2AM5A

Crystal structure of n-acetylglucosaminyltransferase i in complex with udp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
342
structure length
342
Chain Sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminylt
publication title X-ray Crystal Structures of Rabbit N-acetylglucosaminyltransferase I (GnT I) in Complex with Donor Substrate Analogues.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 114
structure length 342
sequence length 342
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2005-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 2am5A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2am5A01
4EE3A 4DE7A 3USQA 1YP2A 3F1CA 3T7OA 3U0XA 1FWYA 3R2WA 2OI7A 1OQMB 2WAWA 3V0PA 1FOAA 2FFUA 2BO7A 5AJNA 1JYLA 3SXAA 2MZBA 5FU0A 4KC4A 1HJJA 3V0LA 1JV3A 3U0YA 1VZXA 5C49A 3NGWA 1W77A 3K8DA 2JCOA 4B5BA 3CGXA 2RJ9A 3OKRA 2OEGA 1S4OA 2RJ5A 3CU0A 3U2UA 2OI5A 2A8WA 5HS2A 4HO2A 3U2TA 2Z86A 3ST8A 1ON8A 4M2BA 4HO0A 3OC9A 1TZFA 2Y4JA 1XZ6A 3OH0A 2Y4KA 5IFYA 4EVWA 4CJ8A 2VXMA 5J49A 1IIMA 1R82A 1NQIB 1LL3A 1WT1A 2FFVA 2YESA 3I0GA 2X65A 4BQHA 4FRHA 5EJ1A 2AECA 3SXGA 3V0MA 3V8YA 3F1YA 2YQJA 4EE4A 1GX4A 2ICYA 1OMXA 4FRBA 1LZJA 1H5SA 5BXCA 1H7EA 3SPTA 3DJ4A 1QWJA 1LL2A 1FO8A 1H5RA 2V0HA 1H7TA 4B3UA 2VSIA 2E8BA 1WT2A 4GBPA 1R7VA 5CQOA 4DECA 1VGZA 3CKVA 1ZCTA 1JVGA 2AGDA 4AC3A 4KC2A 4E1KA 3Q7UA 1H7GA 5CMGX 4CVHA 4M4KA 3I0FA 2VS3A 1ZDFA 4KRVA 3CKNA 4B2XA 4D11A 1LVWA 4KNXA 5C1HA 4KQLA 3T7MA 3TQDA 2JCLA 1FG5N 3I0EA 5C4FA 4ARWA 3DK5A 2XWNA 5C4BA 1FR8A 2RJ6A 1FRWA 2X5ZA 5C36A 3CKJA 4EEAA 3I0CA 3JTJA 1VM8A 2AE7A 4FRAA 4Y62A 2X60A 3U2XA 3I0IX 4NAKA 1JV1A 1VPAA 1ZJ3A 2P6WA 4EE5A 3SXBA 3PKQA 2JCJA 1H4DA 4B4MA 2RITA 1I52A 2V0IA 1H7LA 4M28A 3Q4SA 2YQCA 3E25A 3DUVA 1TW5A 3SXCA 5IDSA 2PX7A 3OH1A 1H5TA 1QGQA 2AH9A 3V0QA 4K6RA 5CQMX 1VZTA 2PGYA 4FCEA 4HOCA 5CQNX 3ZGGA 1YP4A 2XMEA 2D7RA 1O7QA 2O1GA 5C3DA 1VGWA 1ZI3A 1HM9A 1G93A 4AYJA 1FXOA 1G9RA 4FRPA 3IOHA 1NWGB 2Y6PA 4KT7A 4Y7VA 3ZLKA 4UEGA 1WSZA 3LW6A 1ZJPA 2W0VA 2FYBA 4P02A 5C4CA 1FXJA 3ZGFA 3V90A 3JUKA 1ZJ1A 4G3SA 1LZ7A 1OMZA 3OH2A 1V82A 3HL3A 4ZDQA 1QG8A 4EEOA 3GUEA 1TVYA 4FREA 2FYCB 2VD4A 4KC1A 3FWWA 4NANA 1ZDGA 2WEEA 2X5SA 1G1LA 1YROB 5L6VA 1IINA 4AYLA 2QGIA 1H7HA 1ZJ0A 2O1HA 4FCUA 4HO9A 4IRPA 3RMWA 4G3QA 1NKHB 5CMHA 3SX7A 3D5NA 4MYBA 2BO4A 2AM5A 5FUHA 2RIXA 2D0JA 1INIA 5AJOA 3SX3A 1WVCA 4JISA 1W57A 1NF5B 4AAWA 4LW3A 3ZLLA 1WT3A 3V0NA 1ZI5A 1HV9A 1E5KA 3BRKX 2V0LA 2YC3A 2AM3A 2FY7A 4Y6UA 1KWSA 1H5SC 1ZCVA 4L41C 1H7FA 1MP5A 2VFZA 3D98A 1FZWA 1ZJOA 2UX8A 5C3BA 4D0ZA 2I5EA 5IDTA 2Y4LA 1VH3A 4B42A 1H5SB 4D11C 2XWMA 1H5RB 4EEGA 1PZTA 1GQ9A 4IRQA 1O23B 2QH5A 3V91A 4C2SA 4HCQA 2FYDB 4Y9XA 4Y7GA 5L6SA 1H3MA 4KPZA 1INJA 2Y7AA 4MNDA 1R7YA 1H4CA 3OAMA 5JQQA 1K4VA 1FGGA 5DDTA 1QGSA 4D0TA 2WGZA 1O0RA 3SXDA 5EIYA 4D48A 1EZIA 2PA4A 2WVKA 4NAIA 4DDZA 2VS5A 1ZCUA 2RJ0A 4B2WA 3POLA 1H5SD 4NALA 5CMIA 3I0LA 2YQSA 3E26A 1ZHJA 5C38A 1GWWA 2WE9A 2RJ8A 4CJBA 1PZYB 1GQCA 2ZU9A 3R3IA 4HO6A 1MP3A 3I0HA 4KXOA 5C47A 2FYAA 1H7QA 1Z90A 4Y63A 5C48A 1ZI1A 2P72A 5DDVA 1G2VA 2ZU8A 1VGTA 1V83A 2I5KA 1G95A 2NXVA 1R7UA 1EYRA 3T7NA 3RSBA 2GGQA 1HJLA 4ASYA 3CKQA 4Y6NA 3U2VA 1JVDA 2P73A 2DPWA 1GA8A 2Y4MA 4Y7UA 4KNRA 3OH4A 3Q80A 1FGXA 3N9WA 2BO6A 1H5TB 3OH3A 2A8UA 4G87A 4YS8A 3I0JA 1SS9A 4FROA 3PKPA 2XWLA 2RIZA 1R81A 1NMMB 2GGOA 4FRLA 1O7OA 2O1FA 2ICXA 2AESA 5FYEA 4BMAA 1MP4A 1GWVA 1LL0A 3KIAA 2YCMA 1XHBA 5C4DA 2RJ4A 3USRA 5FV9A 4LW6A 2BO8A 1ZJ2A 3O3PA 5C3AA 3EE5A 2WVLA 5FU8A 2CU2A 2OEFA 1NHEB 5CQLX 3U2WA 5I1FA 1LZ0A 2Q4JA 3OGZA 4JD0A 3ZF8A 4HO3A 2VSHA 5C4EA 1WT0A 2XMHA 1R7XA 1G0RA 4Y7TA 2RJ7A 4ASJA 2V0JA 4FQWA 1GX0A 2ZU7A 4HO8A 1LZIA 1S4PA 2JCKA 1H4EA 1MC3A 3FOQA 1G3LA 1HM8A 1ZI4A 1HM0A 3IOJA 3CKOA 3BCVA 3I0KA 2E3DA 3K8EA 4M2AA 1ON6A 5CQPA 1VICA 4HO5A 3D8VA 1G97A 3JUJA 3SX8A 1TW1A 1ZIZA 5EJZA 5CMFX 2WVMA 4G3PA 4J18A 1G23A 5C1LA 1VH1A 1JYKA 2VS4A 2VXLA 3SX5A 4Y64A 1G8OA 2W0WA 1FR9A 4B4BA 3RMVA 4FRQA 4HG6A 5C8RA 5AJPA 4KPXA 5CMJA 4P00A 5FTVA 1VZUA 2D7IA 4B4GA 4HO4A 1FO9A 3V0OA 4CJCA 2RIYA 2RJ1A 4Y7FA 1YP3A 4FRMA 1V84A 4FRDA 1R80A 4EEMA 2Z87A 3I0DA 2V0KA 1W55A 3IOIA 2QKXA 2I7BA 1S4NA 3QVBA 5FTSA 3TZTA 1R7TA 1VGUA 4R7PA 1ZCYA 2APCA 2AM4A 3PNNA 2YC5A 4XWIA 3V8ZA 3SXEA 5C1GA 2PGVA 2YQHA 4ECMA 2OI6A
