1ZCTA

Structure of glycogenin truncated at residue 270 in a complex with udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
262
structure length
258
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSEGHDPPQFLNVWWDIFTTSVVPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Requirements for catalysis in mammalian glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 78
structure length 258
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zctA00
3D8VA 1H4DA 1FG5N 1ZDGA 5C3AA 2GGQA 1NKHB 1KWSA 1LL0A 1WSZA 3K8DA 3OH2A 3I0EA 5C4EA 5CQOA 2FY7A 3U2TA 1WT2A 3CKOA 3D5NA 1H5SB 4FCUA 1G3LA 1PZYB 2WVKA 5C1HA 1EYRA 4B2WA 3CU0A 3OH3A 2RIZA 4Y63A 3GUEA 1LZIA 2YC3A 2AGDA 5CMHA 1FXOA 1VGWA 4FCEA 5J49A 4KPXA 3PNNA 3T7MA 3R3IA 4HOCA 2O1GA 2RJ0A 2YQSA 4EEAA 2P6WA 3USQA 3OH0A 1G23A 1MP5A 1VH3A 1VGUA 4HO2A 3V0QA 1ZDFA 2YQHA 2A8UA 2A8WA 1H5RA 1GWVA 1R7XA 3USRA 1OQMB 2RITA 2V0LA 1ZJPA 3N9WA 2XMHA 1JV3A 2XWMA 3T7NA 2BO8A 4HO4A 5C4BA 2P72A 3EE5A 1H7FA 4D48A 2BO7A 2XWNA 1GA8A 2E8BA 1H7EA 3U2UA 2AH9A 1ZJ2A 2P73A 2PA4A 3DJ4A 4EEGA 1W55A 5L6VA 3R2WA 2X5SA 1FO9A 4L41C 5CQMX 1QGSA 3SXBA 4EEOA 4EE5A 4M28A 3V91A 1H7QA 1HM8A 1S4NA 2RJ8A 4HO3A 3SXGA 1WT0A 3JUKA 2QKXA 4R7PA 4Y62A 4EVWA 1VZUA 1ON6A 2VS3A 2VSIA 1O0RA 5FUHA 4FREA 4J18A 1LL2A 1R80A 1VICA 3OH1A 1VZXA 2O1HA 3SX7A 4B4GA 1MC3A 4Y6UA 1G93A 1G1LA 4BQHA 1Z90A 2WAWA 1NF5B 1K4VA 3OKRA 2ZU8A 1LL3A 5HS2A 1YP4A 4FROA 2AE7A 2X60A 2Z86A 3QVBA 4CJCA 1ZIZA 1ZJ3A 3JTJA 2Y4LA 4MNDA 1GQ9A 2RIYA 5DDTA 4HO6A 2VS5A 4Y7GA 5AJNA 3V0NA 1ZI1A 4MYBA 4G3PA 2YCMA 4NAKA 4AYJA 5JQQA 4ASYA 1G0RA 3Q7UA 2VS4A 2Q4JA 2RJ1A 3BCVA 4Y7FA 1HJLA 1OMXA 2PGYA 2YQJA 1G95A 3OGZA 1TZFA 1JV1A 1IIMA 5C48A 4B5BA 2WVLA 1R81A 4D11A 3I0JA 5FU0A 5C1GA 3SPTA 5FYEA 3D98A 2D0JA 4G3SA 1EZIA 3U2WA 1ZI4A 3SX5A 2QH5A 2APCA 1W57A 1FR9A 1JVDA 3O3PA 4Y6NA 3CKQA 3SX8A 2WGZA 1H5SA 1QG8A 4IRQA 4NANA 1O7OA 1YP2A 4FRHA 1WT3A 3V8ZA 4KRVA 5C4FA 2QGIA 5AJOA 2VFZA 1VH1A 4Y64A 4KPZA 3V0LA 2ICXA 4FRMA 4FRPA 4GBPA 4HO5A 1GQCA 2WVMA 1XHBA 2Y4JA 2Y4MA 5C8RA 1H4CA 5CQNX 2D7IA 2JCJA 5C36A 3Q80A 3F1CA 3FOQA 4BMAA 5IFYA 4HO8A 2V0KA 1H5TB 1ZCYA 2Y7AA 1NMMB 3RMWA 4EE4A 2ICYA 4D0TA 2CU2A 5C4DA 1ZCUA 3U0YA 1V82A 1FWYA 4B4MA 3E26A 3I0DA 1NHEB 4Y7TA 4Y9XA 1V83A 3U0XA 2I7BA 5EJZA 2W0WA 4FQWA 2VD4A 2JCKA 3U2XA 3V0OA 1VZTA 2FYAA 1R7TA 1HM0A 2Y4KA 3ZGFA 3PKQA 3BRKX 3Q4SA 3CKJA 4FRAA 3U2VA 1NQIB 5C1LA 1INIA 4DECA 1G2VA 5AJPA 1JYLA 1QGQA 4G87A 1HJJA 5I1FA 5IDTA 3RMVA 4AAWA 5C3DA 1W77A 1FOAA 5L6SA 2I5EA 3I0LA 4AYLA 1G97A 2RJ5A 2AM3A 1G8OA 4EEMA 1LVWA 3PKPA 4CVHA 2XWLA 1XZ6A 2RIXA 2X5ZA 3E25A 1H7HA 1H3MA 3TZTA 4ECMA 2OI6A 5FU8A 2UX8A 2VXMA 4FRBA 4JISA 4HG6A 1JYKA 4D11C 1VPAA 4D0ZA 1WVCA 3IOIA 1R7UA 5C38A 3I0CA 3SXEA 3DK5A 4KNXA 5BXCA 2YESA 1O23B 3I0FA 1GX4A 5CMIA 1FXJA 4P00A 2NXVA 4HCQA 1MP4A 1H5SC 4JD0A 3ZLKA 4FRLA 1NWGB 3T7OA 3I0IX 2PX7A 4FRDA 2ZU7A 1R7VA 4ZDQA 1QWJA 1SS9A 3HL3A 4B3UA 2X65A 1TW5A 1H7TA 1IINA 2AESA 2YC5A 3POLA 3NGWA 3RSBA 4Y7UA 3ZGGA 1HV9A 3DUVA 4LW3A 3OH4A 1HM9A 2RJ4A 2JCLA 3IOJA 4CJBA 1FGGA 2OI5A 3IOHA 2VSHA 1H5RB 3SXDA 3FWWA 2W0VA 4K6RA 1ZJ0A 5DDVA 1FR8A 4KQLA 1R7YA 2V0HA 1LZ0A 5CMGX 2XMEA 3F1YA 4LW6A 4YS8A 3TQDA 1ZJOA 3K8EA 1ZJ1A 1R82A 3I0HA 4DE7A 1ZI5A 2FFVA 1GX0A 2MZBA 2V0IA 1VM8A 1YP3A 4FRQA 1LZ7A 3I0GA 2RJ9A 2AECA 1H4EA 1TVYA 1LZJA 2FYDB 3I0KA 1VGTA 5FTVA 4B4BA 1I52A 2O1FA 4HO0A 3ZF8A 1TW1A 2GGOA 1FO8A 3CKNA 4AC3A 4KT7A 1ZHJA 3SX3A 3SXCA 4KNRA 4B2XA 2OI7A 4KC4A 4UEGA 1INJA 4G3QA 5EIYA 2FYCB 4Y7VA 5FTSA 5CMFX 4KC2A 2Y6PA 3CGXA 3CKVA 