1G1LA

The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). tdp-glucose complex.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
292
structure length
292
Chain Sequence
KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (RmlA).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 98
structure length 292
sequence length 292
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2000-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g1lA00
4HO2A 4K6RA 2ICYA 3R2WA 5C1GA 3NGWA 3V0LA 5CQOA 1JV1A 3CKQA 3O3PA 3DK5A 1R7TA 3I0JA 3IOHA 3CGXA 2XWNA 4GBPA 1FWYA 1ZCYA 2PGVA 5C47A 1O23B 1ZIZA 3ZLKA 5C36A 5C4CA 1O0RA 2PA4A 2YESA 3USRA 1S4OA 1YP4A 4HO3A 2WEEA 3SXGA 2I7BA 3U2VA 1VH1A 4HO4A 2BO7A 3D5NA 1G1LA 1R80A 3FOQA 4KQLA 2X65A 4IRPA 3RSBA 4R7PA 3SXDA 2W0WA 1ZCVA 5FU8A 3I0IX 3CU0A 1ZJ1A 2OEGA 4FRHA 1TVYA 1LZJA 4M4KA 5FTSA 2AH9A 1GX0A 5C1HA 2YCMA 5L6SA 3V0QA 2JCJA 1H7QA 2BO6A 1ZCUA 4B42A 1NF5B 4C2SA 4D0ZA 1IINA 2NXVA 5C3AA 3CKOA 4FRPA 5FTVA 1XZ6A 1HM8A 2D7IA 3SXAA 3I0HA 4KT7A 1HJJA 1GWWA 1H4EA 1W57A 3ZGFA 4FRMA 1IIMA 3EE5A 1R7XA 3SX3A 1H5TB 1MP4A 1G2VA 3I0FA 2Y7AA 4HO0A 4HG6A 1V83A 4FCEA 3CKJA 1NMMB 4AAWA 3U2UA 3IOJA 1ON6A 2VSHA 3SX8A 4Y64A 5IDTA 4CJBA 1FO9A 1H5RA 2YC3A 2QKXA 1W77A 5AJOA 4EEOA 1INJA 1GX4A 2GGOA 4AYLA 2RJ5A 1WT3A 2OEFA 4D48A 5I1FA 1H5RB 1VICA 5C48A 5DDTA 2BO4A 3V91A 1H5SC 4P02A 2ICXA 3RMVA 2WAWA 5EIYA 2XMHA 4G3SA 1EYRA 5CQNX 1H4CA 3U0YA 4D0TA 1H7EA 1QWJA 1G3LA 1MC3A 5CQPA 1LZIA 2RJ6A 1R7YA 3PNNA 4EVWA 2FFVA 1INIA 3FWWA 5CMIA 4HO9A 1TW1A 3OKRA 4B2XA 3Q4SA 2RIYA 4JISA 4KNXA 1ZHJA 3SXEA 1FXJA 4HO6A 4CVHA 4KC4A 4Y6NA 4Y7GA 4G87A 1LL2A 1PZYB 4FCUA 1ZCTA 5FV9A 3V0PA 5L6VA 1ZI5A 2RJ7A 1G97A 3IOIA 1ZJOA 4HCQA 3V0OA 1Z90A 4YS8A 2Y6PA 2WVMA 1HM0A 5CQMX 3PKPA 1ZJ2A 2WVKA 1FGGA 1WT0A 1V82A 3BRKX 2OI7A 1MP3A 4AYJA 4Y7VA 4ZDQA 4B2WA 1VH3A 2VXMA 1TW5A 1R82A 4EEAA 4CJCA 2VS4A 2AGDA 2X5SA 1XHBA 1FXOA 5FUHA 3SXCA 4P00A 4FREA 5IDSA 4MYBA 3PKQA 2FY7A 1NQIB 3SXBA 2ZU8A 1QG8A 2FYAA 2O1FA 4FRDA 3E26A 2RIXA 1H7LA 1LVWA 3V90A 2Z86A 3T7OA 4B4BA 3I0KA 5HS2A 1VZTA 2W0VA 1VGTA 4KPXA 1VGZA 4KC2A 2AM5A 5C3BA 2YQHA 3I0LA 1H5TA 2RJ8A 1R7VA 4ASYA 3I0CA 1OMXA 3QVBA 1HM9A 3U2WA 1GQCA 4Y62A 2I5KA 1KWSA 1PZTA 4IRQA 2AE7A 4FQWA 1SS9A 4DE7A 1ZJPA 3SX5A 5CMFX 1G93A 1FR8A 2WVLA 2O1HA 4Y9XA 2QGIA 1S4PA 2XWLA 5CQLX 1FG5N 2CU2A 2RJ0A 2UX8A 3E25A 4LW3A 4FRBA 2Y4LA 1ZDFA 4JD0A 3OGZA 4NAKA 1TZFA 1G9RA 3Q7UA 3OH3A 4EE5A 2O1GA 3JUKA 2X60A 1NHEB 2APCA 1YP2A 3K8DA 1K4VA 1O7QA 1QGQA 4Y7UA 4ASJA 4MNDA 1GA8A 1O7OA 3V0NA 1VZXA 1NKHB 3CKVA 3CKNA 2Y4MA 5C8RA 3V8ZA 5C4EA 1GWVA 2FFUA 3Q80A 1I52A 2ZU9A 1FGXA 2BO8A 2YQCA 2QH5A 3TZTA 1JVGA 4B4GA 3D8VA 1G8OA 1GQ9A 5DDVA 4KRVA 1H7HA 