chains in the Genus database with same CATH superfamily
1F1XA 4EE3A 4DE7A 3USQA 1YP2A 3F1CA 3T7OA 3U0XA 1FWYA 4FIYA 3R2WA 1NIQB 3FCDA 2OI7A 2J0BA 1OQMB 2WAWA 3V0PA 4JH6A 1KMZA 1FOAA 2FFUA 2P7KA 2BO7A 5AJNA 1FA5A 1JYLA 3SXAA 2MZBA 5FU0A 4KC4A 1HJJA 1SS4A 3ZI1A 3V0LA 2RJBA 1JV3A 2C0NA 1VZXA 3U0YA 2VK9A 3NGWA 5C49A 5C4PA 1W77A 3ZGJA 3K8DA 3P8AA 2JCOA 3CGXA 4B5BA 2RJ9A 3OKRA 2OEGA 1S4OA 2RJ5A 3CU0A 4Z6ZA 3U2UA 2OI5A 2A8WA 5HS2A 4HO2A 5D7ZA 3U2TA 2WL9A 2Z86A 3ST8A 4Q7CA 1ON8A 4M2BA 4HO0A 1F1UA 3OC9A 1TZFA 2Y4JA 1XZ6A 3OH0A 3OJNA 2RBBA 2Y4KA 5IFYA 3PKXA 3L7TA 4CJ8A 4EVWA 2VXMA 5J49A 1IIMA 1R82A 4GYMA 1NQIB 1KMYA 3ECKA 2P7QA 3SK2A 4Z6OA 1LL3A 1WT1A 2FFVA 2YESA 3I0GA 2X65A 4BQHA 4FRHA 5DRHA 5EJ1A 2AECA 3SXGA 1KLLA 5D4FA 3V0MA 3V8YA 3F1YA 3IUZA 2YQJA 4NB2A 4EE4A 1GX4A 2ICYA 1OMXA 4FRBA 1LZJA 1H5SA 5BXCA 4KYHA 1H7EA 3SPTA 3DJ4A 1QWJA 1SQDA 2ZW6A 4MTQA 1FO8A 1LL2A 1H5RA 4JH4A 2J0AA 2V0HA 4GHEA 1LQPA 1H7TA 4B3UA 2VSIA 1SP9A 2E8BA 1WT2A 4GBPA 1R7VA 5CQOA 4DECA 1VGZA 3CKVA 4NAZA 1ZCTA 1JVGA 2AGDA 4AC3A 4KC2A 4E1KA 3Q7UA 1H7GA 5CMGX 4CVHA 4M4KA 3HPYA 3I0FA 2VS3A 1ZDFA 1BH5A 4FIXA 4KRVA 3HNQA 1JIFA 3CKNA 4B2XA 1LVWA 4KNXA 4D11A 5C1HA 2PJSA 4KQLA 2QH0A 3T7MA 3TQDA 2JCLA 1FG5N 3I0EA 4PAVA 4JH1A 5C4FA 4ARWA 1FA7A 3DK5A 2XWNA 1KW9B 4MYMA 5C4BA 3E0RA 5BWHA 1FR8A 2RJ6A 1XY7A 1FRWA 2X5ZA 4JD1A 5C36A 3CKJA 4EEAA 3I0CA 3JTJA 1F1VA 2A4XA 1VM8A 2AE7A 4FRAA 4Y62A 2X60A 3U2XA 1K4NA 3W0UA 3I0IX 4NAKA 1SP8A 1JV1A 1VPAA 1ZJ3A 1FA6A 2P6WA 4EE5A 3SXBA 4GHHA 2JCJA 1H4DA 3PKQA 4B4MA 2RITA 1I52A 3L20A 2V0IA 4QB5A 1H7LA 4KYKA 3OPYB 4M28A 3Q4SA 4JH9A 2YQCA 3E25A 3DUVA 1TW5A 2WL3A 3KOLA 3SXCA 5IDSA 4GHFA 4GHGA 2PX7A 3OH1A 1H5TA 1TFZA 1QGQA 2AH9A 3V0QA 4K6RA 5CQMX 2ZYQA 1VZTA 2PGYA 4FCEA 4HOCA 5CQNX 3ZGGA 1YP4A 2XMEA 2D7RA 1O7QA 2O1GA 3ISQA 5C3DA 1VGWA 1ZI3A 1HM9A 1G93A 4AYJA 4JH7A 1U69A 3HPVA 1FXOA 1G9RA 4MIXA 4FRPA 3IOHA 1NWGB 2Y6PA 4KT7A 3G12A 4Y7VA 3ZLKA 4UEGA 4Z6LA 1WSZA 1KW6B 1KW8B 3LW6A 3RHEA 1ZJPA 3PKVA 3PKWA 1XRKA 2W0VA 2FYBA 4P02A 5C4CA 4Z6PA 1FXJA 4NAYA 2ZW7A 3BQXA 3ZGFA 3V90A 3JUKA 1ZJ1A 1QIPA 5D91A 4G3SA 1LZ7A 4Z6SA 1OMZA 3OH2A 4O6MA 1V82A 3OXHA 2EI2A 3HL3A 4ZDQA 1QG8A 4EEOA 1KWBB 3RMUA 3GUEA 1TVYA 2I7RA 2FYCB 2VD4A 4FREA 4KC1A 4G6XA 5KEFA 1BYLA 2Q48A 3FWWA 4NANA 1ZDGA 2WEEA 2X5SA 1FA8A 1G1LA 1YROB 5L6VA 1IINA 2P25A 3W0TA 4AYLA 2QGIA 1H7HA 1ZJ0A 1NPBA 1Q0CA 2O1HA 4FCUA 4HO9A 4IRPA 2QNTA 3RMWA 1SQIA 4G3QA 1NKHB 5CMHA 3SX7A 1TWUA 3D5NA 4MYBA 2BO4A 2IG9A 1NKIA 2AM5A 5FUHA 2RIXA 1INIA 2D0JA 2ZA0A 4HC5A 5AJOA 3SX3A 1WVCA 1EWJA 4JISA 3OA4A 1W57A 1NF5B 1Q0OA 4AAWA 4LW3A 3ZLLA 1WT3A 3V0NA 1ZI5A 1HV9A 1E5KA 2EI1A 1XQAA 3GHJA 2EI3A 4RT5A 3BRKX 2P7OA 2V0LA 2YC3A 2AM3A 3OUMA 2FY7A 4Y6UA 1KWSA 1H5SC 1ZCVA 1U6LA 4L41C 5D92A 1H7FA 5DHWA 1MP5A 3BZAA 2VFZA 3D98A 4LQBA 4MTRA 1FROA 1FZWA 1ZJOA 2UX8A 5C3BA 4D0ZA 2I5EA 5DFGA 4NB1A 3ECJA 5IDTA 2Y4LA 1VH3A 1QINA 5EC3A 4B42A 1H5SB 3EY8A 4D11C 1JIEA 2XWMA 1H5RB 4Z6TA 4EEGA 3VB0A 3OJKA 1PZTA 1GQ9A 4IRQA 1O23B 2QH5A 3V91A 3OJTA 4C2SA 5C6XA 4HCQA 3OAJA 2RK9A 2FYDB 3CT8A 4Y9XA 4Y7GA 1LQKA 4Z6UA 4NB0A 5L6SA 1H3MA 1MPYA 1R9CA 4KPZA 4X2AA 1INJA 4MTSA 2Y7AA 3LM4A 1R7YA 4MNDA 1H4CA 3OAMA 3HQ0A 4O6NA 5JQQA 1K4VA 1FGGA 5DDTA 1QGSA 4D0TA 4Z6MA 2WGZA 1EIQA 1O0RA 3SXDA 5EIYA 4D48A 1LQOA 1EZIA 2PA4A 2WVKA 1CJXA 3EY7A 4NAIA 4DDZA 1EILA 2VS5A 1ZCUA 2RJ0A 4B2WA 3POLA 3R6AA 1H5SD 4NVSA 4NALA 5CMIA 3I0LA 2YQSA 3E26A 1ZHJA 5C38A 1GWWA 4GHCA 2RJ8A 2WE9A 4CJBA 1PZYB 1GQCA 2ZU9A 3R3IA 4HO6A 1MP3A 3I0HA 4KXOA 5C47A 2FYAA 1H7QA 1KWCB 4JH5A 1Z90A 5C68A 4Y63A 5CJ3A 1ZSWA 5C48A 1ZI1A 2P72A 5DDVA 1G2VA 2ZU8A 1VGTA 1V83A 2I5KA 1LGTA 1G95A 2NXVA 1R7UA 2RK0A 1EYRA 1JC5A 1F1RA 1F9ZA 1NNRA 3T7NA 3RSBA 2GGQA 1HJLA 4ASYA 1T47A 3CKQA 4Y6NA 4N04A 1EIRA 3U2VA 