3ST8A 1FRWA 1G9RA 1H5TA 2AM5A 1ZI3A 4B42A 5FV9A 2FYBA 3OAMA 3V0PA 3SXAA 2WE9A 2VXLA 2E3DA 1V84A 5C47A 4M2AA 1H5SD 2OEGA 2YQCA 1E5KA 4EE3A 1MP3A 2BO4A 2JCOA 2Z87A 2RJ6A 3V90A 2RJ7A 1S4PA 5EJ1A 1S4OA 3OC9A 2PGVA 1ZCVA 4P02A 4NALA 4XWIA 2FFUA 4DDZA 1JVGA 3JUJA 4ASJA 1ON8A 4M2BA 3KIAA 2AM4A 2WEEA 3LW6A 3ZLLA 2BO6A 1VGZA 4C2SA 5C4CA 2OEFA 2ZU9A 4M4KA 3V8YA 1FZWA 4E1KA 1O7QA 1FGXA 1H7LA 5CQPA 3V0MA 4ARWA 4CJ8A 5C3BA 1H7GA 2D7RA 2V0JA 1YROB 4NAIA 1WT1A 5C49A 4KC1A 1ZCTA 5CQLX 5CMJA 2DPWA 4HO9A 1GWWA 1OMZA 2I5KA 4IRPA 5IDSA 4KXOA 1PZTA
chains in the Genus database with same CATH superfamily
3D8VA 1H4DA 1FG5N 1ZDGA 5C3AA 2GGQA 1NKHB 1KWSA 1LL0A 1WSZA 3K8DA 3OH2A 3I0EA 5C4EA 5CQOA 2FY7A 3U2TA 1WT2A 3CKOA 3D5NA 1H5SB 4FCUA 1G3LA 1PZYB 2WVKA 5C1HA 1EYRA 4B2WA 3CU0A 3OH3A 2RIZA 4Y63A 3GUEA 1LZIA 2YC3A 2AGDA 5CMHA 1FXOA 1VGWA 4FCEA 4O6NA 5J49A 4KPXA 3PNNA 3T7MA 3R3IA 4HOCA 2O1GA 2RJ0A 2YQSA 4EEAA 2P6WA 3USQA 3OH0A 1G23A 1MP5A 1VH3A 1VGUA 4HO2A 3V0QA 1ZDFA 2YQHA 2A8UA 2A8WA 1H5RA 1GWVA 1R7XA 3USRA 1OQMB 2RITA 2V0LA 1ZJPA 3N9WA 4Q7CA 2XMHA 1JV3A 2XWMA 3T7NA 2BO8A 4HO4A 5C4BA 2P72A 3EE5A 1H7FA 4D48A 2BO7A 2XWNA 1GA8A 2E8BA 1H7EA 3U2UA 2AH9A 1ZJ2A 2P73A 2PA4A 3DJ4A 4EEGA 1W55A 5L6VA 3R2WA 2X5SA 1FO9A 4L41C 5CQMX 1QGSA 3SXBA 4EEOA 4EE5A 4M28A 3V91A 1H7QA 1HM8A 1S4NA 2RJ8A 4HO3A 3SXGA 1WT0A 3JUKA 2QKXA 4R7PA 4Y62A 4EVWA 1VZUA 1ON6A 2VS3A 2VSIA 1O0RA 5FUHA 4FREA 4J18A 1LL2A 1R80A 1VICA 3OH1A 1VZXA 2O1HA 3SX7A 4B4GA 1MC3A 5D91A 4Y6UA 1G93A 1G1LA 4BQHA 1Z90A 2WAWA 1NF5B 1K4VA 3OKRA 2ZU8A 1LL3A 5HS2A 1YP4A 4FROA 2AE7A 2X60A 2Z86A 3QVBA 4CJCA 1ZIZA 1ZJ3A 3JTJA 2Y4LA 4MNDA 1GQ9A 2RIYA 5DDTA 4HO6A 2VS5A 4Y7GA 5AJNA 3V0NA 1ZI1A 4MYBA 4G3PA 2YCMA 4NAKA 4AYJA 5JQQA 4ASYA 1G0RA 3Q7UA 2VS4A 2Q4JA 2RJ1A 3BCVA 4Y7FA 1HJLA 1OMXA 2PGYA 2YQJA 1G95A 3OGZA 1TZFA 1JV1A 1IIMA 5C48A 4B5BA 2WVLA 1R81A 4D11A 3I0JA 5FU0A 5C1GA 3SPTA 5FYEA 3D98A 2D0JA 4G3SA 1EZIA 3U2WA 1ZI4A 2VK9A 3SX5A 2QH5A 2APCA 1W57A 1FR9A 1JVDA 3O3PA 4Y6NA 3CKQA 3SX8A 2WGZA 1H5SA 1QG8A 4IRQA 4NANA 1O7OA 1YP2A 4FRHA 4FIXA 1WT3A 3V8ZA 4KRVA 5C4FA 2QGIA 5AJOA 2VFZA 1VH1A 4Y64A 4KPZA 3V0LA 2ICXA 4FRMA 4FRPA 4GBPA 4HO5A 1GQCA 2WVMA 1XHBA 2Y4JA 2Y4MA 5C8RA 1H4CA 5CQNX 2D7IA 2JCJA 5C36A 3Q80A 3F1CA 3FOQA 4BMAA 5IFYA 4HO8A 2V0KA 1H5TB 1ZCYA 2Y7AA 1NMMB 3RMWA 4EE4A 2ICYA 4D0TA 2CU2A 5C4DA 1ZCUA 3U0YA 1V82A 1FWYA 4B4MA 3E26A 3I0DA 1NHEB 4Y7TA 4Y9XA 1V83A 3U0XA 2I7BA 5EJZA 2W0WA 4FQWA 2C0NA 2VD4A 2JCKA 4FIYA 3U2XA 3V0OA 1VZTA 2FYAA 1R7TA 4MIXA 1HM0A 2Y4KA 3ZGFA 3PKQA 3BRKX 3Q4SA 3CKJA 4FRAA 3U2VA 1NQIB 5C1LA 1INIA 4DECA 1G2VA 5AJPA 1JYLA 1QGQA 4G87A 1HJJA 5I1FA 5IDTA 3RMVA 4AAWA 5C3DA 1W77A 1FOAA 5L6SA 2I5EA 3I0LA 4AYLA 1G97A 2RJ5A 2AM3A 1G8OA 4EEMA 1LVWA 3PKPA 4CVHA 2XWLA 1XZ6A 2RIXA 2X5ZA 3E25A 1H7HA 1H3MA 3TZTA 4ECMA 2OI6A 5FU8A 2UX8A 2VXMA 4FRBA 4JISA 4HG6A 1JYKA 4D11C 1VPAA 4D0ZA 1WVCA 3IOIA 1R7UA 5C38A 3I0CA 3SXEA 3DK5A 4KNXA 5BXCA 2YESA 1O23B 3I0FA 4O6MA 1GX4A 5CMIA 1FXJA 4P00A 2NXVA 4HCQA 2J0BA 1MP4A 1H5SC 4JD0A 3ZLKA 4FRLA 1NWGB 3T7OA 3I0IX 2PX7A 4FRDA 2ZU7A 1R7VA 4ZDQA 1QWJA 1SS9A 3HL3A 4B3UA 2X65A 1TW5A 1H7TA 2J0AA 1IINA 2AESA 2YC5A 3POLA 3NGWA 3RSBA 4Y7UA 3ZGGA 1HV9A 3DUVA 4LW3A 5D92A 3OH4A 1HM9A 2RJ4A 2JCLA 3IOJA 4CJBA 1FGGA 2OI5A 3IOHA 2VSHA 1H5RB 3SXDA 3FWWA 2W0VA 4K6RA 1ZJ0A 5DDVA 1FR8A 4KQLA 1R7YA 2V0HA 1LZ0A 5CMGX 2XMEA 3F1YA 4LW6A 4YS8A 3TQDA 1ZJOA 3K8EA 1ZJ1A 1R82A 3I0HA 4DE7A 1ZI5A 2FFVA 1GX0A 2MZBA 2V0IA 1VM8A 1YP3A 4FRQA 1LZ7A 3I0GA 2RJ9A 2AECA 1H4EA 1TVYA 1LZJA 