2WGZA 4UEGA 1H3MA 3OH4A 4EEGA 1VGWA 5C49A 2VFZA 4M2BA 1ZI4A 4B3UA 1FRWA 1LZ7A 4D11A 2AM4A 5C4DA 3I0GA 4CJ8A 2VSIA 3U2TA 3OAMA 1OQMB 3USQA 2PX7A 2YQJA 5C3DA 3R3IA 2GGQA 4NAIA 5IFYA 1E5KA 3KIAA 2XWMA 2DPWA 4E1KA 4BMAA 2JCOA 3ZLLA 1ZDGA 4HO5A 3HL3A 2Z87A 1H5SD 5FU0A 5CMJA 4G3QA 2I5EA 1VPAA 3SPTA 2P72A 4FROA 1JYKA 1VZUA 2XMEA 5JQQA 2OI5A 2ZU7A 3TQDA 4B4MA 5C4FA 4NANA 2VS3A 3OH0A 1MP5A 4Y63A 3JTJA 3ST8A 1FOAA 1ON8A 4LW6A 5BXCA 2P6WA 2RIZA 2P73A 3V8YA 2AESA 1W55A 2RITA 4BQHA 3T7NA 5EJ1A 2V0KA 1HV9A 2AM3A 2FYDB 4M28A 2X5ZA 1WT2A 2VD4A 1HJLA 1ZJ3A 2AECA 4KC1A 2MZBA 4FRAA 1FO8A 2Q4JA 2RJ9A 2Y4JA 3T7MA 4M2AA 3DUVA 3OH2A 2RJ4A 4EE3A 2PGYA 2YQSA 4EE4A 4FRQA 2FYCB 4HOCA 2VS5A 1WVCA 5CMGX 1FZWA 1WSZA 1H7TA 1R81A 2E3DA 1NWGB 3OC9A 4J18A 2V0LA 3U0XA 1OMZA 4Y7FA 1FR9A 2JCKA 1JYLA 2E8BA 3I0EA 3DJ4A 1JVDA 5C38A 1G0RA 1EZIA 1S4NA 2A8WA 5J49A 1R7UA 3K8EA 4HO8A 4XWIA 1ZI3A 1G95A 3V0MA 4DDZA 3I0DA 1G23A 2A8UA 1YROB 2VXLA 1ZI1A 1VM8A 2V0HA 1VGUA 5CMHA 5FYEA 5AJNA 3N9WA 5C1LA 1ZJ0A 4KNRA 2RJ1A 1H4DA 4FRLA 1QGSA 1LZ0A 1H5SA 2D7RA 4ECMA 2V0IA 1LL0A 3F1YA 4AC3A 1JV3A 2WE9A 1LL3A 3GUEA 2D0JA 3LW6A 1H5SB 3D98A 1YP3A 3JUJA 3SX7A 3U2XA 4EEMA 4Y7TA 1WT1A 2Y4KA 4KXOA 2FYBA 3ZGGA 4NALA 2V0JA 3OH1A 4ARWA 4Y6UA 3POLA 1V84A 5EJZA 2JCLA 5AJPA 4L41C 2YC5A 4G3PA 3ZF8A 1H7FA 4DECA 4B5BA 2OI6A 4D11C 4KPZA 3RMWA 5C4BA 3F1CA 3BCVA 1H7GA
chains in the Genus database with same CATH superfamily
4HO2A 4K6RA 2ICYA 3R2WA 5C1GA 3NGWA 3V0LA 5CQOA 1JV1A 3CKQA 3O3PA 3DK5A 1R7TA 3I0JA 3IOHA 3CGXA 2XWNA 4GBPA 1FWYA 1ZCYA 2PGVA 5C47A 1O23B 1ZIZA 3ZLKA 5C36A 5C4CA 1O0RA 2PA4A 2YESA 3USRA 1S4OA 1YP4A 4HO3A 2WEEA 3SXGA 2I7BA 3U2VA 1VH1A 4HO4A 2BO7A 3D5NA 1G1LA 1R80A 3FOQA 4KQLA 2X65A 4IRPA 3RSBA 4R7PA 3SXDA 2W0WA 1ZCVA 5FU8A 3I0IX 3CU0A 1ZJ1A 2OEGA 4FRHA 1TVYA 1LZJA 4M4KA 5FTSA 2AH9A 1GX0A 5C1HA 2YCMA 5L6SA 3V0QA 2JCJA 1H7QA 2BO6A 1ZCUA 4B42A 1NF5B 4C2SA 4D0ZA 1IINA 2NXVA 5C3AA 3CKOA 4FRPA 5FTVA 1XZ6A 1HM8A 2D7IA 3SXAA 3I0HA 4KT7A 1HJJA 1GWWA 2J0AA 1H4EA 1W57A 3ZGFA 4FRMA 1IIMA 3EE5A 1R7XA 3SX3A 1H5TB 1MP4A 1G2VA 3I0FA 2Y7AA 4HO0A 4HG6A 1V83A 4FCEA 3CKJA 1NMMB 4AAWA 3U2UA 3IOJA 1ON6A 2VSHA 4MIXA 3SX8A 4Y64A 5IDTA 4CJBA 2VK9A 1FO9A 1H5RA 2YC3A 2QKXA 1W77A 5AJOA 4EEOA 1INJA 1GX4A 2GGOA 4AYLA 2RJ5A 1WT3A 2OEFA 4D48A 5I1FA 1H5RB 1VICA 4Q7CA 5C48A 5DDTA 2BO4A 3V91A 1H5SC 4P02A 2ICXA 5D92A 3RMVA 2WAWA 5EIYA 2XMHA 4G3SA 1EYRA 5CQNX 1H4CA 3U0YA 4D0TA 1H7EA 1QWJA 1G3LA 1MC3A 5CQPA 1LZIA 2RJ6A 1R7YA 3PNNA 4EVWA 2FFVA 1INIA 3FWWA 5CMIA 4HO9A 1TW1A 3OKRA 4B2XA 3Q4SA 2RIYA 4JISA 4KNXA 1ZHJA 3SXEA 1FXJA 4HO6A 4CVHA 4KC4A 4Y6NA 4Y7GA 4G87A 1LL2A 1PZYB 4FCUA 1ZCTA 5FV9A 3V0PA 5L6VA 1ZI5A 2RJ7A 1G97A 3IOIA 1ZJOA 