1JVDA 2P73A 2DPWA 1GA8A 2Y4MA 4Y7UA 3E5DA 1KNFA 4KNRA 3OH4A 3Q80A 1FGXA 3N9WA 2BO6A 1H5TB 1ECSA 1JC4A 3OH3A 2A8UA 5CTOA 4G87A 4YS8A 3I0JA 1SS9A 4FROA 3PKPA 2XWLA 2RIZA 3VW9A 1QTOA 1R81A 1NMMB 1TG5A 2P7LA 2ZI8A 2GGOA 4FRLA 2EI0A 1O7OA 2O1FA 2ICXA 2AESA 5FYEA 3OJJA 4BMAA 1MP4A 1GWVA 1LL0A 3KIAA 2YCMA 1TSJA 1XHBA 5C4DA 2RJ4A 3USRA 5FV9A 1LKDA 4LW6A 2BO8A 1ZJ2A 3RRIA 4HUZA 4Z6RA 3O3PA 5C3AA 3EE5A 2WVLA 5FU8A 4Z6QA 2CU2A 2R5VA 2OEFA 1NHEB 5CQLX 3U2WA 5I1FA 1LZ0A 4PV5A 2Q4JA 1HANA 3OGZA 4JD0A 3ZF8A 3R4QA 2R6UA 4HO3A 2VSHA 5C4EA 3LHOA 1WT0A 3GM5A 2XMHA 1R7XA 1G0RA 4Y7TA 2RJ7A 3HDPA 4ASJA 2V0JA 4FQWA 1GX0A 2ZU7A 3HUHA 4HO8A 1LZIA 1S4PA 2JCKA 1H4EA 4JH2A 1MC3A 3FOQA 4MTTA 1G3LA 5F6QA 5HCWA 1HM8A 1ZI4A 1HM0A 3IOJA 3CKOA 1KNDA 3BCVA 2IGAA 3I0KA 2E3DA 1DHYA 3K8EA 4M2AA 1MH6A 2P7MA 2ZW5A 4Z6VA 1ON6A 5CQPA 4OPNA 4IAGA 1VICA 4HO5A 3D8VA 1G97A 3JUJA 3SX8A 1TW1A 2QQZA 1ZIZA 4IR0A 5EJZA 5CMFX 3OPYA 2WVMA 4G3PA 4J18A 1G23A 5C1LA 1VH1A 1JYKA 2VS4A 2VXLA 3SX5A 4Y64A 1G8OA 2W0WA 1FR9A 2ZW4A 5BWGA 3B59A 4B4BA 3RMVA 4FRQA 4HG6A 1KW3B 5C8RA 5AJPA 4KPXA 5CMJA 4P00A 5FTVA 1VZUA 2D7IA 4B4GA 4HO4A 1FO9A 4Z04A 3V0OA 4JH3A 3ZW5A 2RIYA 2RJ1A 4Y7FA 4CJCA 1YP3A 4FRMA 1V84A 4FRDA 1R80A 4EEMA 2Z87A 3I0DA 2C21A 3OULA 2V0KA 1W55A 3IOIA 2QKXA 4Z6WA 2I7BA 1S4NA 2A4WA 3QVBA 5FTSA 3TZTA 1R7TA 1VGUA 2P7PA 1ZCYA 4R7PA 2APCA 2ZHPA 4JH8A 2EHZA 4Z6NA 2AM4A 4GHDA 3PNNA 2YC5A 4XWIA 5CB9A 3V8ZA 3SXEA 5C1GA 2PGVA 2YQHA 4ECMA 2OI6A
chains in the Genus database with same CATH topology
4EE3A 4DE7A 3USQA 1YP2A 3F1CA 3T7OA 3U0XA 1FWYA 4FIYA 3R2WA 2OI7A 2J0BA 1OQMB 2WAWA 3V0PA 1FOAA 2FFUA 2BO7A 5AJNA 1JYLA 3SXAA 2MZBA 5FU0A 4KC4A 1HJJA 3V0LA 1JV3A 2C0NA 1VZXA 3U0YA 2VK9A 3NGWA 5C49A 1W77A 3K8DA 2JCOA 4B5BA 3CGXA 2RJ9A 3OKRA 2OEGA 1S4OA 2RJ5A 3CU0A 3U2UA 2OI5A 2A8WA 5HS2A 4HO2A 3U2TA 2Z86A 3ST8A 4Q7CA 1ON8A 4M2BA 4HO0A 3OC9A 1TZFA 2Y4JA 1XZ6A 3OH0A 2Y4KA 5IFYA 4EVWA 4CJ8A 2VXMA 5J49A 1IIMA 1R82A 1NQIB 1LL3A 1WT1A 2FFVA 2YESA 3I0GA 2X65A 4BQHA 4FRHA 5EJ1A 2AECA 3SXGA 3V0MA 3V8YA 3F1YA 2YQJA 4EE4A 1GX4A 2ICYA 1OMXA 4FRBA 1LZJA 1H5SA 5BXCA 1H7EA 3SPTA 3DJ4A 1QWJA 1LL2A 1FO8A 1H5RA 2J0AA 2V0HA 1H7TA 4B3UA 2VSIA 2E8BA 1WT2A 4GBPA 1R7VA 5CQOA 4DECA 1VGZA 3CKVA 1ZCTA 1JVGA 2AGDA 4AC3A 4KC2A 4E1KA 3Q7UA 1H7GA 5CMGX 4CVHA 4M4KA 3I0FA 2VS3A 1ZDFA 4FIXA 4KRVA 3CKNA 4B2XA 4D11A 1LVWA 4KNXA 5C1HA 4KQLA 3T7MA 3TQDA 2JCLA 1FG5N 3I0EA 5C4FA 4ARWA 3DK5A 2XWNA 5C4BA 1FR8A 2RJ6A 1FRWA 2X5ZA 5C36A 3CKJA 4EEAA 3I0CA 3JTJA 1VM8A 2AE7A 4FRAA 4Y62A 2X60A 3U2XA 3I0IX 4NAKA 1JV1A 1VPAA 1ZJ3A 2P6WA 4EE5A 3SXBA 3PKQA 2JCJA 1H4DA 4B4MA 2RITA 1I52A 2V0IA 1H7LA 4M28A 3Q4SA 2YQCA 3E25A 3DUVA 1TW5A 3SXCA 5IDSA 2PX7A 3OH1A 1H5TA 1QGQA 2AH9A 3V0QA 4K6RA 5CQMX 1VZTA 2PGYA 4FCEA 4HOCA 5CQNX 3ZGGA 1YP4A 2XMEA 2D7RA 1O7QA 2O1GA 5C3DA 1VGWA 1ZI3A 1HM9A 1G93A 4AYJA 1FXOA 1G9RA 4MIXA 4FRPA 3IOHA 1NWGB 2Y6PA 4KT7A 4Y7VA 3ZLKA 4UEGA 1WSZA 3LW6A 1ZJPA 2W0VA 2FYBA 4P02A 5C4CA 1FXJA 3ZGFA 3V90A 3JUKA 1ZJ1A 5D91A 4G3SA 1LZ7A 1OMZA 3OH2A 4O6MA 1V82A 3HL3A 4ZDQA 1QG8A 4EEOA 3GUEA 1TVYA 4FREA 2FYCB 2VD4A 4KC1A 3FWWA 4NANA 1ZDGA 2WEEA 2X5SA 1G1LA 1YROB 5L6VA 1IINA 4AYLA 2QGIA 1H7HA 1ZJ0A 2O1HA 4FCUA 4HO9A 4IRPA 3RMWA 4G3QA 1NKHB 5CMHA 3SX7A 3D5NA 4MYBA 2BO4A 2AM5A 5FUHA 2RIXA 2D0JA 1INIA 5AJOA 3SX3A 1WVCA 4JISA 1W57A 1NF5B 4AAWA 4LW3A 3ZLLA 1WT3A 3V0NA 1ZI5A 1HV9A 1E5KA 3BRKX 2V0LA 2YC3A 2AM3A 2FY7A 4Y6UA 1KWSA 1H5SC 1ZCVA 4L41C 5D92A 1H7FA 1MP5A 2VFZA 3D98A 1FZWA 1ZJOA 2UX8A 5C3BA 4D0ZA 2I5EA 5IDTA 2Y4LA 1VH3A 4B42A 1H5SB 4D11C 2XWMA 1H5RB 4EEGA 1PZTA 1GQ9A 4IRQA 1O23B 2QH5A 3V91A 4C2SA 4HCQA 2FYDB 4Y9XA 4Y7GA 5L6SA 1H3MA 4KPZA 1INJA 2Y7AA 4MNDA 1R7YA 1H4CA 3OAMA 4O6NA 5JQQA 1K4VA 1FGGA 5DDTA 1QGSA 4D0TA 2WGZA 1O0RA 3SXDA 5EIYA 4D48A 1EZIA 2PA4A 2WVKA 4NAIA 4DDZA 2VS5A 1ZCUA 2RJ0A 4B2WA 3POLA 1H5SD 4NALA 5CMIA 3I0LA 2YQSA 3E26A 1ZHJA 5C38A 1GWWA 2WE9A 2RJ8A 4CJBA 1PZYB 1GQCA 2ZU9A 3R3IA 4HO6A 1MP3A 3I0HA 4KXOA 5C47A 2FYAA 1H7QA 1Z90A 4Y63A 5C48A 1ZI1A 2P72A 5DDVA 1G2VA 