2FYDB 3I0KA 1VGTA 5FTVA 4B4BA 1I52A 2O1FA 4HO0A 3ZF8A 1TW1A 2GGOA 1FO8A 3CKNA 4AC3A 4KT7A 1ZHJA 3SX3A 3SXCA 4KNRA 4B2XA 2OI7A 4KC4A 4UEGA 1INJA 4G3QA 5EIYA 2FYCB 4Y7VA 5FTSA 5CMFX 4KC2A 2Y6PA 3CGXA 3CKVA 3ST8A 1FRWA 1G9RA 1H5TA 2AM5A 1ZI3A 4B42A 5FV9A 2FYBA 3OAMA 3V0PA 3SXAA 2WE9A 2VXLA 2E3DA 1V84A 5C47A 4M2AA 1H5SD 2OEGA 2YQCA 1E5KA 4EE3A 1MP3A 2BO4A 2JCOA 2Z87A 2RJ6A 3V90A 2RJ7A 1S4PA 5EJ1A 1S4OA 3OC9A 2PGVA 1ZCVA 4P02A 4NALA 4XWIA 2FFUA 4DDZA 1JVGA 3JUJA 4ASJA 1ON8A 4M2BA 3KIAA 2AM4A 2WEEA 3LW6A 3ZLLA 2BO6A 1VGZA 4C2SA 5C4CA 2OEFA 2ZU9A 4M4KA 3V8YA 1FZWA 4E1KA 1O7QA 1FGXA 1H7LA 5CQPA 3V0MA 4ARWA 4CJ8A 5C3BA 1H7GA 2D7RA 2V0JA 1YROB 4NAIA 1WT1A 5C49A 4KC1A 1ZCTA 5CQLX 5CMJA 2DPWA 4HO9A 1GWWA 1OMZA 2I5KA 4IRPA 5IDSA 4KXOA 1PZTA
chains in the Genus database with same CATH topology
3D8VA 1H4DA 1FG5N 1ZDGA 5C3AA 2GGQA 1NKHB 1KWSA 1LL0A 1WSZA 3K8DA 3OH2A 3I0EA 5C4EA 5CQOA 2FY7A 3U2TA 1WT2A 3CKOA 3D5NA 1H5SB 4FCUA 1G3LA 1PZYB 2WVKA 5C1HA 1EYRA 4B2WA 3CU0A 3OH3A 2RIZA 4Y63A 3GUEA 1LZIA 2YC3A 2AGDA 5CMHA 1FXOA 1VGWA 4FCEA 4O6NA 5J49A 4KPXA 3PNNA 3T7MA 3R3IA 4HOCA 2O1GA 2RJ0A 2YQSA 4EEAA 2P6WA 3USQA 3OH0A 1G23A 1MP5A 1VH3A 1VGUA 4HO2A 3V0QA 1ZDFA 2YQHA 2A8UA 2A8WA 1H5RA 1GWVA 1R7XA 3USRA 1OQMB 2RITA 2V0LA 1ZJPA 3N9WA 4Q7CA 2XMHA 1JV3A 2XWMA 3T7NA 2BO8A 4HO4A 5C4BA 2P72A 3EE5A 1H7FA 4D48A 2BO7A 2XWNA 1GA8A 2E8BA 1H7EA 3U2UA 2AH9A 1ZJ2A 2P73A 2PA4A 3DJ4A 4EEGA 1W55A 5L6VA 3R2WA 2X5SA 1FO9A 4L41C 5CQMX 1QGSA 3SXBA 4EEOA 4EE5A 4M28A 3V91A 1H7QA 1HM8A 1S4NA 2RJ8A 4HO3A 3SXGA 1WT0A 3JUKA 2QKXA 4R7PA 4Y62A 4EVWA 1VZUA 1ON6A 2VS3A 2VSIA 1O0RA 5FUHA 4FREA 4J18A 1LL2A 1R80A 1VICA 3OH1A 1VZXA 2O1HA 3SX7A 4B4GA 1MC3A 5D91A 4Y6UA 1G93A 1G1LA 4BQHA 1Z90A 2WAWA 1NF5B 1K4VA 3OKRA 2ZU8A 1LL3A 5HS2A 1YP4A 4FROA 2AE7A 2X60A 2Z86A 3QVBA 4CJCA 1ZIZA 1ZJ3A 3JTJA 2Y4LA 4MNDA 1GQ9A 2RIYA 5DDTA 4HO6A 2VS5A 4Y7GA 5AJNA 3V0NA 1ZI1A 4MYBA 4G3PA 2YCMA 4NAKA 4AYJA 5JQQA 4ASYA 1G0RA 3Q7UA 2VS4A 2Q4JA 2RJ1A 3BCVA 4Y7FA 1HJLA 1OMXA 2PGYA 2YQJA 1G95A 3OGZA 1TZFA 1JV1A 1IIMA 5C48A 4B5BA 2WVLA 1R81A 4D11A 3I0JA 5FU0A 5C1GA 3SPTA 5FYEA 3D98A 2D0JA 4G3SA 1EZIA 3U2WA 1ZI4A 2VK9A 3SX5A 2QH5A 2APCA 1W57A 1FR9A 1JVDA 3O3PA 4Y6NA 3CKQA 3SX8A 2WGZA 1H5SA 1QG8A 4IRQA 4NANA 1O7OA 1YP2A 4FRHA 4FIXA 1WT3A 3V8ZA 4KRVA 5C4FA 2QGIA 5AJOA 2VFZA 1VH1A 4Y64A 4KPZA 3V0LA 2ICXA 4FRMA 4FRPA 4GBPA 4HO5A 1GQCA 2WVMA 1XHBA 2Y4JA 2Y4MA 5C8RA 1H4CA 5CQNX 2D7IA 2JCJA 5C36A 3Q80A 3F1CA 3FOQA 4BMAA 5IFYA 4HO8A 2V0KA 1H5TB 1ZCYA 2Y7AA 1NMMB 3RMWA 4EE4A 2ICYA 4D0TA 2CU2A 5C4DA 1ZCUA 3U0YA 1V82A 1FWYA 4B4MA 3E26A 3I0DA 1NHEB 4Y7TA 4Y9XA 1V83A 3U0XA 2I7BA 5EJZA 2W0WA 4FQWA 2C0NA 2VD4A 2JCKA 4FIYA 3U2XA 3V0OA 1VZTA 2FYAA 1R7TA 4MIXA 1HM0A 2Y4KA 3ZGFA 3PKQA 3BRKX 3Q4SA 3CKJA 4FRAA 3U2VA 1NQIB 5C1LA 1INIA 4DECA 1G2VA 5AJPA 1JYLA 1QGQA 4G87A 1HJJA 5I1FA 5IDTA 3RMVA 4AAWA 5C3DA 1W77A 1FOAA 5L6SA 2I5EA 3I0LA 4AYLA 1G97A 2RJ5A 2AM3A 1G8OA 4EEMA 1LVWA 3PKPA 4CVHA 2XWLA 1XZ6A 2RIXA 2X5ZA 3E25A 1H7HA 1H3MA 3TZTA 4ECMA 2OI6A 5FU8A 2UX8A 2VXMA 4FRBA 4JISA 4HG6A 1JYKA 4D11C 1VPAA 4D0ZA 1WVCA 3IOIA 1R7UA 5C38A 3I0CA 3SXEA 3DK5A 4KNXA 5BXCA 2YESA 1O23B 3I0FA 4O6MA 1GX4A 5CMIA 1FXJA 4P00A 2NXVA 4HCQA 2J0BA 1MP4A 1H5SC 4JD0A 3ZLKA 4FRLA 1NWGB 3T7OA 3I0IX 2PX7A 4FRDA 2ZU7A 1R7VA 4ZDQA 1QWJA 1SS9A 3HL3A 4B3UA 2X65A 1TW5A 1H7TA 2J0AA 1IINA 2AESA 2YC5A 3POLA 3NGWA 3RSBA 4Y7UA 3ZGGA 1HV9A 3DUVA 4LW3A 5D92A 3OH4A 1HM9A 2RJ4A 2JCLA 3IOJA 4CJBA 1FGGA 2OI5A 3IOHA 2VSHA 1H5RB 3SXDA 3FWWA 2W0VA 4K6RA 1ZJ0A 