;  3I0F A;  1TVY A;  5CMJ A;  5C4F A;  2ICY A;  1V83 A;  3V91 A;  5CMF X;  3SXD A;  3I0E A;  4J18 A;  5JQQ A;  1ZJ1 A;  4D0T A;  1H5S A;  1GX0 A;  2E8B A;  3SXE A;  1LZ7 A;  3RMV A;  1OQM B;  1ZDF A;  2RIX A;  2V0I A;  1FRW A;  1PZY B;  3V0Q A;  4DEC A;  2JCK A;  5FUH A;  4AC3 A;  3OGZ A;  1ON6 A;  3CKV A;  1HM9 A;  1YP4 A;  5C4D A;  2VXM A;  5C4E A;  5IDS A;  4EEA A;  1VGW A;  1LL3 A;  1S4P A;  1H5S C;  2XMH A;  2Y4J A;  1WSZ A;  4FRO A;  1ON8 A;  1H5T A;  1H4E A;  3FWW A;  2VFZ A;  1VH1 A;  4KT7 A;  2V0K A;  3BCV A;  5CMG X;  3Q7U A;  1XHB A;  1K4V A;  5C47 A;  5FV9 A;  2JCL A;  3I0H A;  1JV3 A;  2WGZ A;  4HO4 A;  3SXA A;  5C4C A;  1G23 A;  4HG6 A;  3BRK X;  2I5K A;  3U2U A;  1NQI B;  4IRQ A;  3IOH A;  1FXJ A;  2Z87 A;  5HS2 A;  5FU0 A;  5C36 A;  4B4M A;  4Y62 A;  3V0L A;  3PKP A;  4NAI A;  5FTS A;  3DUV A;  4BQH A;  2Y6P A;  1HJL A;  4FRB A;  4AAW A;  2X60 A;  2WE9 A;  1LZI A;  2FFU A;  4ASJ A;  1TZF A;  2RJ9 A;  1ZDG A;  2WVL A;  5FU8 A;  2W0W A;  3SX5 A;  1JVG A;  3I0D A;  1XZ6 A;  1FR9 A;  4EVW A;  3Q80 A;  2Z86 A;  2AM5 A;  2APC A;  1ZI4 A;  1NMM B;  5DDT A;  1QGS A;  5CMH A;  1R7V A;  4KC1 A;  1LZJ A;  1O7Q A;  4AYJ A;  2PX7 A;  4M2B A;  1V84 A;  2P73 A;  4KRV A;  2W0V A;  4Y9X A;  1I52 A;  3V8Z A;  1H7E A;  2RIY A;  3V0O A;  3SXB A;  4GBP A;  2VD4 A;  3U2T A;  1WT1 A;  2OI6 A;  5C1G A;  1QWJ A;  4M2A A;  3CKN A;  5EJ1 A;  5C49 A;  3NGW A;  1JV1 A;  3T7O A;  1ZCT A;  1H7F A;  1S4O A;  3IOI A;  1WT3 A;  3OC9 A;  5C4B A;  4HO5 A;  3K8D A;  1EZI A;  2ICX A;  4AYL A;  2WVM A;  2QH5 A;  2RJ8 A;  1NKH B;  4B42 A;  1ZCY A;  1SS9 A;  1OMZ A;  3PKQ A;  2Y4L A;  4MYB A;  2D7R A;  1H7Q A;  3D98 A;  3SXG A;  2Y4M A;  2RJ5 A;  1GQ9 A;  3KIA A;  3RSB A;  3I0I X;  2XWM A;  1LL0 A;  4ASY A;  1ZJ3 A;  2FFV A;  2JCO A;  4HO6 A;  1EYR A;  1R7X A;  5DDV A;  2ZU7 A;  4HOC A;  1H5R A;  4EE5 A;  2O1H A;  1H4C A;  2YES A;  2AES A;  3JUK A;  1R7Y A;  4FRH A;  3R2W A;  4R7P A;  3ST8 