2ZU8A 1VGTA 1V83A 2I5KA 1G95A 2NXVA 1R7UA 1EYRA 3T7NA 3RSBA 2GGQA 1HJLA 4ASYA 3CKQA 4Y6NA 3U2VA 1JVDA 2P73A 2DPWA 1GA8A 2Y4MA 4Y7UA 4KNRA 3OH4A 3Q80A 1FGXA 3N9WA 2BO6A 1H5TB 3OH3A 2A8UA 4G87A 4YS8A 3I0JA 1SS9A 4FROA 3PKPA 2XWLA 2RIZA 1R81A 1NMMB 2GGOA 4FRLA 1O7OA 2O1FA 2ICXA 2AESA 5FYEA 4BMAA 1MP4A 1GWVA 1LL0A 3KIAA 2YCMA 1XHBA 5C4DA 2RJ4A 3USRA 5FV9A 4LW6A 2BO8A 1ZJ2A 3O3PA 5C3AA 3EE5A 2WVLA 5FU8A 2CU2A 2OEFA 1NHEB 5CQLX 3U2WA 5I1FA 1LZ0A 2Q4JA 3OGZA 4JD0A 3ZF8A 4HO3A 2VSHA 5C4EA 1WT0A 2XMHA 1R7XA 1G0RA 4Y7TA 2RJ7A 4ASJA 2V0JA 4FQWA 1GX0A 2ZU7A 4HO8A 1LZIA 1S4PA 2JCKA 1H4EA 1MC3A 3FOQA 1G3LA 1HM8A 1ZI4A 1HM0A 3IOJA 3CKOA 3BCVA 3I0KA 2E3DA 3K8EA 4M2AA 1ON6A 5CQPA 1VICA 4HO5A 3D8VA 1G97A 3JUJA 3SX8A 1TW1A 1ZIZA 5EJZA 5CMFX 2WVMA 4G3PA 4J18A 1G23A 5C1LA 1VH1A 1JYKA 2VS4A 2VXLA 3SX5A 4Y64A 1G8OA 2W0WA 1FR9A 4B4BA 3RMVA 4FRQA 4HG6A 5C8RA 5AJPA 4KPXA 5CMJA 4P00A 5FTVA 1VZUA 2D7IA 4B4GA 4HO4A 1FO9A 3V0OA 4CJCA 2RIYA 2RJ1A 4Y7FA 1YP3A 4FRMA 1V84A 4FRDA 1R80A 4EEMA 2Z87A 3I0DA 2V0KA 1W55A 3IOIA 2QKXA 2I7BA 1S4NA 3QVBA 5FTSA 3TZTA 1R7TA 1VGUA 4R7PA 1ZCYA 2APCA 2AM4A 3PNNA 2YC5A 4XWIA 3V8ZA 3SXEA 5C1GA 2PGVA 2YQHA 4ECMA 2OI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EE3 A;  4DE7 A;  3USQ A;  1YP2 A;  3F1C A;  3T7O A;  3U0X A;  1FWY A;  3R2W A;  2OI7 A;  1OQM B;  2WAW A;  3V0P A;  1FOA A;  2FFU A;  2BO7 A;  5AJN A;  1JYL A;  3SXA A;  2MZB A;  5FU0 A;  4KC4 A;  1HJJ A;  3V0L A;  1JV3 A;  3U0Y A;  1VZX A;  5C49 A;  3NGW A;  1W77 A;  3K8D A;  2JCO A;  4B5B A;  3CGX A;  2RJ9 A;  3OKR A;  2OEG A;  1S4O A;  2RJ5 A;  3CU0 A;  3U2U A;  2OI5 A;  2A8W A;  5HS2 A;  4HO2 A;  3U2T A;  2Z86 A;  3ST8 A;  1ON8 A;  4M2B A;  4HO0 A;  3OC9 A;  1TZF A;  2Y4J A;  1XZ6 A;  3OH0 A;  2Y4K A;  5IFY A;  4EVW A;  4CJ8 A;  2VXM A;  5J49 A;  1IIM A;  1R82 A;  1NQI B;  1LL3 A;  1WT1 A;  2FFV A;  2YES A;  3I0G A;  2X65 A;  4BQH A;  4FRH A;  5EJ1 A;  2AEC A;  3SXG A;  3V0M A;  3V8Y A;  3F1Y A;  2YQJ A;  4EE4 A;  1GX4 A;  2ICY A;  1OMX A;  4FRB A;  1LZJ A;  1H5S A;  5BXC A;  1H7E A;  3SPT A;  3DJ4 A;  1QWJ A;  1LL2 A;  1FO8 A;  1H5R A;  2V0H A;  1H7T A;  4B3U A;  2VSI A;  2E8B A;  1WT2 A;  4GBP A;  1R7V A;  5CQO A;  4DEC A;  1VGZ A;  3CKV A;  1ZCT A;  1JVG A;  2AGD A;  4AC3 A;  4KC2 A;  4E1K A;  3Q7U A;  1H7G A;  5CMG X;  4CVH A;  4M4K A;  3I0F A;  2VS3 A;  1ZDF A;  4KRV A;  3CKN A;  4B2X A;  4D11 A;  1LVW A;  4KNX A;  5C1H A;  4KQL A;  3T7M A;  3TQD A;  2JCL A;  1FG5 N;  3I0E A;  5C4F A;  4ARW A;  3DK5 A;  2XWN A;  5C4B A;  1FR8 A;  2RJ6 A;  1FRW A;  2X5Z A;  5C36 A;  3CKJ A;  4EEA A;  3I0C A;  3JTJ A;  1VM8 A;  2AE7 A;  4FRA A;  4Y62 A;  2X60 A;  3U2X A;  3I0I X;  4NAK A;  1JV1 A;  1VPA A;  1ZJ3 A;  2P6W A;  4EE5 A;  3SXB A;  3PKQ A;  2JCJ A;  1H4D A;  4B4M A;  2RIT A;  1I52 A;  2V0I A;  1H7L A;  4M28 A;  3Q4S A;  2YQC A;  3E25 A;  3DUV A;  1TW5 A;  3SXC A;  5IDS A;  2PX7 A;  3OH1 A;  1H5T A;  1QGQ A;  2AH9 A;  3V0Q A;  4K6R A;  5CQM X;  1VZT A;  2PGY A;  4FCE A;  4HOC A;  5CQN X;  3ZGG A;  1YP4 A;  2XME A;  2D7R A;  1O7Q A;  2O1G A;  5C3D A;  1VGW A;  1ZI3 A;  1HM9 A;  1G93 A;  4AYJ A;  1FXO A;  1G9R A;  4FRP A;  3IOH A;  1NWG B;  2Y6P A;  4KT7 A;  4Y7V A;  3ZLK A;  4UEG A;  1WSZ A;  3LW6 A;  1ZJP A;  2W0V A;  2FYB A;  4P02 A;  5C4C A;  1FXJ A;  3ZGF A;  3V90 A;  3JUK A;  1ZJ1 A;  4G3S A;  1LZ7 A;  1OMZ A;  3OH2 A;  1V82 A;  3HL3 A;  4ZDQ A;  1QG8 A;  4EEO A;  3GUE A;  1TVY A;  4FRE A;  2FYC B;  2VD4 A;  4KC1 A;  3FWW A;  4NAN A;  1ZDG A;  2WEE A;  2X5S A;  1G1L A;  1YRO B;  5L6V A;  1IIN A;  4AYL A;  2QGI A;  1H7H A;  1ZJ0 A;  2O1H A;  4FCU A;  4HO9 A;  4IRP A;  3RMW A;  4G3Q A;  1NKH B;  5CMH A;  3SX7 A;  3D5N A;  4MYB A;  2BO4 A;  2AM5 A;  5FUH A;  2RIX A;  2D0J A;  1INI A;  5AJO A;  3SX3 A;  1WVC A;  4JIS A;  1W57 A;  1NF5 B;  4AAW A;  4LW3 A;  3ZLL A;  1WT3 A;  3V0N A;  1ZI5 A;  1HV9 A;  1E5K A;  3BRK X;  2V0L A;  2YC3 A;  2AM3 A;  2FY7 A;  4Y6U A;  1KWS A;  1H5S C;  1ZCV A;  4L41 C;  1H7F