5DDVA 1FR8A 4KQLA 1R7YA 2V0HA 1LZ0A 5CMGX 2XMEA 3F1YA 4LW6A 4YS8A 3TQDA 1ZJOA 3K8EA 1ZJ1A 1R82A 3I0HA 4DE7A 1ZI5A 2FFVA 1GX0A 2MZBA 2V0IA 1VM8A 1YP3A 4FRQA 1LZ7A 3I0GA 2RJ9A 2AECA 1H4EA 1TVYA 1LZJA 2FYDB 3I0KA 1VGTA 5FTVA 4B4BA 1I52A 2O1FA 4HO0A 3ZF8A 1TW1A 2GGOA 1FO8A 3CKNA 4AC3A 4KT7A 1ZHJA 3SX3A 3SXCA 4KNRA 4B2XA 2OI7A 4KC4A 4UEGA 1INJA 4G3QA 5EIYA 2FYCB 4Y7VA 5FTSA 5CMFX 4KC2A 2Y6PA 3CGXA 3CKVA 3ST8A 1FRWA 1G9RA 1H5TA 2AM5A 1ZI3A 4B42A 5FV9A 2FYBA 3OAMA 3V0PA 3SXAA 2WE9A 2VXLA 2E3DA 1V84A 5C47A 4M2AA 1H5SD 2OEGA 2YQCA 1E5KA 4EE3A 1MP3A 2BO4A 2JCOA 2Z87A 2RJ6A 3V90A 2RJ7A 1S4PA 5EJ1A 1S4OA 3OC9A 2PGVA 1ZCVA 4P02A 4NALA 4XWIA 2FFUA 4DDZA 1JVGA 3JUJA 4ASJA 1ON8A 4M2BA 3KIAA 2AM4A 2WEEA 3LW6A 3ZLLA 2BO6A 1VGZA 4C2SA 5C4CA 2OEFA 2ZU9A 4M4KA 3V8YA 1FZWA 4E1KA 1O7QA 1FGXA 1H7LA 5CQPA 3V0MA 4ARWA 4CJ8A 5C3BA 1H7GA 2D7RA 2V0JA 1YROB 4NAIA 1WT1A 5C49A 4KC1A 1ZCTA 5CQLX 5CMJA 2DPWA 4HO9A 1GWWA 1OMZA 2I5KA 4IRPA 5IDSA 4KXOA 1PZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8V A;  1H4D A;  1FG5 N;  1ZDG A;  5C3A A;  2GGQ A;  1NKH B;  1KWS A;  1LL0 A;  1WSZ A;  3K8D A;  3OH2 A;  3I0E A;  5C4E A;  5CQO A;  2FY7 A;  3U2T A;  1WT2 A;  3CKO A;  3D5N A;  1H5S B;  4FCU A;  1G3L A;  1PZY B;  2WVK A;  5C1H A;  1EYR A;  4B2W A;  3CU0 A;  3OH3 A;  2RIZ A;  4Y63 A;  3GUE A;  1LZI A;  2YC3 A;  2AGD A;  5CMH A;  1FXO A;  1VGW A;  4FCE A;  5J49 A;  4KPX A;  3PNN A;  3T7M A;  3R3I A;  4HOC A;  2O1G A;  2RJ0 A;  2YQS A;  4EEA A;  2P6W A;  3USQ A;  3OH0 A;  1G23 A;  1MP5 A;  1VH3 A;  1VGU A;  4HO2 A;  3V0Q A;  1ZDF A;  2YQH A;  2A8U A;  2A8W A;  1H5R A;  1GWV A;  1R7X A;  3USR A;  1OQM B;  2RIT A;  2V0L A;  1ZJP A;  3N9W A;  2XMH A;  1JV3 A;  2XWM A;  3T7N A;  2BO8 A;  4HO4 A;  5C4B A;  2P72 A;  3EE5 A;  1H7F A;  4D48 A;  2BO7 A;  2XWN A;  1GA8 A;  2E8B A;  1H7E A;  3U2U A;  2AH9 A;  1ZJ2 A;  2P73 A;  2PA4 A;  3DJ4 A;  4EEG A;  1W55 A;  5L6V A;  3R2W A;  2X5S A;  1FO9 A;  4L41 C;  5CQM X;  1QGS A;  3SXB A;  4EEO A;  4EE5 A;  4M28 A;  3V91 A;  1H7Q A;  1HM8 A;  1S4N A;  2RJ8 A;  4HO3 A;  3SXG A;  1WT0 A;  3JUK A;  2QKX A;  4R7P A;  4Y62 A;  4EVW A;  1VZU A;  1ON6 A;  2VS3 A;  2VSI A;  1O0R A;  5FUH A;  4FRE A;  4J18 A;  1LL2 A;  1R80 A;  1VIC A;  3OH1 A;  1VZX A;  2O1H A;  3SX7 A;  4B4G A;  1MC3 A;  4Y6U A;  1G93 A;  1G1L A;  4BQH A;  1Z90 A;  2WAW A;  1NF5 B;  1K4V A;  3OKR A;  2ZU8 A;  1LL3 A;  5HS2 A;  1YP4 A;  4FRO A;  2AE7 A;  2X60 A;  2Z86 A;  3QVB A;  4CJC A;  1ZIZ A;  1ZJ3 A;  3JTJ A;  2Y4L A;  4MND A;  1GQ9 A;  2RIY A;  5DDT A;  4HO6 A;  2VS5 A;  4Y7G A;  5AJN A;  3V0N A;  1ZI1 A;  4MYB A;  4G3P A;  2YCM A;  4NAK A;  4AYJ A;  5JQQ A;  4ASY A;  1G0R A;  3Q7U A;  2VS4 A;  2Q4J A;  2RJ1 A;  3BCV A;  4Y7F A;  1HJL A;  1OMX A;  2PGY A;  2YQJ A;  1G95 A;  3OGZ A;  1TZF A;  1JV1 A;  1IIM A;  5C48 A;  4B5B A;  2WVL A;  1R81 A;  4D11 A;  3I0J A;  5FU0 A;  5C1G A;  3SPT A;  5FYE A;  3D98 A;  2D0J A;  4G3S A;  1EZI A;  3U2W A;  1ZI4 A;  3SX5 A;  2QH5 A;  2APC A;  1W57 A;  1FR9 A;  1JVD A;  3O3P A;  4Y6N A;  3CKQ A;  3SX8 A;  2WGZ A;  1H5S A;  1QG8 A;  4IRQ A;  4NAN A;  1O7O A;  1YP2 A;  4FRH A;  1WT3 A;  3V8Z A;  4KRV A;  5C4F A;  2QGI A;  5AJO A;  2VFZ A;  1VH1 A;  4Y64 A;  4KPZ A;  3V0L A;  2ICX A;  4FRM A;  4FRP A;  4GBP A;  4HO5 A;  1GQC A;  2WVM A;  1XHB A;  2Y4J A;  2Y4M A;  5C8R A;  1H4C A;  5CQN X;  2D7I A;  2JCJ A;  5C36 A;  3Q80 A;  3F1C A;  3FOQ A;  4BMA A;  5IFY A;  4HO8 A;  2V0K A;  1H5T B;  1ZCY A;  2Y7A A;  1NMM B;  