4HCQA 3V0OA 1Z90A 4YS8A 2Y6PA 2WVMA 1HM0A 5CQMX 3PKPA 1ZJ2A 2WVKA 1FGGA 1WT0A 1V82A 3BRKX 2OI7A 1MP3A 4AYJA 4Y7VA 4ZDQA 4B2WA 1VH3A 2VXMA 1TW5A 1R82A 4EEAA 4CJCA 2VS4A 2AGDA 2X5SA 1XHBA 1FXOA 5FUHA 3SXCA 4P00A 4FREA 5IDSA 4MYBA 3PKQA 2FY7A 1NQIB 3SXBA 2ZU8A 1QG8A 2FYAA 2O1FA 4FRDA 3E26A 2RIXA 4O6MA 1H7LA 1LVWA 3V90A 2Z86A 3T7OA 4B4BA 3I0KA 5HS2A 1VZTA 2W0VA 1VGTA 4KPXA 1VGZA 4KC2A 2AM5A 5C3BA 2YQHA 3I0LA 1H5TA 2RJ8A 1R7VA 4ASYA 3I0CA 1OMXA 3QVBA 1HM9A 3U2WA 1GQCA 4Y62A 2I5KA 1KWSA 1PZTA 4IRQA 2AE7A 4FQWA 1SS9A 4DE7A 1ZJPA 3SX5A 4FIXA 5CMFX 2J0BA 1G93A 1FR8A 2WVLA 2O1HA 4Y9XA 2QGIA 1S4PA 2XWLA 4O6NA 5CQLX 1FG5N 2CU2A 2RJ0A 2UX8A 3E25A 4LW3A 4FRBA 2Y4LA 1ZDFA 4JD0A 3OGZA 4NAKA 1TZFA 1G9RA 3Q7UA 3OH3A 4EE5A 2O1GA 3JUKA 2X60A 1NHEB 2APCA 1YP2A 3K8DA 1K4VA 1O7QA 1QGQA 4Y7UA 4ASJA 4MNDA 1GA8A 1O7OA 3V0NA 1VZXA 1NKHB 3CKVA 3CKNA 2Y4MA 5C8RA 3V8ZA 5C4EA 1GWVA 2FFUA 3Q80A 1I52A 2ZU9A 1FGXA 2BO8A 2YQCA 2QH5A 3TZTA 1JVGA 4B4GA 3D8VA 1G8OA 1GQ9A 5DDVA 4KRVA 1H7HA 2WGZA 4UEGA 1H3MA 3OH4A 4EEGA 1VGWA 5C49A 2VFZA 4M2BA 1ZI4A 4B3UA 1FRWA 1LZ7A 4D11A 2AM4A 5C4DA 3I0GA 4CJ8A 2VSIA 3U2TA 3OAMA 1OQMB 3USQA 2PX7A 2YQJA 5C3DA 3R3IA 2GGQA 4NAIA 5IFYA 1E5KA 3KIAA 2XWMA 2DPWA 4E1KA 4BMAA 2JCOA 3ZLLA 1ZDGA 4HO5A 3HL3A 2Z87A 1H5SD 5FU0A 5CMJA 4G3QA 2I5EA 1VPAA 3SPTA 2P72A 4FROA 1JYKA 1VZUA 2XMEA 5JQQA 2OI5A 2ZU7A 3TQDA 4B4MA 5C4FA 4NANA 2VS3A 3OH0A 1MP5A 4Y63A 3JTJA 3ST8A 1FOAA 1ON8A 4LW6A 5BXCA 2P6WA 2RIZA 2P73A 3V8YA 2AESA 1W55A 2RITA 4BQHA 3T7NA 5EJ1A 2V0KA 1HV9A 2AM3A 2FYDB 4M28A 2X5ZA 1WT2A 2VD4A 1HJLA 1ZJ3A 2AECA 4KC1A 2MZBA 4FRAA 1FO8A 2Q4JA 2RJ9A 2Y4JA 3T7MA 4M2AA 3DUVA 3OH2A 2RJ4A 4EE3A 2PGYA 2YQSA 4EE4A 4FRQA 2FYCB 4HOCA 2VS5A 5D91A 1WVCA 5CMGX 1FZWA 1WSZA 1H7TA 1R81A 2E3DA 1NWGB 3OC9A 4J18A 2V0LA 3U0XA 1OMZA 4Y7FA 1FR9A 2JCKA 1JYLA 2E8BA 3I0EA 3DJ4A 1JVDA 5C38A 1G0RA 4FIYA 1EZIA 1S4NA 2A8WA 5J49A 1R7UA 3K8EA 4HO8A 4XWIA 1ZI3A 1G95A 3V0MA 4DDZA 3I0DA 1G23A 2A8UA 1YROB 2VXLA 1ZI1A 1VM8A 2V0HA 1VGUA 5CMHA 5FYEA 5AJNA 3N9WA 5C1LA 1ZJ0A 4KNRA 2RJ1A 1H4DA 4FRLA 1QGSA 1LZ0A 1H5SA 2D7RA 4ECMA 2V0IA 1LL0A 3F1YA 4AC3A 1JV3A 2WE9A 1LL3A 3GUEA 2D0JA 3LW6A 1H5SB 3D98A 1YP3A 3JUJA 3SX7A 3U2XA 4EEMA 4Y7TA 1WT1A 2Y4KA 4KXOA 2FYBA 3ZGGA 4NALA 2V0JA 3OH1A 4ARWA 4Y6UA 3POLA 1V84A 5EJZA 2JCLA 5AJPA 4L41C 2YC5A 4G3PA 2C0NA 3ZF8A 1H7FA 4DECA 4B5BA 2OI6A 4D11C 4KPZA 3RMWA 5C4BA 3F1CA 3BCVA 1H7GA
chains in the Genus database with same CATH topology