A;  1MP5 A;  2VFZ A;  3D98 A;  1FZW A;  1ZJO A;  2UX8 A;  5C3B A;  4D0Z A;  2I5E A;  5IDT A;  2Y4L A;  1VH3 A;  4B42 A;  1H5S B;  4D11 C;  2XWM A;  1H5R B;  4EEG A;  1PZT A;  1GQ9 A;  4IRQ A;  1O23 B;  2QH5 A;  3V91 A;  4C2S A;  4HCQ A;  2FYD B;  4Y9X A;  4Y7G A;  5L6S A;  1H3M A;  4KPZ A;  1INJ A;  2Y7A A;  4MND A;  1R7Y A;  1H4C A;  3OAM A;  5JQQ A;  1K4V A;  1FGG A;  5DDT A;  1QGS A;  4D0T A;  2WGZ A;  1O0R A;  3SXD A;  5EIY A;  4D48 A;  1EZI A;  2PA4 A;  2WVK A;  4NAI A;  4DDZ A;  2VS5 A;  1ZCU A;  2RJ0 A;  4B2W A;  3POL A;  1H5S D;  4NAL A;  5CMI A;  3I0L A;  2YQS A;  3E26 A;  1ZHJ A;  5C38 A;  1GWW A;  2WE9 A;  2RJ8 A;  4CJB A;  1PZY B;  1GQC A;  2ZU9 A;  3R3I A;  4HO6 A;  1MP3 A;  3I0H A;  4KXO A;  5C47 A;  2FYA A;  1H7Q A;  1Z90 A;  4Y63 A;  5C48 A;  1ZI1 A;  2P72 A;  5DDV A;  1G2V A;  2ZU8 A;  1VGT A;  1V83 A;  2I5K A;  1G95 A;  2NXV A;  1R7U A;  1EYR A;  3T7N A;  3RSB A;  2GGQ A;  1HJL A;  4ASY A;  3CKQ A;  4Y6N A;  3U2V A;  1JVD A;  2P73 A;  2DPW A;  1GA8 A;  2Y4M A;  4Y7U A;  4KNR A;  3OH4 A;  3Q80 A;  1FGX A;  3N9W A;  2BO6 A;  1H5T B;  3OH3 A;  2A8U A;  4G87 A;  4YS8 A;  3I0J A;  1SS9 A;  4FRO A;  3PKP A;  2XWL A;  2RIZ A;  1R81 A;  1NMM B;  2GGO A;  4FRL A;  1O7O A;  2O1F A;  2ICX A;  2AES A;  5FYE A;  4BMA A;  1MP4 A;  1GWV A;  1LL0 A;  3KIA A;  2YCM A;  1XHB A;  5C4D A;  2RJ4 A;  3USR A;  5FV9 A;  4LW6 A;  2BO8 A;  1ZJ2 A;  3O3P A;  5C3A A;  3EE5 A;  2WVL A;  5FU8 A;  2CU2 A;  2OEF A;  1NHE B;  5CQL X;  3U2W A;  5I1F A;  1LZ0 A;  2Q4J A;  3OGZ A;  4JD0 A;  3ZF8 A;  4HO3 A;  2VSH A;  5C4E A;  1WT0 A;  2XMH A;  1R7X A;  1G0R A;  4Y7T A;  2RJ7 A;  4ASJ A;  2V0J A;  4FQW A;  1GX0 A;  2ZU7 A;  4HO8 A;  1LZI A;  1S4P A;  2JCK A;  1H4E A;  1MC3 A;  3FOQ A;  1G3L A;  1HM8 A;  1ZI4 A;  1HM0 A;  3IOJ A;  3CKO A;  3BCV A;  3I0K A;  2E3D A;  3K8E A;  4M2A A;  1ON6 A;  5CQP A;  1VIC A;  4HO5 A;  3D8V A;  1G97 A;  3JUJ A;  3SX8 A;  1TW1 A;  1ZIZ A;  5EJZ A;  5CMF X;  2WVM A;  4G3P A;  4J18 A;  1G23 A;  5C1L A;  1VH1 A;  1JYK A;  2VS4 A;  2VXL A;  3SX5 A;  4Y64 A;  1G8O A;  2W0W A;  1FR9 A;  4B4B A;  3RMV A;  4FRQ A;  4HG6 A;  5C8R A;  5AJP A;  4KPX A;  5CMJ A;  4P00 A;  5FTV A;  1VZU A;  2D7I A;  4B4G A;  4HO4 A;  1FO9 A;  3V0O A;  4CJC A;  2RIY A;  2RJ1 A;  4Y7F A;  1YP3 A;  4FRM A;  1V84 A;  4FRD A;  1R80 A;  4EEM A;  2Z87 A;  3I0D A;  2V0K A;  1W55 A;  3IOI A;  2QKX A;  2I7B A;  1S4N A;  3QVB A;  5FTS A;  3TZT A;  1R7T A;  1VGU A;  4R7P A;  1ZCY A;  2APC A;  2AM4 A;  3PNN A;  2YC5 A;  4XWI A;  3V8Z A;  3SXE A;  5C1G A;  2PGV A;  2YQH A;  4ECM A;  2OI6 A; 
#chains in the Genus database with same CATH topology
 1F1X A;  4EE3 A;  4DE7 A;  3USQ A;  1YP2 A;  3F1C A;  3T7O A;  3U0X A;  1FWY A;  4FIY A;  3R2W A;  1NIQ B;  3FCD A;  2OI7 A;  2J0B A;  1OQM B;  2WAW A;  3V0P A;  4JH6 A;  1KMZ A;  1FOA A;  2FFU A;  2P7K A;  2BO7 A;  5AJN A;  1FA5 A;  1JYL A;  3SXA A;  2MZB A;  5FU0 A;  4KC4 A;  1HJJ A;  1SS4 A;  3ZI1 A;  3V0L A;  2RJB A;  1JV3 A;  2C0N A;  1VZX A;  3U0Y A;  2VK9 A;  3NGW A;  5C49 A;  5C4P A;  1W77 A;  3ZGJ A;  3K8D A;  3P8A A;  2JCO A;  3CGX A;  4B5B A;  2RJ9 A;  3OKR A;  2OEG A;  1S4O A;  2RJ5 A;  3CU0 A;  4Z6Z A;  3U2U A;  2OI5 A;  2A8W A;  5HS2 A;  4HO2 A;  5D7Z A;  3U2T A;  2WL9 A;  2Z86 A;  3ST8 A;  4Q7C A;  1ON8 A;  4M2B A;  4HO0 A;  1F1U A;  3OC9 A;  1TZF A;  2Y4J A;  1XZ6 A;  3OH0 A;  3OJN A;  2RBB A;  2Y4K A;  5IFY A;  3PKX A;  3L7T A;  4CJ8 A;  4EVW A;  2VXM A;  5J49 A;  1IIM A;  1R82 A;  4GYM A;  1NQI B;  1KMY A;  3ECK A;  2P7Q A;  3SK2 A;  4Z6O A;  1LL3 A;  1WT1 A;  2FFV A;  2YES A;  3I0G A;  2X65 A;  4BQH A;  4FRH A;  5DRH A;  5EJ1 A;  2AEC A;  3SXG A;  1KLL A;  5D4F A;  3V0M A;  3V8Y A;  3F1Y A;  3IUZ A;  2YQJ A;  4NB2 A;  4EE4 A;  1GX4 A;  2ICY A;  1OMX A;  4FRB A;  1LZJ A;  1H5S A;  5BXC A;  4KYH A;  1H7E A;  3SPT A;  3DJ4 A;  1QWJ A;  1SQD A;  2ZW6 A;  4MTQ A;  1FO8 A;  1LL2 A;  1H5R A;  4JH4 A;  2J0A A;  2V0H A;  4GHE A;  1LQP A;  