A;  2VSI A;  1W55 A;  4NAN A;  3DJ4 A;  3ZGG A;  1INJ A;  2V0H A;  1ZHJ A;  1ZJO A;  2OI7 A;  4HCQ A;  1GQC A;  2AM3 A;  1H7G A;  4G3P A;  3SPT A;  1KWS A;  3OH1 A;  1H7H A;  3HL3 A;  5CQO A;  5AJO A;  1ZCV A;  3USQ A;  3V90 A;  4EE3 A;  1OMX A;  2XME A;  1R82 A;  2D0J A;  3IOJ A;  4KQL A;  3ZLL A;  1INI A;  2FYB A;  2FYC B;  1HM8 A;  1ZJP A;  1VGT A;  2DPW A;  1JYK A;  2FYD B;  1PZT A;  4G3S A;  1FGX A;  2BO8 A;  4KPZ A;  1ZI3 A;  4YS8 A;  3SX7 A;  1FO9 A;  1TW1 A;  2YQC A;  1YRO B;  1FG5 N;  5FYE A;  3QVB A;  4FRL A;  1FGG A;  3I0C A;  1G2V A;  4KXO A;  1H5S B;  4Y7G A;  1FOA A;  4Y63 A;  5IDT A;  4HO8 A;  4Y7T A;  2XWN A;  4Y6U A;  3I0J A;  4LW6 A;  5C1H A;  2OEG A;  2WEE A;  3ZLK A;  4KC4 A;  1W57 A;  4B2X A;  4B4G A;  2OI5 A;  4HO9 A;  3K8E A;  1GX4 A;  4G87 A;  2AE7 A;  2BO6 A;  4KNX A;  4XWI A;  1FZW A;  1FO8 A;  1H5T B;  1VZX A;  4FRQ A;  4ZDQ A;  4UEG A;  3OH3 A;  5FTV A;  4JIS A;  2WVK A;  3U2W A;  2RJ0 A;  4KC2 A;  1O23 B;  3T7N A;  2D7I A;  2JCJ A;  2BO7 A;  3OH2 A;  4KNR A;  2AGD A;  4P00 A;  2BO4 A;  5J49 A;  3SX3 A;  4B4B A;  3Q4S A;  4DDZ A;  1TW5 A;  3CKO A;  1HM0 A;  2RJ7 A;  1R81 A;  4B2W A;  3V0P A;  4CJC A;  5AJP A;  1ZIZ A;  1ZCU A;  1GWW A;  3OKR A;  3CKJ A;  1G9R A;  2FYA A;  1QGQ A;  5CQP A;  1G0R A;  2V0J A;  3RMW A;  2GGQ A;  4CJB A;  1FR8 A;  1G97 A;  4NAL A;  1ZJ2 A;  1MP5 A;  1HJJ A;  1ZI1 A;  4Y6N A;  1YP2 A;  5C8R A;  4C2S A;  1H7L A;  5BXC A;  1GA8 A;  3U2X A;  1FWY A;  1H3M A;  2YCM A;  2X5S A;  3I0K A;  1LL2 A;  3SXC A;  3T7M A;  2YC3 A;  3D8V A;  4DE7 A;  2FY7 A;  1WT2 A;  4EEO A;  4B3U A;  4D11 A;  1YP3 A;  1E5K A;  5C3D A;  1H4D A;  2A8U A;  5L6V A;  2PGY A;  1R7T A;  5C3B A;  2PGV A;  2X5Z A;  3V0M A;  4MND A;  1VM8 A;  1G8O A;  1QG8 A;  3R3I A;  4CVH A;  2QKX A;  2CU2 A;  2QGI A;  3OH4 A;  4FQW A;  5IFY A;  2X65 A;  3D5N A;  1MC3 A;  3ZGF A;  3ZF8 A;  3E26 A;  2Y4K A;  4L41 C;  4FCU A;  4D11 C;  5AJN A;  1W77 A;  5CQL X;  