4HO2A 4K6RA 2ICYA 3R2WA 5C1GA 3NGWA 3V0LA 5CQOA 1JV1A 3CKQA 3O3PA 3DK5A 1R7TA 3I0JA 3IOHA 3CGXA 2XWNA 4GBPA 1FWYA 1ZCYA 2PGVA 5C47A 1O23B 1ZIZA 3ZLKA 5C36A 5C4CA 1O0RA 2PA4A 2YESA 3USRA 1S4OA 1YP4A 4HO3A 2WEEA 3SXGA 2I7BA 3U2VA 1VH1A 4HO4A 2BO7A 3D5NA 1G1LA 1R80A 3FOQA 4KQLA 2X65A 4IRPA 3RSBA 4R7PA 3SXDA 2W0WA 1ZCVA 5FU8A 3I0IX 3CU0A 1ZJ1A 2OEGA 4FRHA 1TVYA 1LZJA 4M4KA 5FTSA 2AH9A 1GX0A 5C1HA 2YCMA 5L6SA 3V0QA 2JCJA 1H7QA 2BO6A 1ZCUA 4B42A 1NF5B 4C2SA 4D0ZA 1IINA 2NXVA 5C3AA 3CKOA 4FRPA 5FTVA 1XZ6A 1HM8A 2D7IA 3SXAA 3I0HA 4KT7A 1HJJA 1GWWA 2J0AA 1H4EA 1W57A 3ZGFA 4FRMA 1IIMA 3EE5A 1R7XA 3SX3A 1H5TB 1MP4A 1G2VA 3I0FA 2Y7AA 4HO0A 4HG6A 1V83A 4FCEA 3CKJA 1NMMB 4AAWA 3U2UA 3IOJA 1ON6A 2VSHA 4MIXA 3SX8A 4Y64A 5IDTA 4CJBA 2VK9A 1FO9A 1H5RA 2YC3A 2QKXA 1W77A 5AJOA 4EEOA 1INJA 1GX4A 2GGOA 4AYLA 2RJ5A 1WT3A 2OEFA 4D48A 5I1FA 1H5RB 1VICA 4Q7CA 5C48A 5DDTA 2BO4A 3V91A 1H5SC 4P02A 2ICXA 5D92A 3RMVA 2WAWA 5EIYA 2XMHA 4G3SA 1EYRA 5CQNX 1H4CA 3U0YA 4D0TA 1H7EA 1QWJA 1G3LA 1MC3A 5CQPA 1LZIA 2RJ6A 1R7YA 3PNNA 4EVWA 2FFVA 1INIA 3FWWA 5CMIA 4HO9A 1TW1A 3OKRA 4B2XA 3Q4SA 2RIYA 4JISA 4KNXA 1ZHJA 3SXEA 1FXJA 4HO6A 4CVHA 4KC4A 4Y6NA 4Y7GA 4G87A 1LL2A 1PZYB 4FCUA 1ZCTA 5FV9A 3V0PA 5L6VA 1ZI5A 2RJ7A 1G97A 3IOIA 1ZJOA 4HCQA 3V0OA 1Z90A 4YS8A 2Y6PA 2WVMA 1HM0A 5CQMX 3PKPA 1ZJ2A 2WVKA 1FGGA 1WT0A 1V82A 3BRKX 2OI7A 1MP3A 4AYJA 4Y7VA 4ZDQA 4B2WA 1VH3A 2VXMA 1TW5A 1R82A 4EEAA 4CJCA 2VS4A 2AGDA 2X5SA 1XHBA 1FXOA 5FUHA 3SXCA 4P00A 4FREA 5IDSA 4MYBA 3PKQA 2FY7A 1NQIB 3SXBA 2ZU8A 1QG8A 2FYAA 2O1FA 4FRDA 3E26A 2RIXA 4O6MA 1H7LA 1LVWA 3V90A 2Z86A 3T7OA 4B4BA 3I0KA 5HS2A 1VZTA 2W0VA 1VGTA 4KPXA 1VGZA 4KC2A 2AM5A 5C3BA 2YQHA 3I0LA 1H5TA 2RJ8A 1R7VA 4ASYA 3I0CA 1OMXA 3QVBA 1HM9A 3U2WA 1GQCA 4Y62A 2I5KA 1KWSA 1PZTA 4IRQA 2AE7A 4FQWA 1SS9A 4DE7A 1ZJPA 3SX5A 4FIXA 5CMFX 2J0BA 1G93A 1FR8A 2WVLA 2O1HA 4Y9XA 2QGIA 1S4PA 2XWLA 4O6NA 5CQLX 1FG5N 2CU2A 2RJ0A 2UX8A 3E25A 4LW3A 4FRBA 2Y4LA 1ZDFA 4JD0A 3OGZA 4NAKA 1TZFA 1G9RA 3Q7UA 3OH3A 4EE5A 2O1GA 3JUKA 2X60A 1NHEB 2APCA 1YP2A 3K8DA 1K4VA 1O7QA 1QGQA 4Y7UA 4ASJA 4MNDA 1GA8A 1O7OA 3V0NA 1VZXA 1NKHB 3CKVA 3CKNA 2Y4MA 5C8RA 3V8ZA 5C4EA 1GWVA 2FFUA 3Q80A 1I52A 2ZU9A 1FGXA 2BO8A 2YQCA 2QH5A 3TZTA 1JVGA 4B4GA 3D8VA 1G8OA 1GQ9A 5DDVA 4KRVA 1H7HA 2WGZA 4UEGA 1H3MA 3OH4A 4EEGA 1VGWA 5C49A 2VFZA 4M2BA 1ZI4A 4B3UA 1FRWA 1LZ7A 4D11A 2AM4A 5C4DA 3I0GA 4CJ8A 2VSIA 3U2TA 3OAMA 1OQMB 3USQA 2PX7A 2YQJA 5C3DA 3R3IA 2GGQA 4NAIA 5IFYA 1E5KA 3KIAA 2XWMA 2DPWA 4E1KA 4BMAA 2JCOA 3ZLLA 1ZDGA 4HO5A 3HL3A 2Z87A 1H5SD 5FU0A 5CMJA 4G3QA 2I5EA 1VPAA 3SPTA 2P72A 4FROA 1JYKA 1VZUA 2XMEA 5JQQA 2OI5A 2ZU7A 3TQDA 4B4MA 5C4FA 4NANA 2VS3A 3OH0A 1MP5A 4Y63A 3JTJA 3ST8A 1FOAA 1ON8A 4LW6A 5BXCA 2P6WA 2RIZA 2P73A 3V8YA 2AESA 1W55A 2RITA 4BQHA 3T7NA 5EJ1A 2V0KA 1HV9A 2AM3A 2FYDB 4M28A 2X5ZA 1WT2A 2VD4A 1HJLA 1ZJ3A 2AECA 4KC1A 2MZBA 4FRAA 1FO8A 2Q4JA 2RJ9A 2Y4JA 3T7MA 4M2AA 3DUVA 3OH2A 2RJ4A 4EE3A 2PGYA 