1H7T A;  4B3U A;  2VSI A;  1SP9 A;  2E8B A;  1WT2 A;  4GBP A;  1R7V A;  5CQO A;  4DEC A;  1VGZ A;  3CKV A;  4NAZ A;  1ZCT A;  1JVG A;  2AGD A;  4AC3 A;  4KC2 A;  4E1K A;  3Q7U A;  1H7G A;  5CMG X;  4CVH A;  4M4K A;  3HPY A;  3I0F A;  2VS3 A;  1ZDF A;  1BH5 A;  4FIX A;  4KRV A;  3HNQ A;  1JIF A;  3CKN A;  4B2X A;  1LVW A;  4KNX A;  4D11 A;  5C1H A;  2PJS A;  4KQL A;  2QH0 A;  3T7M A;  3TQD A;  2JCL A;  1FG5 N;  3I0E A;  4PAV A;  4JH1 A;  5C4F A;  4ARW A;  1FA7 A;  3DK5 A;  2XWN A;  1KW9 B;  4MYM A;  5C4B A;  3E0R A;  5BWH A;  1FR8 A;  2RJ6 A;  1XY7 A;  1FRW A;  2X5Z A;  4JD1 A;  5C36 A;  3CKJ A;  4EEA A;  3I0C A;  3JTJ A;  1F1V A;  2A4X A;  1VM8 A;  2AE7 A;  4FRA A;  4Y62 A;  2X60 A;  3U2X A;  1K4N A;  3W0U A;  3I0I X;  4NAK A;  1SP8 A;  1JV1 A;  1VPA A;  1ZJ3 A;  1FA6 A;  2P6W A;  4EE5 A;  3SXB A;  4GHH A;  2JCJ A;  1H4D A;  3PKQ A;  4B4M A;  2RIT A;  1I52 A;  3L20 A;  2V0I A;  4QB5 A;  1H7L A;  4KYK A;  3OPY B;  4M28 A;  3Q4S A;  4JH9 A;  2YQC A;  3E25 A;  3DUV A;  1TW5 A;  2WL3 A;  3KOL A;  3SXC A;  5IDS A;  4GHF A;  4GHG A;  2PX7 A;  3OH1 A;  1H5T A;  1TFZ A;  1QGQ A;  2AH9 A;  3V0Q A;  4K6R A;  5CQM X;  2ZYQ A;  1VZT A;  2PGY A;  4FCE A;  4HOC A;  5CQN X;  3ZGG A;  1YP4 A;  2XME A;  2D7R A;  1O7Q A;  2O1G A;  3ISQ A;  5C3D A;  1VGW A;  1ZI3 A;  1HM9 A;  1G93 A;  4AYJ A;  4JH7 A;  1U69 A;  3HPV A;  1FXO A;  1G9R A;  4MIX A;  4FRP A;  3IOH A;  1NWG B;  2Y6P A;  4KT7 A;  3G12 A;  4Y7V A;  3ZLK A;  4UEG A;  4Z6L A;  1WSZ A;  1KW6 B;  1KW8 B;  3LW6 A;  3RHE A;  1ZJP A;  3PKV A;  3PKW A;  1XRK A;  2W0V A;  2FYB A;  4P02 A;  5C4C A;  4Z6P A;  1FXJ A;  4NAY A;  2ZW7 A;  3BQX A;  3ZGF A;  3V90 A;  3JUK A;  1ZJ1 A;  1QIP A;  5D91 A;  4G3S A;  1LZ7 A;  4Z6S A;  1OMZ A;  3OH2 A;  4O6M A;  1V82 A;  3OXH A;  2EI2 A;  3HL3 A;  4ZDQ A;  1QG8 A;  4EEO A;  1KWB B;  3RMU A;  3GUE A;  1TVY A;  2I7R A;  2FYC B;  2VD4 A;  4FRE A;  4KC1 A;  4G6X A;  5KEF A;  1BYL A;  2Q48 A;  3FWW A;  4NAN A;  1ZDG A;  2WEE A;  2X5S A;  1FA8 A;  1G1L A;  1YRO B;  5L6V A;  1IIN A;  2P25 A;  3W0T A;  4AYL A;  2QGI A;  1H7H A;  1ZJ0 A;  1NPB A;  1Q0C A;  2O1H A;  4FCU A;  4HO9 A;  4IRP A;  2QNT A;  3RMW A;  1SQI A;  4G3Q A;  1NKH B;  5CMH A;  3SX7 A;  1TWU A;  3D5N A;  4MYB A;  2BO4 A;  2IG9 A;  1NKI A;  2AM5 A;  5FUH A;  2RIX A;  1INI A;  2D0J A;  2ZA0 A;  4HC5 A;  5AJO A;  3SX3 A;  1WVC A;  1EWJ A;  4JIS A;  3OA4 A;  1W57 A;  1NF5 B;  1Q0O A;  4AAW A;  4LW3 A;  3ZLL A;  1WT3 A;  3V0N A;  1ZI5 A;  1HV9 A;  1E5K A;  2EI1 A;  1XQA A;  3GHJ A;  2EI3 A;  4RT5 A;  3BRK X;  2P7O A;  2V0L A;  2YC3 A;  2AM3 A;  3OUM A;  2FY7 A;  4Y6U A;  1KWS A;  1H5S C;  1ZCV A;  1U6L A;  4L41 C;  5D92 A;  1H7F A;  5DHW A;  1MP5 A;  3BZA A;  2VFZ A;  3D98 A;  4LQB A;  4MTR A;  1FRO A;  1FZW A;  1ZJO A;  2UX8 A;  5C3B A;  4D0Z A;  2I5E A;  5DFG A;  4NB1 A;  3ECJ A;  5IDT A;  2Y4L A;  1VH3 A;  1QIN A;  5EC3 A;  4B42 A;  1H5S B;  3EY8 A;  4D11 C;  1JIE A;  2XWM A;  1H5R B;  4Z6T A;  4EEG A;  3VB0 A;  3OJK A;  1PZT A;  1GQ9 A;  4IRQ A;  1O23 B;  2QH5 A;  3V91 A;  3OJT A;  4C2S A;  5C6X A;  4HCQ A;  3OAJ A;  2RK9 A;  2FYD B;  3CT8 A;  4Y9X A;  4Y7G A;  1LQK A;  4Z6U A;  4NB0 A;  5L6S A;  1H3M A;  1MPY A;  1R9C A;  4KPZ A;  4X2A A;  1INJ A;  4MTS A;  2Y7A A;  3LM4 A;  1R7Y A;  4MND A;  1H4C A;  3OAM A;  3HQ0 A;  4O6N A;  5JQQ A;  1K4V A;  1FGG A;  5DDT A;  1QGS A;  4D0T A;  4Z6M A;  2WGZ A;  1EIQ A;  1O0R A;  3SXD A;  5EIY A;  4D48 A;  1LQO A;  1EZI A;  2PA4 A;  2WVK A;  1CJX A;  3EY7 A;  4NAI A;  4DDZ A;  1EIL A;  2VS5 A;  1ZCU A;  2RJ0 A;  4B2W A;  3POL A;  3R6A A;  1H5S D;  4NVS A;  4NAL A;  5CMI A;  3I0L A;  2YQS A;  3E26 A;  1ZHJ A;  5C38 A;  1GWW A;  4GHC A;  2RJ8 A;  2WE9 A;  4CJB A;  1PZY B;  1GQC A;  2ZU9 A;  3R3I A;  4HO6 A;  1MP3 A;  3I0H A;  4KXO A;  5C47 A;  2FYA A;  1H7Q A;  1KWC B;  4JH5 A;  1Z90 A;  5C68 A;  4Y63 A;  5CJ3 A;  1ZSW A;  5C48 A;  1ZI1 A;  2P72 A;  5DDV A;  1G2V A;  2ZU8 A;  1VGT A;  1V83 A;  2I5K A;  