5EIY A;  3V0N A;  1R7U A;  1V82 A;  3SX8 A;  1G95 A;  2RJ6 A;  1VZU A;  4FRD A;  4HO2 A;  4FRE A;  3JUJ A;  3U0X A;  2Q4J A;  3O3P A;  4EE4 A;  4HO0 A;  2AM4 A;  2GGO A;  1GWV A;  3U2V A;  3POL A;  4Y64 A;  1R80 A;  1Z90 A;  4EEM A;  3CGX A;  3EE5 A;  1WVC A;  1IIN A;  5CQM X;  3V8Y A;  3LW6 A;  2VS4 A;  3I0L A;  3JTJ A;  4Y7F A;  3I0G A;  3CKQ A;  1ZJ0 A;  4CJ8 A;  5I1F A;  4FCE A;  1VGZ A;  2E3D A;  1H7T A;  2I7B A;  2RJ4 A;  2YQJ A;  3OAM A;  5C1L A;  4NAK A;  1H5R B;  1VGU A;  2PA4 A;  4B5B A;  1MP4 A;  2VS5 A;  3U0Y A;  2YQH A;  4EEG A;  2VXL A;  2AEC A;  3DK5 A;  1FXO A;  3TQD A;  1WT0 A;  1NWG B;  3PNN A;  4G3Q A;  1LZ0 A;  4IRP A;  4Y7U A;  4K6R A;  5C38 A;  2RJ1 A;  3F1C A; 
#chains in the Genus database with same CATH topology
 4M4K A;  4BMA A;  5C48 A;  1LVW A;  3F1Y A;  2WAW A;  1NHE B;  3GUE A;  1G1L A;  5CQN X;  4ARW A;  4FRP A;  2ZU8 A;  4D48 A;  3TZT A;  5EJZ A;  1NF5 B;  2P72 A;  2VSH A;  2RIT A;  2XWL A;  1S4N A;  1O7O A;  1VIC A;  4LW3 A;  2YC5 A;  1VPA A;  4P02 A;  4KPX A;  3FOQ A;  5L6S A;  2YQS A;  1IIM A;  3OH0 A;  2V0L A;  2RIZ A;  2O1F A;  2A8W A;  4JD0 A;  2UX8 A;  2I5E A;  3N9W A;  3USR A;  4M28 A;  4FRM A;  1G93 A;  2O1G A;  2OEF A;  1VZT A;  1JVD A;  2AH9 A;  3CU0 A;  4D0Z A;  4E1K A;  4ECM A;  1H5S D;  1HV9 A;  1MP3 A;  2NXV A;  2VS3 A;  2Y7A A;  2ZU9 A;  5CMI A;  1VH3 A;  1O0R A;  5D92 A;  4HO3 A;  3E25 A;  4Y7V A;  5C3A A;  1JYL A;  1G3L A;  2MZB A;  1ZI5 A;  2P6W A;  4FRA A;  3I0F A;  1TVY A;  5CMJ A;  5C4F A;  2ICY A;  1V83 A;  3V91 A;  5CMF X;  3SXD A;  3I0E A;  4J18 A;  5JQQ A;  1ZJ1 A;  4D0T A;  1H5S A;  1GX0 A;  2E8B A;  3SXE A;  1LZ7 A;  3RMV A;  2J0A A;  1OQM B;  1ZDF A;  2RIX A;  2V0I A;  1FRW A;  1PZY B;  3V0Q A;  4DEC A;  2JCK A;  5FUH A;  4AC3 A;  3OGZ A;  1ON6 A;  3CKV A;  1HM9 A;  1YP4 A;  5C4D A;  2VXM A;  5C4E A;  5IDS A;  4EEA A;  1VGW A;  1LL3 A;  1S4P A;  1H5S C;  2XMH A;  2Y4J A;  1WSZ A;  4FRO A;  1ON8 A;  1H5T A;  