2YQSA 4EE4A 4FRQA 2FYCB 4HOCA 2VS5A 5D91A 1WVCA 5CMGX 1FZWA 1WSZA 1H7TA 1R81A 2E3DA 1NWGB 3OC9A 4J18A 2V0LA 3U0XA 1OMZA 4Y7FA 1FR9A 2JCKA 1JYLA 2E8BA 3I0EA 3DJ4A 1JVDA 5C38A 1G0RA 4FIYA 1EZIA 1S4NA 2A8WA 5J49A 1R7UA 3K8EA 4HO8A 4XWIA 1ZI3A 1G95A 3V0MA 4DDZA 3I0DA 1G23A 2A8UA 1YROB 2VXLA 1ZI1A 1VM8A 2V0HA 1VGUA 5CMHA 5FYEA 5AJNA 3N9WA 5C1LA 1ZJ0A 4KNRA 2RJ1A 1H4DA 4FRLA 1QGSA 1LZ0A 1H5SA 2D7RA 4ECMA 2V0IA 1LL0A 3F1YA 4AC3A 1JV3A 2WE9A 1LL3A 3GUEA 2D0JA 3LW6A 1H5SB 3D98A 1YP3A 3JUJA 3SX7A 3U2XA 4EEMA 4Y7TA 1WT1A 2Y4KA 4KXOA 2FYBA 3ZGGA 4NALA 2V0JA 3OH1A 4ARWA 4Y6UA 3POLA 1V84A 5EJZA 2JCLA 5AJPA 4L41C 2YC5A 4G3PA 2C0NA 3ZF8A 1H7FA 4DECA 4B5BA 2OI6A 4D11C 4KPZA 3RMWA 5C4BA 3F1CA 3BCVA 1H7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO2 A;  4K6R A;  2ICY A;  3R2W A;  5C1G A;  3NGW A;  3V0L A;  5CQO A;  1JV1 A;  3CKQ A;  3O3P A;  3DK5 A;  1R7T A;  3I0J A;  3IOH A;  3CGX A;  2XWN A;  4GBP A;  1FWY A;  1ZCY A;  2PGV A;  5C47 A;  1O23 B;  1ZIZ A;  3ZLK A;  5C36 A;  5C4C A;  1O0R A;  2PA4 A;  2YES A;  3USR A;  1S4O A;  1YP4 A;  4HO3 A;  2WEE A;  3SXG A;  2I7B A;  3U2V A;  1VH1 A;  4HO4 A;  2BO7 A;  3D5N A;  1G1L A;  1R80 A;  3FOQ A;  4KQL A;  2X65 A;  4IRP A;  3RSB A;  4R7P A;  3SXD A;  2W0W A;  1ZCV A;  5FU8 A;  3I0I X;  3CU0 A;  1ZJ1 A;  2OEG A;  4FRH A;  1TVY A;  1LZJ A;  4M4K A;  5FTS A;  2AH9 A;  1GX0 A;  5C1H A;  2YCM A;  5L6S A;  3V0Q A;  2JCJ A;  1H7Q A;  2BO6 A;  1ZCU A;  4B42 A;  1NF5 B;  4C2S A;  4D0Z A;  1IIN A;  2NXV A;  5C3A A;  3CKO A;  4FRP A;  5FTV A;  1XZ6 A;  1HM8 A;  2D7I A;  3SXA A;  3I0H A;  4KT7 A;  1HJJ A;  1GWW A;  1H4E A;  1W57 A;  3ZGF A;  4FRM A;  1IIM A;  3EE5 A;  1R7X A;  3SX3 A;  1H5T B;  1MP4 A;  1G2V A;  3I0F A;  2Y7A A;  4HO0 A;  4HG6 A;  1V83 A;  4FCE A;  3CKJ A;  1NMM B;  4AAW A;  3U2U A;  3IOJ A;  1ON6 A;  2VSH A;  3SX8 A;  4Y64 A;  5IDT A;  4CJB A;  1FO9 A;  1H5R A;  2YC3 A;  2QKX A;  1W77 A;  5AJO A;  4EEO A;  1INJ A;  1GX4 A;  2GGO A;  4AYL A;  2RJ5 A;  1WT3 A;  2OEF A;  4D48 A;  5I1F A;  1H5R B;  1VIC A;  5C48 A;  5DDT A;  2BO4 A;  3V91 A;  1H5S C;  4P02 A;  2ICX A;  3RMV A;  2WAW A;  5EIY A;  2XMH A;  4G3S A;  1EYR A;  5CQN X;  1H4C A;  3U0Y A;  4D0T A;  1H7E A;  1QWJ A;  1G3L A;  1MC3 A;  5CQP A;  1LZI A;  2RJ6 A;  1R7Y A;  3PNN A;  4EVW A;  2FFV A;  1INI A;  3FWW A;  5CMI A;  4HO9 A;  1TW1 A;  3OKR A;  4B2X A;  3Q4S A;  2RIY A;  4JIS A;  4KNX A;  1ZHJ A;  3SXE A;  1FXJ A;  4HO6 A;  4CVH A;  4KC4 A;  4Y6N A;  4Y7G A;  4G87 A;  1LL2 A;  1PZY B;  4FCU A;  1ZCT A;  5FV9 A;  3V0P A;  5L6V A;  1ZI5 A;  2RJ7 A;  1G97 A;  3IOI A;  1ZJO A;  4HCQ A;  3V0O A;  1Z90 A;  4YS8 A;  2Y6P A;  2WVM A;  1HM0 A;  5CQM