1LGT A;  1G95 A;  2NXV A;  1R7U A;  2RK0 A;  1EYR A;  1JC5 A;  1F1R A;  1F9Z A;  1NNR A;  3T7N A;  3RSB A;  2GGQ A;  1HJL A;  4ASY A;  1T47 A;  3CKQ A;  4Y6N A;  4N04 A;  1EIR A;  3U2V A;  1JVD A;  2P73 A;  2DPW A;  1GA8 A;  2Y4M A;  4Y7U A;  3E5D A;  1KNF A;  4KNR A;  3OH4 A;  3Q80 A;  1FGX A;  3N9W A;  2BO6 A;  1H5T B;  1ECS A;  1JC4 A;  3OH3 A;  2A8U A;  5CTO A;  4G87 A;  4YS8 A;  3I0J A;  1SS9 A;  4FRO A;  3PKP A;  2XWL A;  2RIZ A;  3VW9 A;  1QTO A;  1R81 A;  1NMM B;  1TG5 A;  2P7L A;  2ZI8 A;  2GGO A;  4FRL A;  2EI0 A;  1O7O A;  2O1F A;  2ICX A;  2AES A;  5FYE A;  3OJJ A;  4BMA A;  1MP4 A;  1GWV A;  1LL0 A;  3KIA A;  2YCM A;  1TSJ A;  1XHB A;  5C4D A;  2RJ4 A;  3USR A;  5FV9 A;  1LKD A;  4LW6 A;  2BO8 A;  1ZJ2 A;  3RRI A;  4HUZ A;  4Z6R A;  3O3P A;  5C3A A;  3EE5 A;  2WVL A;  5FU8 A;  4Z6Q A;  2CU2 A;  2R5V A;  2OEF A;  1NHE B;  5CQL X;  3U2W A;  5I1F A;  1LZ0 A;  4PV5 A;  2Q4J A;  1HAN A;  3OGZ A;  4JD0 A;  3ZF8 A;  3R4Q A;  2R6U A;  4HO3 A;  2VSH A;  5C4E A;  3LHO A;  1WT0 A;  3GM5 A;  2XMH A;  1R7X A;  1G0R A;  4Y7T A;  2RJ7 A;  3HDP A;  4ASJ A;  2V0J A;  4FQW A;  1GX0 A;  2ZU7 A;  3HUH A;  4HO8 A;  1LZI A;  1S4P A;  2JCK A;  1H4E A;  4JH2 A;  1MC3 A;  3FOQ A;  4MTT A;  1G3L A;  5F6Q A;  5HCW A;  1HM8 A;  1ZI4 A;  1HM0 A;  3IOJ A;  3CKO A;  1KND A;  3BCV A;  2IGA A;  3I0K A;  2E3D A;  1DHY A;  3K8E A;  4M2A A;  1MH6 A;  2P7M A;  2ZW5 A;  4Z6V A;  1ON6 A;  5CQP A;  4OPN A;  4IAG A;  1VIC A;  4HO5 A;  3D8V A;  1G97 A;  3JUJ A;  3SX8 A;  1TW1 A;  2QQZ A;  1ZIZ A;  4IR0 A;  5EJZ A;  5CMF X;  3OPY A;  2WVM A;  4G3P A;  4J18 A;  1G23 A;  5C1L A;  1VH1 A;  1JYK A;  2VS4 A;  2VXL A;  3SX5 A;  4Y64 A;  1G8O A;  2W0W A;  1FR9 A;  2ZW4 A;  5BWG A;  3B59 A;  4B4B A;  3RMV A;  4FRQ A;  4HG6 A;  1KW3 B;  5C8R A;  5AJP A;  4KPX A;  5CMJ A;  4P00 A;  5FTV A;  1VZU A;  2D7I A;  4B4G A;  4HO4 A;  1FO9 A;  4Z04 A;  3V0O A;  4JH3 A;  3ZW5 A;  2RIY A;  2RJ1 A;  4Y7F A;  4CJC A;  1YP3 A;  4FRM A;  1V84 A;  4FRD A;  1R80 A;  4EEM A;  2Z87 A;  3I0D A;  2C21 A;  3OUL A;  2V0K A;  1W55 A;  3IOI A;  2QKX A;  4Z6W A;  2I7B A;  1S4N A;  2A4W A;  3QVB A;  5FTS A;  3TZT A;  1R7T A;  1VGU A;  2P7P A;  1ZCY A;  4R7P A;  2APC A;  2ZHP A;  4JH8 A;  2EHZ A;  4Z6N A;  2AM4 A;  4GHD A;  3PNN A;  2YC5 A;  4XWI A;  5CB9 A;  3V8Z A;  3SXE A;  5C1G A;  2PGV A;  2YQH A;  4ECM A;  2OI6 A; 
#chains in the Genus database with same CATH homology
 4EE3 A;  4DE7 A;  3USQ A;  1YP2 A;  3F1C A;  3T7O A;  3U0X A;  1FWY A;  4FIY A;  3R2W A;  2OI7 A;  2J0B A;  1OQM B;  2WAW A;  3V0P A;  1FOA A;  2FFU A;  2BO7 A;  5AJN A;  1JYL A;  3SXA A;  2MZB A;  5FU0 A;  4KC4 A;  1HJJ A;  3V0L A;  1JV3 A;  2C0N A;  1VZX A;  3U0Y A;  2VK9 A;  3NGW A;  5C49 A;  1W77 A;  3K8D A;  2JCO A;  4B5B A;  3CGX A;  2RJ9 A;  3OKR A;  2OEG A;  1S4O A;  2RJ5 A;  3CU0 A;  3U2U A;  2OI5 A;  2A8W A;  5HS2 A;  4HO2 A;  3U2T A;  2Z86 A;  3ST8 A;  4Q7C A;  1ON8 A;  4M2B A;  4HO0 A;  3OC9 A;  1TZF A;  2Y4J A;  1XZ6 A;  3OH0 A;  2Y4K A;  5IFY A;  4EVW A;  4CJ8 A;  2VXM A;  5J49 A;  1IIM A;  1R82 A;  1NQI B;  1LL3 A;  1WT1 A;  2FFV A;  2YES A;  3I0G A;  2X65 A;  4BQH A;  4FRH A;  5EJ1 A;  2AEC A;  3SXG A;  3V0M A;  3V8Y A;  3F1Y A;  2YQJ A;  4EE4 A;  1GX4 A;  2ICY A;  1OMX A;  4FRB A;  1LZJ A;  1H5S A;  5BXC A;  1H7E A;  3SPT A;  3DJ4 A;  1QWJ A;  1LL2 A;  1FO8 A;  1H5R A;  2J0A A;  2V0H A;  1H7T A;  4B3U A;  2VSI A;  2E8B A;  1WT2 A;  4GBP A;  1R7V A;  5CQO A;  4DEC A;  1VGZ A;  3CKV A;  1ZCT A;  1JVG A;  2AGD A;  4AC3 A;  4KC2 A;  4E1K A;  3Q7U A;  1H7G A;  5CMG X;  4CVH A;  4M4K A;  3I0F A;  2VS3 A;  1ZDF A;  4FIX A;  4KRV A;  3CKN A;  4B2X A;  4D11 A;  1LVW A;  4KNX A;  5C1H A;  4KQL A;  3T7M A;  3TQD A;  2JCL A;  1FG5 N;  3I0E A;  5C4F A;  4ARW A;  3DK5 A;  2XWN A;  5C4B A;  1FR8 A;  2RJ6 A;  1FRW A;  2X5Z A;  5C36 A;  3CKJ A;  4EEA A;  3I0C A;  3JTJ A;  1VM8 A;  2AE7 A;  4FRA A;  4Y62 A;  2X60 A;  3U2X A;  3I0I X;  4NAK A;  1JV1 A;  1VPA