1H4E A;  3FWW A;  2VFZ A;  1VH1 A;  4KT7 A;  2V0K A;  2C0N A;  3BCV A;  5CMG X;  3Q7U A;  1XHB A;  1K4V A;  5C47 A;  5FV9 A;  2JCL A;  3I0H A;  1JV3 A;  2WGZ A;  4HO4 A;  3SXA A;  5C4C A;  1G23 A;  4HG6 A;  3BRK X;  2I5K A;  3U2U A;  1NQI B;  4IRQ A;  3IOH A;  1FXJ A;  2Z87 A;  5HS2 A;  5FU0 A;  5C36 A;  4B4M A;  4Y62 A;  3V0L A;  3PKP A;  4NAI A;  5FTS A;  3DUV A;  4BQH A;  2Y6P A;  1HJL A;  4FRB A;  4AAW A;  2X60 A;  2WE9 A;  1LZI A;  2FFU A;  4ASJ A;  1TZF A;  2RJ9 A;  1ZDG A;  2WVL A;  5FU8 A;  2W0W A;  3SX5 A;  1JVG A;  3I0D A;  1XZ6 A;  1FR9 A;  4EVW A;  3Q80 A;  2Z86 A;  2AM5 A;  2APC A;  1ZI4 A;  1NMM B;  5DDT A;  1QGS A;  5CMH A;  1R7V A;  4KC1 A;  1LZJ A;  1O7Q A;  4AYJ A;  2PX7 A;  4M2B A;  1V84 A;  2P73 A;  4KRV A;  2W0V A;  4Y9X A;  1I52 A;  3V8Z A;  1H7E A;  2RIY A;  3V0O A;  3SXB A;  4GBP A;  2VD4 A;  3U2T A;  1WT1 A;  2OI6 A;  5C1G A;  1QWJ A;  4M2A A;  3CKN A;  5EJ1 A;  5C49 A;  3NGW A;  1JV1 A;  3T7O A;  1ZCT A;  1H7F A;  1S4O A;  3IOI A;  1WT3 A;  3OC9 A;  5C4B A;  4HO5 A;  3K8D A;  1EZI A;  2ICX A;  4AYL A;  2WVM A;  2QH5 A;  2RJ8 A;  1NKH B;  4B42 A;  1ZCY A;  1SS9 A;  1OMZ A;  3PKQ A;  2Y4L A;  4MYB A;  2D7R A;  1H7Q A;  3D98 A;  3SXG A;  2Y4M A;  2RJ5 A;  1GQ9 A;  3KIA A;  2J0B A;  3RSB A;  3I0I X;  4FIX A;  2XWM A;  1LL0 A;  4ASY A;  1ZJ3 A;  2FFV A;  2JCO A;  4HO6 A;  1EYR A;  1R7X A;  5DDV A;  2ZU7 A;  4HOC A;  1H5R A;  4EE5 A;  2O1H A;  1H4C A;  2YES A;  2AES A;  3JUK A;  1R7Y A;  4FRH A;  3R2W A;  4R7P A;  3ST8 A;  2VSI A;  1W55 A;  4NAN A;  3DJ4 A;  3ZGG A;  1INJ A;  2V0H A;  1ZHJ A;  1ZJO A;  2OI7 A;  4HCQ A;  1GQC A;  2AM3 A;  1H7G A;  4G3P A;  3SPT A;  1KWS A;  3OH1 A;  1H7H A;  3HL3 A;  5CQO A;  5AJO A;  1ZCV A;  3USQ A;  3V90 A;  4EE3 A;  1OMX A;  2XME A;  1R82 A;  2D0J A;  3IOJ A;  4KQL A;  4MIX A;  1INI A;  3ZLL A;  2FYB A;  2FYC B;  1HM8 A;  1ZJP A;  1VGT A;  2DPW A;  1JYK A;  2FYD B;  1PZT A;  4G3S A;  1FGX A;  2BO8 A;  4KPZ A;  1ZI3 A;  4YS8 A;  3SX7 A;  1FO9 A;  1TW1 A;  2YQC A;  1YRO B;  1FG5 N;  5FYE A;  3QVB A;  4FRL A;  4Q7C A;  1FGG A;  3I0C A;  1G2V A;  4KXO A;  1H5S B;  4Y7G A;  1FOA A;  4Y63 A;  5IDT A;  4HO8 A;  4Y7T A;  2XWN A;  4Y6U A;  3I0J A;  4LW6 A;  5C1H A;  2OEG A;  2WEE A;  3ZLK A;  4KC4 A;  1W57 A;  4B2X A;  4B4G A;  2OI5 A;  4HO9 A;  3K8E A;  1GX4 A;  4G87 A;  2AE7 A;  2BO6 A;  4KNX A;  4XWI A;  1FZW A;  1FO8 A;  1H5T B;  1VZX A;  4FRQ A;  4ZDQ A;  4UEG A;  3OH3 A;  5FTV A;  4JIS A;  2WVK A;  3U2W A;  2RJ0 A;  4KC2 A;  1O23 B;  3T7N A;  2D7I A;  2JCJ A;  2BO7 A;  3OH2 A;  4KNR A;  2AGD A;  4P00 A;  2BO4 A;  5J49 A;  3SX3 A;  4B4B A;  3Q4S A;  4DDZ A;  1TW5 A;  3CKO A;  1HM0 A;  2RJ7 A;  1R81 A;  4B2W A;  3V0P A;  4CJC A;  5AJP A;  1ZIZ A;  1ZCU A;  1GWW A;  3OKR A;  3CKJ A;  1G9R A;  2FYA A;  1QGQ A;  5CQP A;  1G0R A;  2V0J A;  3RMW A;  2GGQ A;  4CJB A;  1FR8 A;  1G97 A;  4NAL A;  1ZJ2 A;  1MP5 A;  1HJJ A;  1ZI1 A;  4O6M A;  4Y6N A;  1YP2 A;  5C8R A;  4C2S A;  1H7L A;  5BXC A;  1GA8 A;  3U2X A;  1FWY A;  1H3M A;  2YCM A;  2X5S A;  3I0K A;  1LL2 A;  3SXC A;  3T7M A;  2YC3 A;  3D8V A;  4DE7 A;  2FY7 A;  4FIY A;  1WT2 A;  4EEO A;  4B3U A;  4D11 A;  1YP3 A;  1E5K A;  5C3D A;  1H4D A;  2A8U A;  5L6V A;  2PGY A;  1R7T A;  5C3B A;  2PGV A;  2X5Z A;  3V0M A;  4MND A;  1VM8 A;  1G8O A;  1QG8 A;  3R3I A;  4CVH A;  2QKX A;  2CU2 A;  2QGI A;  3OH4 A;  4FQW A;  5IFY A;  2X65 A;  3D5N A;  1MC3 A;  3ZGF A;  3ZF8 A;  3E26 A;  2Y4K A;  4L41 C;  4FCU A;  4D11 C;  5AJN A;  1W77 A;  5CQL X;  5EIY A;  3V0N A;  1R7U A;  1V82 A;  3SX8 A;  1G95 A;  2RJ6 A;  1VZU A;  4FRD A;  4HO2 A;  4FRE A;  4O6N A;  3JUJ A;  3U0X A;  2Q4J A;  3O3P A;  4EE4 A;  4HO0 A;  2AM4 A;  2GGO A;  1GWV A;  3U2V A;  3POL A;  4Y64 A;  1R80 A;  1Z90 A;  4EEM A;  3CGX A;  3EE5 A;  1WVC A;  1IIN A;  5CQM X;  3V8Y A;  3LW6 A;  2VS4 A;  3I0L A;  3JTJ A;  4Y7F A;  3I0G A;  3CKQ A;  1ZJ0 A;  4CJ8 A;  5I1F A;  4FCE A;  1VGZ A;  2E3D A;  1H7T A;  2I7B A;  2RJ4 A;  2YQJ A;  3OAM A;  5C1L A;  4NAK A;  1H5R B;  1VGU A;  2PA4 A;  5D91 A;  4B5B A;  1MP4 A;  2VS5 A;  3U0Y A;  2YQH A;  4EEG A;  2VXL A;  2AEC A;  3DK5 A;  2VK9 A;  1FXO A;  3TQD A;  1WT0 A;  1NWG B;  3PNN A;  4G3Q A;  1LZ0 A;  4IRP A;  4Y7U A;  4K6R A;  5C38 A;  2RJ1 A;  3F1C A; 
#chains in the Genus database with same CATH homology
 4M4K A;  4BMA A;  5C48 A;  1LVW A;  3F1Y A;  2WAW A;  1NHE B;  3GUE A;  1G1L A;  5CQN X;  4ARW A;  4FRP A;  2ZU8 A;  4D48 A;  3TZT A;  5EJZ A;  1NF5 B;  2P72 A;  2VSH A;  2RIT A;  2XWL A;  1S4N A;  1O7O A;  1VIC A;  4LW3 A;  2YC5 A;  1VPA A;  4P02 A;  4KPX A;  3FOQ A;  5L6S A;  2YQS A;  1IIM A;  3OH0 A;  2V0L A;  2RIZ A;  2O1F A;  2A8W A;  4JD0 A;  2UX8 A;  2I5E A;  3N9W A;  3USR A;  4M28 A;  4FRM A;  1G93 A;  2O1G A;  2OEF A;  1VZT A;  1JVD A;  2AH9 A;  3CU0 A;  4D0Z A;  4E1K A;  4ECM A;  1H5S D;  1HV9 A;  1MP3 A;  2NXV A;  2VS3 A;  2Y7A A;  2ZU9 A;  5CMI A;  1VH3 A;  1O0R A;  5D92 A;  4HO3 A;  3E25 A;  4Y7V A;  5C3A A;  1JYL A;  1G3L A;  2MZB A;  1ZI5 A;  2P6W A;  4FRA A;  3I0F A;  1TVY A;  5CMJ A;  5C4F A;  2ICY A;  1V83 A;  3V91 A;  5CMF X;  3SXD A;  3I0E A;  4J18 A;  5JQQ A;  1ZJ1 A;  4D0T A;  1H5S A;  1GX0 A;  2E8B A;  3SXE A;  1LZ7 A;  3RMV A;  2J0A A;  1OQM B;  1ZDF A;  2RIX A;  2V0I A;  1FRW A;  1PZY B;  3V0Q A;  4DEC A;  2JCK A;  5FUH A;  4AC3 A;  3OGZ A;  1ON6 A;  3CKV A;  1HM9 A;  1YP4 A;  5C4D A;  2VXM A;  5C4E A;  5IDS A;  4EEA A;  1VGW A;  1LL3 A;  1S4P A;  1H5S C;  2XMH A;  2Y4J A;  1WSZ A;  4FRO A;  1ON8 A;  1H5T A;  1H4E A;  3FWW A;  2VFZ A;  1VH1 A;  4KT7 A;  2V0K A;  2C0N A;  3BCV A;  5CMG X;  3Q7U A;  1XHB A;  1K4V A;  5C47 A;  5FV9 A;  2JCL A;  3I0H A;  1JV3 A;  2WGZ A;  4HO4 A;  3SXA A;  5C4C A;  1G23 A;  4HG6 A;  3BRK X;  2I5K A;  3U2U A;  1NQI B;  4IRQ A;  3IOH A;  1FXJ A;  2Z87 A;  5HS2 A;  5FU0 A;  5C36 A;  4B4M A;  4Y62 A;  3V0L A;  3PKP A;  4NAI A;  5FTS A;  3DUV A;  