3RMW A;  4EE4 A;  2ICY A;  4D0T A;  2CU2 A;  5C4D A;  1ZCU A;  3U0Y A;  1V82 A;  1FWY A;  4B4M A;  3E26 A;  3I0D A;  1NHE B;  4Y7T A;  4Y9X A;  1V83 A;  3U0X A;  2I7B A;  5EJZ A;  2W0W A;  4FQW A;  2VD4 A;  2JCK A;  3U2X A;  3V0O A;  1VZT A;  2FYA A;  1R7T A;  1HM0 A;  2Y4K A;  3ZGF A;  3PKQ A;  3BRK X;  3Q4S A;  3CKJ A;  4FRA A;  3U2V A;  1NQI B;  5C1L A;  1INI A;  4DEC A;  1G2V A;  5AJP A;  1JYL A;  1QGQ A;  4G87 A;  1HJJ A;  5I1F A;  5IDT A;  3RMV A;  4AAW A;  5C3D A;  1W77 A;  1FOA A;  5L6S A;  2I5E A;  3I0L A;  4AYL A;  1G97 A;  2RJ5 A;  2AM3 A;  1G8O A;  4EEM A;  1LVW A;  3PKP A;  4CVH A;  2XWL A;  1XZ6 A;  2RIX A;  2X5Z A;  3E25 A;  1H7H A;  1H3M A;  3TZT A;  4ECM A;  2OI6 A;  5FU8 A;  2UX8 A;  2VXM A;  4FRB A;  4JIS A;  4HG6 A;  1JYK A;  4D11 C;  1VPA A;  4D0Z A;  1WVC A;  3IOI A;  1R7U A;  5C38 A;  3I0C A;  3SXE A;  3DK5 A;  4KNX A;  5BXC A;  2YES A;  1O23 B;  3I0F A;  1GX4 A;  5CMI A;  1FXJ A;  4P00 A;  2NXV A;  4HCQ A;  1MP4 A;  1H5S C;  4JD0 A;  3ZLK A;  4FRL A;  1NWG B;  3T7O A;  3I0I X;  2PX7 A;  4FRD A;  2ZU7 A;  1R7V A;  4ZDQ A;  1QWJ A;  1SS9 A;  3HL3 A;  4B3U A;  2X65 A;  1TW5 A;  1H7T A;  1IIN A;  2AES A;  2YC5 A;  3POL A;  3NGW A;  3RSB A;  4Y7U A;  3ZGG A;  1HV9 A;  3DUV A;  4LW3 A;  3OH4 A;  1HM9 A;  2RJ4 A;  2JCL A;  3IOJ A;  4CJB A;  1FGG A;  2OI5 A;  3IOH A;  2VSH A;  1H5R B;  3SXD A;  3FWW A;  2W0V A;  4K6R A;  1ZJ0 A;  5DDV A;  1FR8 A;  4KQL A;  1R7Y A;  2V0H A;  1LZ0 A;  5CMG X;  2XME A;  3F1Y A;  4LW6 A;  4YS8 A;  3TQD A;  1ZJO A;  3K8E A;  1ZJ1 A;  1R82 A;  3I0H A;  4DE7 A;  1ZI5 A;  2FFV A;  1GX0 A;  2MZB A;  2V0I A;  1VM8 A;  1YP3 A;  4FRQ A;  1LZ7 A;  3I0G A;  2RJ9 A;  2AEC A;  1H4E A;  1TVY A;  1LZJ A;  2FYD B;  3I0K A;  1VGT A;  5FTV A;  4B4B A;  1I52 A;  2O1F A;  4HO0 A;  3ZF8 A;  1TW1 A;  2GGO A;  1FO8 A;  3CKN A;  4AC3 A;  4KT7 A;  1ZHJ A;  3SX3 A;  3SXC A;  4KNR A;  4B2X A;  2OI7 A;  4KC4 A;  4UEG A;  1INJ A;  4G3Q A;  5EIY A;  2FYC B;  4Y7V A;  5FTS A;  5CMF X;  4KC2 A;  2Y6P A;  3CGX A;  3CKV A;  3ST8 A;  1FRW A;  1G9R A;  1H5T A;  2AM5 A;  1ZI3 A;  4B42 A;  5FV9 A;  2FYB A;  3OAM A;  3V0P A;  3SXA A;  2WE9 A;  2VXL A;  2E3D A;  1V84 A;  5C47 A;  4M2A A;  1H5S D;  2OEG A;  2YQC A;  1E5K A;  4EE3 A;  1MP3 A;  2BO4 A;  2JCO A;  2Z87 A;  2RJ6 A;  3V90 A;  2RJ7 A;  1S4P A;  5EJ1 A;  1S4O A;  3OC9 A;  2PGV A;  1ZCV A;  4P02 A;  4NAL A;  4XWI A;  2FFU A;  4DDZ A;  1JVG A;  3JUJ A;  4ASJ A;  1ON8 A;  4M2B A;  3KIA A;  2AM4 A;  2WEE A;  3LW6 A;  3ZLL A;  2BO6 A;  1VGZ A;  4C2S A;  5C4C A;  2OEF A;  2ZU9 A;  4M4K A;  3V8Y A;  1FZW A;  4E1K A;  1O7Q A;  1FGX A;  1H7L A;  5CQP A;  3V0M A;  4ARW A;  4CJ8 A;  5C3B A;  1H7G A;  2D7R A;  2V0J A;  1YRO B;  4NAI A;  1WT1 A;  5C49 A;  4KC1 A;  1ZCT A;  5CQL X;  5CMJ A;  2DPW A;  4HO9 A;  1GWW A;  1OMZ A;  2I5K A;  4IRP A;  5IDS A;  4KXO A;  1PZT A; 
#chains in the Genus database with same CATH topology
 3D8V A;  1H4D A;  1FG5 N;  1ZDG A;  5C3A A;  2GGQ A;  1NKH B;  1KWS A;  1LL0 A;  1WSZ A;  3K8D A;  3OH2 A;  3I0E A;  5C4E A;  5CQO A;  2FY7 A;  3U2T A;  1WT2 A;  3CKO A;  3D5N A;  1H5S B;  4FCU A;  1G3L A;  1PZY B;  2WVK A;  5C1H A;  1EYR A;  4B2W A;  3CU0 A;  3OH3 A;  2RIZ A;  4Y63 A;  3GUE A;  1LZI A;  2YC3 A;  2AGD A;  5CMH A;  1FXO A;  1VGW A;  4FCE A;  4O6N A;  5J49 A;  4KPX A;  3PNN A;  3T7M A;  3R3I A;  4HOC A;  2O1G A;  2RJ0 A;  2YQS A;  4EEA A;  2P6W A;  3USQ A;  3OH0 A;  1G23 A;  1MP5 A;  1VH3 A;  1VGU A;  4HO2 A;  3V0Q