A;  1ZJ3 A;  2P6W A;  4EE5 A;  3SXB A;  3PKQ A;  2JCJ A;  1H4D A;  4B4M A;  2RIT A;  1I52 A;  2V0I A;  1H7L A;  4M28 A;  3Q4S A;  2YQC A;  3E25 A;  3DUV A;  1TW5 A;  3SXC A;  5IDS A;  2PX7 A;  3OH1 A;  1H5T A;  1QGQ A;  2AH9 A;  3V0Q A;  4K6R A;  5CQM X;  1VZT A;  2PGY A;  4FCE A;  4HOC A;  5CQN X;  3ZGG A;  1YP4 A;  2XME A;  2D7R A;  1O7Q A;  2O1G A;  5C3D A;  1VGW A;  1ZI3 A;  1HM9 A;  1G93 A;  4AYJ A;  1FXO A;  1G9R A;  4MIX A;  4FRP A;  3IOH A;  1NWG B;  2Y6P A;  4KT7 A;  4Y7V A;  3ZLK A;  4UEG A;  1WSZ A;  3LW6 A;  1ZJP A;  2W0V A;  2FYB A;  4P02 A;  5C4C A;  1FXJ A;  3ZGF A;  3V90 A;  3JUK A;  1ZJ1 A;  5D91 A;  4G3S A;  1LZ7 A;  1OMZ A;  3OH2 A;  4O6M A;  1V82 A;  3HL3 A;  4ZDQ A;  1QG8 A;  4EEO A;  3GUE A;  1TVY A;  4FRE A;  2FYC B;  2VD4 A;  4KC1 A;  3FWW A;  4NAN A;  1ZDG A;  2WEE A;  2X5S A;  1G1L A;  1YRO B;  5L6V A;  1IIN A;  4AYL A;  2QGI A;  1H7H A;  1ZJ0 A;  2O1H A;  4FCU A;  4HO9 A;  4IRP A;  3RMW A;  4G3Q A;  1NKH B;  5CMH A;  3SX7 A;  3D5N A;  4MYB A;  2BO4 A;  2AM5 A;  5FUH A;  2RIX A;  2D0J A;  1INI A;  5AJO A;  3SX3 A;  1WVC A;  4JIS A;  1W57 A;  1NF5 B;  4AAW A;  4LW3 A;  3ZLL A;  1WT3 A;  3V0N A;  1ZI5 A;  1HV9 A;  1E5K A;  3BRK X;  2V0L A;  2YC3 A;  2AM3 A;  2FY7 A;  4Y6U A;  1KWS A;  1H5S C;  1ZCV A;  4L41 C;  5D92 A;  1H7F A;  1MP5 A;  2VFZ A;  3D98 A;  1FZW A;  1ZJO A;  2UX8 A;  5C3B A;  4D0Z A;  2I5E A;  5IDT A;  2Y4L A;  1VH3 A;  4B42 A;  1H5S B;  4D11 C;  2XWM A;  1H5R B;  4EEG A;  1PZT A;  1GQ9 A;  4IRQ A;  1O23 B;  2QH5 A;  3V91 A;  4C2S A;  4HCQ A;  2FYD B;  4Y9X A;  4Y7G A;  5L6S A;  1H3M A;  4KPZ A;  1INJ A;  2Y7A A;  4MND A;  1R7Y A;  1H4C A;  3OAM A;  4O6N A;  5JQQ A;  1K4V A;  1FGG A;  5DDT A;  1QGS A;  4D0T A;  2WGZ A;  1O0R A;  3SXD A;  5EIY A;  4D48 A;  1EZI A;  2PA4 A;  2WVK A;  4NAI A;  4DDZ A;  2VS5 A;  1ZCU A;  2RJ0 A;  4B2W A;  3POL A;  1H5S D;  4NAL A;  5CMI A;  3I0L A;  2YQS A;  3E26 A;  1ZHJ A;  5C38 A;  1GWW A;  2WE9 A;  2RJ8 A;  4CJB A;  1PZY B;  1GQC A;  2ZU9 A;  3R3I A;  4HO6 A;  1MP3 A;  3I0H A;  4KXO A;  5C47 A;  2FYA A;  1H7Q A;  1Z90 A;  4Y63 A;  5C48 A;  1ZI1 A;  2P72 A;  5DDV A;  1G2V A;  2ZU8 A;  1VGT A;  1V83 A;  2I5K A;  1G95 A;  2NXV A;  1R7U A;  1EYR A;  3T7N A;  3RSB A;  2GGQ A;  1HJL A;  4ASY A;  3CKQ A;  4Y6N A;  3U2V A;  1JVD A;  2P73 A;  2DPW A;  1GA8 A;  2Y4M A;  4Y7U A;  4KNR A;  3OH4 A;  3Q80 A;  1FGX A;  3N9W A;  2BO6 A;  1H5T B;  3OH3 A;  2A8U A;  4G87 A;  4YS8 A;  3I0J A;  1SS9 A;  4FRO A;  3PKP A;  2XWL A;  2RIZ A;  1R81 A;  1NMM B;  2GGO A;  4FRL A;  1O7O A;  2O1F A;  2ICX A;  2AES A;  5FYE A;  4BMA A;  1MP4 A;  1GWV A;  1LL0 A;  3KIA A;  2YCM A;  1XHB A;  5C4D A;  2RJ4 A;  3USR A;  5FV9 A;  4LW6 A;  2BO8 A;  1ZJ2 A;  3O3P A;  5C3A A;  3EE5 A;  2WVL A;  5FU8 A;  2CU2 A;  2OEF A;  1NHE B;  5CQL X;  3U2W A;  5I1F A;  1LZ0 A;  2Q4J A;  3OGZ A;  4JD0 A;  3ZF8 A;  4HO3 A;  2VSH A;  5C4E A;  1WT0 A;  2XMH A;  1R7X A;  1G0R A;  4Y7T A;  2RJ7 A;  4ASJ A;  2V0J A;  4FQW A;  1GX0 A;  2ZU7 A;  4HO8 A;  1LZI A;  1S4P A;  2JCK A;  1H4E A;  1MC3 A;  3FOQ A;  1G3L A;  1HM8 A;  1ZI4 A;  1HM0 A;  3IOJ A;  3CKO A;  3BCV A;  3I0K A;  2E3D A;  3K8E A;  4M2A A;  1ON6 A;  5CQP A;  1VIC A;  4HO5 A;  3D8V A;  1G97 A;  3JUJ A;  3SX8 A;  1TW1 A;  1ZIZ A;  5EJZ A;  5CMF X;  2WVM A;  4G3P A;  4J18 A;  1G23 A;  5C1L A;  1VH1 A;  1JYK A;  2VS4 A;  2VXL A;  3SX5 A;  4Y64 A;  1G8O A;  2W0W A;  1FR9 A;  4B4B A;  3RMV A;  4FRQ A;  4HG6 A;  5C8R A;  5AJP A;  4KPX A;  5CMJ A;  4P00 A;  5FTV A;  1VZU A;  2D7I A;  4B4G A;  4HO4 A;  1FO9 A;  3V0O A;  4CJC A;  2RIY A;  2RJ1 A;  4Y7F A;  1YP3 A;  4FRM A;  1V84 A;  4FRD A;  1R80 A;  4EEM A;  2Z87 A;  3I0D A;  2V0K A;  1W55 A;  3IOI A;  2QKX A;  2I7B A;  1S4N A;  3QVB A;  5FTS A;  3TZT A;  1R7T A;  1VGU A;  4R7P A;  1ZCY A;  2APC A;  2AM4 A;  3PNN A;  2YC5 A;  4XWI A;  3V8Z A;  3SXE A;  5C1G A;  2PGV A;  2YQH A;  4ECM A;  2OI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...