X;  3PKP A;  1ZJ2 A;  2WVK A;  1FGG A;  1WT0 A;  1V82 A;  3BRK X;  2OI7 A;  1MP3 A;  4AYJ A;  4Y7V A;  4ZDQ A;  4B2W A;  1VH3 A;  2VXM A;  1TW5 A;  1R82 A;  4EEA A;  4CJC A;  2VS4 A;  2AGD A;  2X5S A;  1XHB A;  1FXO A;  5FUH A;  3SXC A;  4P00 A;  4FRE A;  5IDS A;  4MYB A;  3PKQ A;  2FY7 A;  1NQI B;  3SXB A;  2ZU8 A;  1QG8 A;  2FYA A;  2O1F A;  4FRD A;  3E26 A;  2RIX A;  1H7L A;  1LVW A;  3V90 A;  2Z86 A;  3T7O A;  4B4B A;  3I0K A;  5HS2 A;  1VZT A;  2W0V A;  1VGT A;  4KPX A;  1VGZ A;  4KC2 A;  2AM5 A;  5C3B A;  2YQH A;  3I0L A;  1H5T A;  2RJ8 A;  1R7V A;  4ASY A;  3I0C A;  1OMX A;  3QVB A;  1HM9 A;  3U2W A;  1GQC A;  4Y62 A;  2I5K A;  1KWS A;  1PZT A;  4IRQ A;  2AE7 A;  4FQW A;  1SS9 A;  4DE7 A;  1ZJP A;  3SX5 A;  5CMF X;  1G93 A;  1FR8 A;  2WVL A;  2O1H A;  4Y9X A;  2QGI A;  1S4P A;  2XWL A;  5CQL X;  1FG5 N;  2CU2 A;  2RJ0 A;  2UX8 A;  3E25 A;  4LW3 A;  4FRB A;  2Y4L A;  1ZDF A;  4JD0 A;  3OGZ A;  4NAK A;  1TZF A;  1G9R A;  3Q7U A;  3OH3 A;  4EE5 A;  2O1G A;  3JUK A;  2X60 A;  1NHE B;  2APC A;  1YP2 A;  3K8D A;  1K4V A;  1O7Q A;  1QGQ A;  4Y7U A;  4ASJ A;  4MND A;  1GA8 A;  1O7O A;  3V0N A;  1VZX A;  1NKH B;  3CKV A;  3CKN A;  2Y4M A;  5C8R A;  3V8Z A;  5C4E A;  1GWV A;  2FFU A;  3Q80 A;  1I52 A;  2ZU9 A;  1FGX A;  2BO8 A;  2YQC A;  2QH5 A;  3TZT A;  1JVG A;  4B4G A;  3D8V A;  1G8O A;  1GQ9 A;  5DDV A;  4KRV A;  1H7H A;  2WGZ A;  4UEG A;  1H3M A;  3OH4 A;  4EEG A;  1VGW A;  5C49 A;  2VFZ A;  4M2B A;  1ZI4 A;  4B3U A;  1FRW A;  1LZ7 A;  4D11 A;  2AM4 A;  5C4D A;  3I0G A;  4CJ8 A;  2VSI A;  3U2T A;  3OAM A;  1OQM B;  3USQ A;  2PX7 A;  2YQJ A;  5C3D A;  3R3I A;  2GGQ A;  4NAI A;  5IFY A;  1E5K A;  3KIA A;  2XWM A;  2DPW A;  4E1K A;  4BMA A;  2JCO A;  3ZLL A;  1ZDG A;  4HO5 A;  3HL3 A;  2Z87 A;  1H5S D;  5FU0 A;  5CMJ A;  4G3Q A;  2I5E A;  1VPA A;  3SPT A;  2P72 A;  4FRO A;  1JYK A;  1VZU A;  2XME A;  5JQQ A;  2OI5 A;  2ZU7 A;  3TQD A;  4B4M A;  5C4F A;  4NAN A;  2VS3 A;  3OH0 A;  1MP5 A;  4Y63 A;  3JTJ A;  3ST8 A;  1FOA A;  1ON8 A;  4LW6 A;  5BXC A;  2P6W A;  2RIZ A;  2P73 A;  3V8Y A;  2AES A;  1W55 A;  2RIT A;  4BQH A;  3T7N A;  5EJ1 A;  2V0K A;  1HV9 A;  2AM3 A;  2FYD B;  4M28 A;  2X5Z A;  1WT2 A;  2VD4 A;  1HJL A;  1ZJ3 A;  2AEC A;  4KC1 A;  2MZB A;  4FRA A;  1FO8 A;  2Q4J A;  2RJ9 A;  2Y4J A;  3T7M A;  4M2A A;  3DUV A;  3OH2 A;  2RJ4 A;  4EE3 A;  2PGY A;  2YQS A;  4EE4 A;  4FRQ A;  2FYC B;  4HOC A;  2VS5 A;  1WVC A;  5CMG X;  1FZW A;  1WSZ A;  1H7T A;  1R81 A;  2E3D A;  1NWG B;  3OC9 A;  4J18 A;  2V0L A;  3U0X A;  1OMZ A;  4Y7F A;  1FR9 A;  2JCK A;  1JYL A;  2E8B A;  3I0E A;  3DJ4 A;  1JVD A;  5C38 A;  1G0R A;  1EZI A;  1S4N A;  2A8W A;  5J49 A;  1R7U A;  3K8E A;  4HO8 A;  4XWI A;  1ZI3 A;  1G95 A;  3V0M A;  4DDZ A;  3I0D A;  1G23 A;  2A8U A;  1YRO B;  2VXL A;  1ZI1 A;  1VM8 A;  2V0H A;  1VGU A;  5CMH A;  5FYE A;  5AJN A;  3N9W A;  5C1L A;  1ZJ0 A;  4KNR A;  2RJ1 A;  1H4D A;  4FRL A;  1QGS A;  1LZ0 A;  1H5S A;  2D7R A;  4ECM A;  2V0I A;  1LL0 A;  3F1Y A;  4AC3 A;  1JV3 A;  2WE9 A;  1LL3 A;  3GUE A;  2D0J A;  3LW6 A;  1H5S B;  3D98 A;  1YP3 A;  3JUJ A;  3SX7 A;  3U2X A;  4EEM A;  4Y7T A;  1WT1 A;  2Y4K A;  4KXO A;  2FYB A;  3ZGG A;  4NAL A;  2V0J A;  3OH1 A;  4ARW A;  4Y6U A;  3POL A;  1V84 A;  5EJZ A;  2JCL A;  5AJP A;  4L41 C;  2YC5 A;  4G3P A;  3ZF8 A;  1H7F A;  4DEC A;  4B5B A;  2OI6 A;  4D11 C;  4KPZ A;  3RMW A;  5C4B A;  3F1C A;  3BCV A;  1H7G A; 
#chains in the Genus database with same CATH topology
 4HO2 A;  4K6R A;  2ICY A;  3R2W A;  5C1G A;  3NGW A;  3V0L A;  5CQO A;  1JV1 A;  3CKQ A;  3O3P A;  3DK5 A;  1R7T A;  3I0J A;  3IOH A;  3CGX A;  2XWN A;  4GBP A;  1FWY A;  1ZCY A;  2PGV A;  5C47 A;  1O23 B;  1ZIZ A;  3ZLK A;  5C36 A;  5C4C A;  1O0R A;  2PA4 A;  2YES A;  3USR A;  1S4O A;  1YP4 A;  4HO3 A;  2WEE A;  3SXG A;  2I7B A;  3U2V A;  1VH1 A;  4HO4 A;  2BO7 A;  3D5N A;  1G1L A;  1R80 A;  3FOQ A;  4KQL A;  2X65 A;  4IRP A;  3RSB A;  4R7P A;  3SXD A;  2W0W A;  1ZCV A;  5FU8 A;  3I0I X;  3CU0 A;  1ZJ1 A;  2OEG A;  4FRH A;  1TVY A;  1LZJ A;  4M4K A;  5FTS A;  2AH9 A;  1GX0 A;  5C1H A;  2YCM A;  5L6S A;  3V0Q A;  2JCJ A;  1H7Q A;  2BO6 A;  1ZCU A;  4B42 A;  1NF5 B;  4C2S A;  4D0Z A;  1IIN A;  2NXV A;  5C3A A;  3CKO A;  4FRP A;  5FTV A;  1XZ6 A;  1HM8 A;  2D7I A;  3SXA A;  3I0H A;  4KT7 A;  1HJJ A;  1GWW A;  2J0A A;  1H4E A;  1W57 A;  3ZGF A;  4FRM A;  1IIM A;  3EE5 A;  1R7X A;  3SX3 A;  1H5T B;  1MP4 A;  1G2V A;  3I0F A;  2Y7A A;  4HO0 A;  4HG6 A;  1V83 A;  4FCE A;  3CKJ A;  1NMM B;  4AAW A;  3U2U A;  3IOJ A;  1ON6 A;  2VSH A;  4MIX A;  3SX8 A;  4Y64 A;  5IDT A;  4CJB A;  2VK9 A;  1FO9 A;  1H5R A;  2YC3 A;  2QKX A;  1W77 A;  5AJO A;  4EEO A;  1INJ A;  1GX4 A;  2GGO A;  4AYL A;  2RJ5 A;  1WT3 A;  2OEF A;  4D48 A;  5I1F A;  1H5R B;  1VIC A;  4Q7C A;  5C48 A;  5DDT A;  2BO4 A;  3V91 A;  1H5S C;  4P02 A;  2ICX A;  5D92 A;  3RMV A;  2WAW A;  5EIY A;  2XMH A;  4G3S A;  1EYR A;  5CQN X;  1H4C A;  3U0Y A;  4D0T A;  1H7E A;  1QWJ A;  1G3L A;  1MC3 A;  5CQP A;  1LZI A;  2RJ6 A;  1R7Y A;  3PNN A;  4EVW A;  2FFV A;  1INI A;  3FWW A;  5CMI A;  4HO9 A;  1TW1 A;  3OKR A;  4B2X A;  3Q4S A;  2RIY A;  4JIS A;  4KNX A;  1ZHJ A;  3SXE A;  1FXJ A;  4HO6 A;  4CVH A;  4KC4 A;  4Y6N A;  4Y7G A;  4G87 A;  1LL2 A;  1PZY B;  4FCU A;  1ZCT A;  5FV9 A;  3V0P A;  5L6V A;  1ZI5 A;  2RJ7 A;  1G97 