A;  1ZDF A;  2YQH A;  2A8U A;  2A8W A;  1H5R A;  1GWV A;  1R7X A;  3USR A;  1OQM B;  2RIT A;  2V0L A;  1ZJP A;  3N9W A;  4Q7C A;  2XMH A;  1JV3 A;  2XWM A;  3T7N A;  2BO8 A;  4HO4 A;  5C4B A;  2P72 A;  3EE5 A;  1H7F A;  4D48 A;  2BO7 A;  2XWN A;  1GA8 A;  2E8B A;  1H7E A;  3U2U A;  2AH9 A;  1ZJ2 A;  2P73 A;  2PA4 A;  3DJ4 A;  4EEG A;  1W55 A;  5L6V A;  3R2W A;  2X5S A;  1FO9 A;  4L41 C;  5CQM X;  1QGS A;  3SXB A;  4EEO A;  4EE5 A;  4M28 A;  3V91 A;  1H7Q A;  1HM8 A;  1S4N A;  2RJ8 A;  4HO3 A;  3SXG A;  1WT0 A;  3JUK A;  2QKX A;  4R7P A;  4Y62 A;  4EVW A;  1VZU A;  1ON6 A;  2VS3 A;  2VSI A;  1O0R A;  5FUH A;  4FRE A;  4J18 A;  1LL2 A;  1R80 A;  1VIC A;  3OH1 A;  1VZX A;  2O1H A;  3SX7 A;  4B4G A;  1MC3 A;  5D91 A;  4Y6U A;  1G93 A;  1G1L A;  4BQH A;  1Z90 A;  2WAW A;  1NF5 B;  1K4V A;  3OKR A;  2ZU8 A;  1LL3 A;  5HS2 A;  1YP4 A;  4FRO A;  2AE7 A;  2X60 A;  2Z86 A;  3QVB A;  4CJC A;  1ZIZ A;  1ZJ3 A;  3JTJ A;  2Y4L A;  4MND A;  1GQ9 A;  2RIY A;  5DDT A;  4HO6 A;  2VS5 A;  4Y7G A;  5AJN A;  3V0N A;  1ZI1 A;  4MYB A;  4G3P A;  2YCM A;  4NAK A;  4AYJ A;  5JQQ A;  4ASY A;  1G0R A;  3Q7U A;  2VS4 A;  2Q4J A;  2RJ1 A;  3BCV A;  4Y7F A;  1HJL A;  1OMX A;  2PGY A;  2YQJ A;  1G95 A;  3OGZ A;  1TZF A;  1JV1 A;  1IIM A;  5C48 A;  4B5B A;  2WVL A;  1R81 A;  4D11 A;  3I0J A;  5FU0 A;  5C1G A;  3SPT A;  5FYE A;  3D98 A;  2D0J A;  4G3S A;  1EZI A;  3U2W A;  1ZI4 A;  2VK9 A;  3SX5 A;  2QH5 A;  2APC A;  1W57 A;  1FR9 A;  1JVD A;  3O3P A;  4Y6N A;  3CKQ A;  3SX8 A;  2WGZ A;  1H5S A;  1QG8 A;  4IRQ A;  4NAN A;  1O7O A;  1YP2 A;  4FRH A;  4FIX A;  1WT3 A;  3V8Z A;  4KRV A;  5C4F A;  2QGI A;  5AJO A;  2VFZ A;  1VH1 A;  4Y64 A;  4KPZ A;  3V0L A;  2ICX A;  4FRM A;  4FRP A;  4GBP A;  4HO5 A;  1GQC A;  2WVM A;  1XHB A;  2Y4J A;  2Y4M A;  5C8R A;  1H4C A;  5CQN X;  2D7I A;  2JCJ A;  5C36 A;  3Q80 A;  3F1C A;  3FOQ A;  4BMA A;  5IFY A;  4HO8 A;  2V0K A;  1H5T B;  1ZCY A;  2Y7A A;  1NMM B;  3RMW A;  4EE4 A;  2ICY A;  4D0T A;  2CU2 A;  5C4D A;  1ZCU A;  3U0Y A;  1V82 A;  1FWY A;  4B4M A;  3E26 A;  3I0D A;  1NHE B;  4Y7T A;  4Y9X A;  1V83 A;  3U0X A;  2I7B A;  5EJZ A;  2W0W A;  4FQW A;  2C0N A;  2VD4 A;  2JCK A;  4FIY A;  3U2X A;  3V0O A;  1VZT A;  2FYA A;  1R7T A;  4MIX A;  1HM0 A;  2Y4K A;  3ZGF A;  3PKQ A;  3BRK X;  3Q4S A;  3CKJ A;  4FRA A;  3U2V A;  1NQI B;  5C1L A;  1INI A;  4DEC A;  1G2V A;  5AJP A;  1JYL A;  1QGQ A;  4G87 A;  1HJJ A;  5I1F A;  5IDT A;  3RMV A;  4AAW A;  5C3D A;  1W77 A;  1FOA A;  5L6S A;  2I5E A;  3I0L A;  4AYL A;  1G97 A;  2RJ5 A;  2AM3 A;  1G8O A;  4EEM A;  1LVW A;  3PKP A;  4CVH A;  2XWL A;  1XZ6 A;  2RIX A;  2X5Z A;  3E25 A;  1H7H A;  1H3M A;  3TZT A;  4ECM A;  2OI6 A;  5FU8 A;  2UX8 A;  2VXM A;  4FRB A;  4JIS A;  4HG6 A;  1JYK A;  4D11 C;  1VPA A;  4D0Z A;  1WVC A;  3IOI A;  1R7U A;  5C38 A;  3I0C A;  3SXE A;  3DK5 A;  4KNX A;  5BXC A;  2YES A;  1O23 B;  3I0F A;  4O6M A;  1GX4 A;  5CMI A;  1FXJ A;  4P00 A;  2NXV A;  4HCQ A;  2J0B A;  1MP4 A;  1H5S C;  4JD0 A;  3ZLK A;  4FRL A;  1NWG B;  3T7O A;  3I0I X;  2PX7 A;  4FRD A;  2ZU7 A;  1R7V A;  4ZDQ A;  1QWJ A;  1SS9 A;  3HL3 A;  4B3U A;  2X65 A;  1TW5 A;  1H7T A;  2J0A A;  1IIN A;  2AES A;  2YC5 A;  3POL A;  3NGW A;  3RSB A;  4Y7U A;  3ZGG A;  1HV9 A;  3DUV A;  4LW3 A;  5D92 A;  3OH4 A;  1HM9 A;  2RJ4 A;  2JCL A;  3IOJ A;  4CJB A;  1FGG A;  2OI5 A;  3IOH A;  2VSH A;  1H5R B;  3SXD A;  3FWW A;  2W0V A;  4K6R A;  1ZJ0 A;  5DDV A;  1FR8 A;  4KQL A;  1R7Y A;  2V0H