4BQH A;  2Y6P A;  1HJL A;  4FRB A;  4AAW A;  2X60 A;  2WE9 A;  1LZI A;  2FFU A;  4ASJ A;  1TZF A;  2RJ9 A;  1ZDG A;  2WVL A;  5FU8 A;  2W0W A;  3SX5 A;  1JVG A;  3I0D A;  1XZ6 A;  1FR9 A;  4EVW A;  3Q80 A;  2Z86 A;  2AM5 A;  2APC A;  1ZI4 A;  1NMM B;  5DDT A;  1QGS A;  5CMH A;  1R7V A;  4KC1 A;  1LZJ A;  1O7Q A;  4AYJ A;  2PX7 A;  4M2B A;  1V84 A;  2P73 A;  4KRV A;  2W0V A;  4Y9X A;  1I52 A;  3V8Z A;  1H7E A;  2RIY A;  3V0O A;  3SXB A;  4GBP A;  2VD4 A;  3U2T A;  1WT1 A;  2OI6 A;  5C1G A;  1QWJ A;  4M2A A;  3CKN A;  5EJ1 A;  5C49 A;  3NGW A;  1JV1 A;  3T7O A;  1ZCT A;  1H7F A;  1S4O A;  3IOI A;  1WT3 A;  3OC9 A;  5C4B A;  4HO5 A;  3K8D A;  1EZI A;  2ICX A;  4AYL A;  2WVM A;  2QH5 A;  2RJ8 A;  1NKH B;  4B42 A;  1ZCY A;  1SS9 A;  1OMZ A;  3PKQ A;  2Y4L A;  4MYB A;  2D7R A;  1H7Q A;  3D98 A;  3SXG A;  2Y4M A;  2RJ5 A;  1GQ9 A;  3KIA A;  2J0B A;  3RSB A;  3I0I X;  4FIX A;  2XWM A;  1LL0 A;  4ASY A;  1ZJ3 A;  2FFV A;  2JCO A;  4HO6 A;  1EYR A;  1R7X A;  5DDV A;  2ZU7 A;  4HOC A;  1H5R A;  4EE5 A;  2O1H A;  1H4C A;  2YES A;  2AES A;  3JUK A;  1R7Y A;  4FRH A;  3R2W A;  4R7P A;  3ST8 A;  2VSI A;  1W55 A;  4NAN A;  3DJ4 A;  3ZGG A;  1INJ A;  2V0H A;  1ZHJ A;  1ZJO A;  2OI7 A;  4HCQ A;  1GQC A;  2AM3 A;  1H7G A;  4G3P A;  3SPT A;  1KWS A;  3OH1 A;  1H7H A;  3HL3 A;  5CQO A;  5AJO A;  1ZCV A;  3USQ A;  3V90 A;  4EE3 A;  1OMX A;  2XME A;  1R82 A;  2D0J A;  3IOJ A;  4KQL A;  4MIX A;  1INI A;  3ZLL A;  2FYB A;  2FYC B;  1HM8 A;  1ZJP A;  1VGT A;  2DPW A;  1JYK A;  2FYD B;  1PZT A;  4G3S A;  1FGX A;  2BO8 A;  4KPZ A;  1ZI3 A;  4YS8 A;  3SX7 A;  1FO9 A;  1TW1 A;  2YQC A;  1YRO B;  1FG5 N;  5FYE A;  3QVB A;  4FRL A;  4Q7C A;  1FGG A;  3I0C A;  1G2V A;  4KXO A;  1H5S B;  4Y7G A;  1FOA A;  4Y63 A;  5IDT A;  4HO8 A;  4Y7T A;  2XWN A;  4Y6U A;  3I0J A;  4LW6 A;  5C1H A;  2OEG A;  2WEE A;  3ZLK A;  4KC4 A;  1W57 A;  4B2X A;  4B4G A;  2OI5 A;  4HO9 A;  3K8E A;  1GX4 A;  4G87 A;  2AE7 A;  