A;  1LZ0 A;  5CMG X;  2XME A;  3F1Y A;  4LW6 A;  4YS8 A;  3TQD A;  1ZJO A;  3K8E A;  1ZJ1 A;  1R82 A;  3I0H A;  4DE7 A;  1ZI5 A;  2FFV A;  1GX0 A;  2MZB A;  2V0I A;  1VM8 A;  1YP3 A;  4FRQ A;  1LZ7 A;  3I0G A;  2RJ9 A;  2AEC A;  1H4E A;  1TVY A;  1LZJ A;  2FYD B;  3I0K A;  1VGT A;  5FTV A;  4B4B A;  1I52 A;  2O1F A;  4HO0 A;  3ZF8 A;  1TW1 A;  2GGO A;  1FO8 A;  3CKN A;  4AC3 A;  4KT7 A;  1ZHJ A;  3SX3 A;  3SXC A;  4KNR A;  4B2X A;  2OI7 A;  4KC4 A;  4UEG A;  1INJ A;  4G3Q A;  5EIY A;  2FYC B;  4Y7V A;  5FTS A;  5CMF X;  4KC2 A;  2Y6P A;  3CGX A;  3CKV A;  3ST8 A;  1FRW A;  1G9R A;  1H5T A;  2AM5 A;  1ZI3 A;  4B42 A;  5FV9 A;  2FYB A;  3OAM A;  3V0P A;  3SXA A;  2WE9 A;  2VXL A;  2E3D A;  1V84 A;  5C47 A;  4M2A A;  1H5S D;  2OEG A;  2YQC A;  1E5K A;  4EE3 A;  1MP3 A;  2BO4 A;  2JCO A;  2Z87 A;  2RJ6 A;  3V90 A;  2RJ7 A;  1S4P A;  5EJ1 A;  1S4O A;  3OC9 A;  2PGV A;  1ZCV A;  4P02 A;  4NAL A;  4XWI A;  2FFU A;  4DDZ A;  1JVG A;  3JUJ A;  4ASJ A;  1ON8 A;  4M2B A;  3KIA A;  2AM4 A;  2WEE A;  3LW6 A;  3ZLL A;  2BO6 A;  1VGZ A;  4C2S A;  5C4C A;  2OEF A;  2ZU9 A;  4M4K A;  3V8Y A;  1FZW A;  4E1K A;  1O7Q A;  1FGX A;  1H7L A;  5CQP A;  3V0M A;  4ARW A;  4CJ8 A;  5C3B A;  1H7G A;  2D7R A;  2V0J A;  1YRO B;  4NAI A;  1WT1 A;  5C49 A;  4KC1 A;  1ZCT A;  5CQL X;  5CMJ A;  2DPW A;  4HO9 A;  1GWW A;  1OMZ A;  2I5K A;  4IRP A;  5IDS A;  4KXO A;  1PZT A; 
#chains in the Genus database with same CATH homology
 3D8V A;  1H4D A;  1FG5 N;  1ZDG A;  5C3A A;  2GGQ A;  1NKH B;  1KWS A;  1LL0 A;  1WSZ A;  3K8D A;  3OH2 A;  3I0E A;  5C4E A;  5CQO A;  2FY7 A;  3U2T A;  1WT2 A;  3CKO A;  3D5N A;  1H5S B;  4FCU A;  1G3L A;  1PZY B;  2WVK A;  5C1H A;  1EYR A;  4B2W A;  3CU0 A;  3OH3 A;  2RIZ A;  4Y63 A;  3GUE A;  1LZI A;  2YC3 A;  2AGD A;  5CMH A;  1FXO A;  1VGW A;  4FCE A;  4O6N A;  5J49 A;  4KPX A;  3PNN A;  3T7M A;  3R3I A;  4HOC A;  2O1G A;  2RJ0 A;  2YQS A;  4EEA A;  2P6W A;  3USQ A;  3OH0 A;  1G23 A;  1MP5 A;  1VH3 A;  1VGU A;  4HO2 A;  3V0Q A;  1ZDF A;  2YQH A;  2A8U A;  2A8W A;  1H5R A;  1GWV A;  1R7X A;  3USR A;  1OQM B;  2RIT A;  2V0L A;  1ZJP A;  3N9W A;  4Q7C A;  2XMH A;  1JV3 A;  2XWM A;  3T7N A;  2BO8 A;  4HO4 A;  5C4B A;  2P72 A;  3EE5 A;  1H7F A;  4D48 A;  2BO7 A;  2XWN A;  1GA8 A;  2E8B A;  1H7E A;  3U2U A;  2AH9 A;  1ZJ2 A;  2P73 A;  2PA4 A;  3DJ4 A;  4EEG A;  1W55 A;  5L6V A;  3R2W A;  2X5S A;  1FO9 A;  4L41 C;  5CQM X;  1QGS A;  3SXB A;  4EEO A;  4EE5 A;  4M28 A;  3V91 A;  1H7Q A;  1HM8 A;  1S4N A;  2RJ8 A;  4HO3 A;  3SXG A;  1WT0 A;  3JUK A;  2QKX A;  4R7P A;  4Y62 A;  4EVW A;  1VZU A;  1ON6 A;  2VS3 A;  2VSI A;  1O0R A;  5FUH A;  4FRE A;  4J18 A;  1LL2 A;  1R80 A;  1VIC A;  3OH1 A;  1VZX A;  2O1H A;  3SX7 A;  4B4G A;  1MC3 A;  5D91 A;  4Y6U A;  1G93 A;  1G1L A;  4BQH A;  1Z90 A;  2WAW A;  1NF5 B;  1K4V A;  3OKR A;  2ZU8 A;  1LL3 A;  5HS2 A;  1YP4 A;  4FRO A;  2AE7 A;  2X60 A;  2Z86 A;  3QVB A;  4CJC A;  1ZIZ A;  1ZJ3 A;  3JTJ A;  2Y4L A;  4MND A;  1GQ9 A;  2RIY A;  5DDT A;  4HO6 A;  2VS5 A;  4Y7G A;  5AJN A;  3V0N A;  1ZI1 A;  4MYB A;  4G3P A;  2YCM A;  4NAK A;  4AYJ A;  5JQQ A;  4ASY A;  1G0R A;  3Q7U A;  2VS4 A;  2Q4J A;  2RJ1 A;  3BCV A;  4Y7F A;  1HJL A;  1OMX A;  2PGY A;  2YQJ A;  1G95 A;  3OGZ A;  1TZF A;  1JV1 A;  1IIM A;  5C48 A;  4B5B A;  2WVL A;  1R81 A;  4D11 A;  3I0J A;  5FU0 A;  5C1G A;  3SPT A;  5FYE A;  3D98 A;  2D0J A;  4G3S A;  1EZI A;  3U2W A;  1ZI4 A;  2VK9 A;  3SX5 A;  2QH5 A;  2APC A;  1W57 A;  1FR9 A;  1JVD A;  3O3P A;  4Y6N A;  3CKQ A;  3SX8 A;  2WGZ A;  1H5S A;  1QG8 A;  4IRQ A;  4NAN A;  1O7O A;  1YP2 A;  4FRH A;  4FIX A;  1WT3 A;  3V8Z A;  4KRV A;  5C4F A;  2QGI A;  5AJO A;  2VFZ A;  1VH1 A;  4Y64 A;  4KPZ A;  3V0L A;  2ICX A;  4FRM A;  4FRP A;  4GBP A;  4HO5 A;  1GQC A;  2WVM A;  1XHB A;  2Y4J A;  2Y4M A;  5C8R A;  1H4C A;  5CQN X;  2D7I A;  2JCJ A;  5C36 A;  3Q80 A;  3F1C A;  3FOQ A;  4BMA A;  5IFY A;  4HO8 A;  2V0K A;  1H5T B;  1ZCY A;  2Y7A A;  1NMM B;  3RMW A;  4EE4 A;  2ICY A;  4D0T A;  2CU2 A;  5C4D A;  1ZCU A;  3U0Y A;  1V82 A;  1FWY A;  4B4M A;  3E26 A;  3I0D A;  1NHE B;  4Y7T A;  4Y9X A;  1V83 A;  3U0X A;  2I7B A;  5EJZ A;  2W0W A;  4FQW A;  2C0N A;  2VD4 A;  2JCK A;  4FIY A;  3U2X A;  3V0O A;  1VZT A;  2FYA A;  1R7T A;  4MIX A;  1HM0 A;  2Y4K A;  3ZGF A;  3PKQ A;  3BRK X;  3Q4S A;  3CKJ A;  4FRA A;  3U2V A;  1NQI B;  5C1L A;  1INI A;  4DEC A;  1G2V A;  5AJP A;  1JYL A;  1QGQ A;  4G87 A;  1HJJ A;  5I1F A;  5IDT A;  3RMV A;  4AAW A;  5C3D A;  1W77 A;  1FOA A;  5L6S A;  2I5E A;  3I0L A;  4AYL A;  1G97 A;  2RJ5 A;  2AM3 A;  1G8O A;  4EEM A;  1LVW A;  3PKP A;  4CVH A;  2XWL A;  1XZ6 A;  2RIX A;  2X5Z A;  3E25 A;  1H7H A;  1H3M A;  3TZT A;  4ECM A;  2OI6 A;  5FU8 A;  2UX8 A;  2VXM A;  4FRB A;  4JIS A;  4HG6 A;  1JYK A;  4D11 C;  1VPA A;  4D0Z A;  1WVC A;  3IOI A;  1R7U A;  5C38 A;  3I0C A;  3SXE A;  3DK5 A;  4KNX A;  5BXC A;  2YES A;  1O23 B;  3I0F A;  4O6M A;  1GX4 A;  5CMI A;  1FXJ A;  4P00 A;  2NXV A;  4HCQ A;  2J0B A;  1MP4 A;  1H5S C;  4JD0 A;  3ZLK A;  4FRL A;  1NWG B;  3T7O A;  3I0I X;  2PX7 A;  4FRD A;  2ZU7 A;  1R7V A;  4ZDQ A;  1QWJ A;  1SS9 A;  3HL3 A;  4B3U A;  2X65 A;  1TW5 A;  1H7T A;  2J0A A;  1IIN A;  2AES A;  2YC5 A;  3POL A;  3NGW A;  3RSB A;  4Y7U A;  3ZGG A;  1HV9 A;  3DUV A;  4LW3 A;  5D92 A;  3OH4 A;  1HM9 A;  2RJ4 A;  2JCL A;  3IOJ A;  4CJB A;  1FGG A;  2OI5 A;  3IOH A;  2VSH A;  1H5R B;  3SXD A;  3FWW A;  2W0V A;  4K6R A;  1ZJ0 A;  5DDV A;  1FR8 A;  4KQL A;  1R7Y A;  2V0H A;  1LZ0 A;  5CMG X;  2XME A;  3F1Y A;  4LW6 A;  4YS8 A;  3TQD A;  1ZJO A;  3K8E A;  1ZJ1 A;  1R82 A;  3I0H A;  4DE7 A;  1ZI5 A;  2FFV A;  1GX0 A;  2MZB A;  2V0I A;  1VM8 A;  1YP3 A;  4FRQ A;  1LZ7 A;  3I0G A;  2RJ9 A;  2AEC A;  1H4E A;  1TVY A;  1LZJ A;  2FYD B;  3I0K A;  1VGT A;  5FTV A;  4B4B A;  1I52 A;  2O1F A;  4HO0 A;  3ZF8 A;  1TW1 A;  2GGO A;  1FO8 A;  3CKN A;  4AC3 A;  4KT7 A;  1ZHJ A;  3SX3 A;  3SXC A;  4KNR A;  4B2X A;  2OI7 A;  4KC4 A;  4UEG A;  1INJ A;  4G3Q A;  5EIY A;  2FYC B;  4Y7V A;  5FTS A;  5CMF X;  4KC2 A;  2Y6P A;  3CGX A;  3CKV A;  3ST8 A;  1FRW A;  1G9R A;  1H5T A;  2AM5 A;  1ZI3 A;  4B42 A;  5FV9 A;  2FYB A;  3OAM A;  3V0P A;  3SXA A;  2WE9 A;  2VXL A;  2E3D A;  1V84 A;  5C47 A;  4M2A A;  1H5S D;  2OEG A;  2YQC A;  1E5K A;  4EE3 A;  1MP3 A;  2BO4 A;  2JCO A;  2Z87 A;  2RJ6 A;  3V90 A;  2RJ7 A;  1S4P A;  5EJ1 A;  1S4O A;  3OC9 A;  2PGV A;  1ZCV A;  4P02 A;  4NAL A;  4XWI A;  2FFU A;  4DDZ A;  1JVG A;  3JUJ A;  4ASJ A;  1ON8 A;  4M2B A;  3KIA A;  2AM4 A;  2WEE A;  3LW6 A;  3ZLL A;  2BO6 A;  1VGZ A;  4C2S A;  5C4C A;  2OEF A;  2ZU9 A;  4M4K A;  3V8Y A;  1FZW A;  4E1K A;  1O7Q A;  1FGX A;  1H7L A;  5CQP A;  3V0M A;  4ARW A;  4CJ8 A;  5C3B A;  1H7G A;  2D7R A;  2V0J A;  1YRO B;  4NAI A;  1WT1 A;  5C49 A;  4KC1 A;  1ZCT A;  5CQL X;  5CMJ A;  2DPW A;  4HO9 A;  1GWW A;  1OMZ A;  2I5K A;  4IRP A;  5IDS A;  4KXO A;  1PZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...