2BO6 A;  4KNX A;  4XWI A;  1FZW A;  1FO8 A;  1H5T B;  1VZX A;  4FRQ A;  4ZDQ A;  4UEG A;  3OH3 A;  5FTV A;  4JIS A;  2WVK A;  3U2W A;  2RJ0 A;  4KC2 A;  1O23 B;  3T7N A;  2D7I A;  2JCJ A;  2BO7 A;  3OH2 A;  4KNR A;  2AGD A;  4P00 A;  2BO4 A;  5J49 A;  3SX3 A;  4B4B A;  3Q4S A;  4DDZ A;  1TW5 A;  3CKO A;  1HM0 A;  2RJ7 A;  1R81 A;  4B2W A;  3V0P A;  4CJC A;  5AJP A;  1ZIZ A;  1ZCU A;  1GWW A;  3OKR A;  3CKJ A;  1G9R A;  2FYA A;  1QGQ A;  5CQP A;  1G0R A;  2V0J A;  3RMW A;  2GGQ A;  4CJB A;  1FR8 A;  1G97 A;  4NAL A;  1ZJ2 A;  1MP5 A;  1HJJ A;  1ZI1 A;  4O6M A;  4Y6N A;  1YP2 A;  5C8R A;  4C2S A;  1H7L A;  5BXC A;  1GA8 A;  3U2X A;  1FWY A;  1H3M A;  2YCM A;  2X5S A;  3I0K A;  1LL2 A;  3SXC A;  3T7M A;  2YC3 A;  3D8V A;  4DE7 A;  2FY7 A;  4FIY A;  1WT2 A;  4EEO A;  4B3U A;  4D11 A;  1YP3 A;  1E5K A;  5C3D A;  1H4D A;  2A8U A;  5L6V A;  2PGY A;  1R7T A;  5C3B A;  2PGV A;  2X5Z A;  3V0M A;  4MND A;  1VM8 A;  1G8O A;  1QG8 A;  3R3I A;  4CVH A;  2QKX A;  2CU2 A;  2QGI A;  3OH4 A;  4FQW A;  5IFY A;  2X65 A;  3D5N A;  1MC3 A;  3ZGF A;  3ZF8 A;  3E26 A;  2Y4K A;  4L41 C;  4FCU A;  4D11 C;  5AJN A;  1W77 A;  5CQL X;  5EIY A;  3V0N A;  1R7U A;  1V82 A;  3SX8 A;  1G95 A;  2RJ6 A;  1VZU A;  4FRD A;  4HO2 A;  4FRE A;  4O6N A;  3JUJ A;  3U0X A;  2Q4J A;  3O3P A;  4EE4 A;  4HO0 A;  2AM4 A;  2GGO A;  1GWV A;  3U2V A;  3POL A;  4Y64 A;  1R80 A;  1Z90 A;  4EEM A;  3CGX A;  3EE5 A;  1WVC A;  1IIN A;  5CQM X;  3V8Y A;  3LW6 A;  2VS4 A;  3I0L A;  3JTJ A;  4Y7F A;  3I0G A;  3CKQ A;  1ZJ0 A;  4CJ8 A;  5I1F A;  4FCE A;  1VGZ A;  2E3D A;  1H7T A;  2I7B A;  2RJ4 A;  2YQJ A;  3OAM A;  5C1L A;  4NAK A;  1H5R B;  1VGU A;  2PA4 A;  5D91 A;  4B5B A;  1MP4 A;  2VS5 A;  3U0Y A;  2YQH A;  4EEG A;  2VXL A;  2AEC A;  3DK5 A;  2VK9 A;  1FXO A;  3TQD A;  1WT0 A;  1NWG B;  3PNN A;  4G3Q A;  1LZ0 A;  4IRP A;  4Y7U A;  4K6R A;  5C38 A;  2RJ1 A;  3F1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...