A;  3IOI A;  1ZJO A;  4HCQ A;  3V0O A;  1Z90 A;  4YS8 A;  2Y6P A;  2WVM A;  1HM0 A;  5CQM X;  3PKP A;  1ZJ2 A;  2WVK A;  1FGG A;  1WT0 A;  1V82 A;  3BRK X;  2OI7 A;  1MP3 A;  4AYJ A;  4Y7V A;  4ZDQ A;  4B2W A;  1VH3 A;  2VXM A;  1TW5 A;  1R82 A;  4EEA A;  4CJC A;  2VS4 A;  2AGD A;  2X5S A;  1XHB A;  1FXO A;  5FUH A;  3SXC A;  4P00 A;  4FRE A;  5IDS A;  4MYB A;  3PKQ A;  2FY7 A;  1NQI B;  3SXB A;  2ZU8 A;  1QG8 A;  2FYA A;  2O1F A;  4FRD A;  3E26 A;  2RIX A;  4O6M A;  1H7L A;  1LVW A;  3V90 A;  2Z86 A;  3T7O A;  4B4B A;  3I0K A;  5HS2 A;  1VZT A;  2W0V A;  1VGT A;  4KPX A;  1VGZ A;  4KC2 A;  2AM5 A;  5C3B A;  2YQH A;  3I0L A;  1H5T A;  2RJ8 A;  1R7V A;  4ASY A;  3I0C A;  1OMX A;  3QVB A;  1HM9 A;  3U2W A;  1GQC A;  4Y62 A;  2I5K A;  1KWS A;  1PZT A;  4IRQ A;  2AE7 A;  4FQW A;  1SS9 A;  4DE7 A;  1ZJP A;  3SX5 A;  4FIX A;  5CMF X;  2J0B A;  1G93 A;  1FR8 A;  2WVL A;  2O1H A;  4Y9X A;  2QGI A;  1S4P A;  2XWL A;  4O6N A;  5CQL X;  1FG5 N;  2CU2 A;  2RJ0 A;  2UX8 A;  3E25 A;  4LW3 A;  4FRB A;  2Y4L A;  1ZDF A;  4JD0 A;  3OGZ A;  4NAK A;  1TZF A;  1G9R A;  3Q7U A;  3OH3 A;  4EE5 A;  2O1G A;  3JUK A;  2X60 A;  1NHE B;  2APC A;  1YP2 A;  3K8D A;  1K4V A;  1O7Q A;  1QGQ A;  4Y7U A;  4ASJ A;  4MND A;  1GA8 A;  1O7O A;  3V0N A;  1VZX A;  1NKH B;  3CKV A;  3CKN A;  2Y4M A;  5C8R A;  3V8Z A;  5C4E A;  1GWV A;  2FFU A;  3Q80 A;  1I52 A;  2ZU9 A;  1FGX A;  2BO8 A;  2YQC A;  2QH5 A;  3TZT A;  1JVG A;  4B4G A;  3D8V A;  1G8O A;  1GQ9 A;  5DDV A;  4KRV A;  1H7H A;  2WGZ A;  4UEG A;  1H3M A;  3OH4 A;  4EEG A;  1VGW A;  5C49 A;  2VFZ A;  4M2B A;  1ZI4 A;  4B3U A;  1FRW A;  1LZ7 A;  4D11 A;  2AM4 A;  5C4D A;  3I0G A;  4CJ8 A;  2VSI A;  3U2T A;  3OAM A;  1OQM B;  3USQ A;  2PX7 A;  2YQJ A;  5C3D A;  3R3I A;  2GGQ A;  4NAI A;  5IFY A;  1E5K A;  3KIA A;  2XWM A;  2DPW A;  4E1K A;  4BMA A;  2JCO A;  3ZLL A;  1ZDG A;  4HO5 A;  3HL3 A;  2Z87 A;  1H5S D;  5FU0 A;  5CMJ A;  4G3Q A;  2I5E A;  1VPA A;  3SPT A;  2P72 A;  4FRO A;  1JYK A;  1VZU A;  2XME A;  5JQQ A;  2OI5 A;  2ZU7 A;  3TQD A;  4B4M A;  5C4F A;  4NAN A;  2VS3 A;  3OH0 A;  1MP5 A;  4Y63 A;  3JTJ A;  3ST8 A;  1FOA A;  1ON8 A;  4LW6 A;  5BXC A;  2P6W A;  2RIZ A;  2P73 A;  3V8Y A;  2AES A;  1W55 A;  2RIT A;  4BQH A;  3T7N A;  5EJ1 A;  2V0K A;  1HV9 A;  2AM3 A;  2FYD B;  4M28 A;  2X5Z A;  1WT2 A;  2VD4 A;  1HJL A;  1ZJ3 A;  2AEC A;  4KC1 A;  2MZB A;  4FRA A;  1FO8 A;  2Q4J A;  2RJ9 A;  2Y4J A;  3T7M A;  4M2A A;  3DUV A;  3OH2 A;  2RJ4 A;  4EE3 A;  2PGY A;  2YQS A;  4EE4 A;  4FRQ A;  2FYC B;  4HOC A;  2VS5 A;  5D91 A;  1WVC A;  5CMG X;  1FZW A;  1WSZ A;  1H7T A;  1R81 A;  2E3D A;  1NWG B;  3OC9 A;  4J18 A;  2V0L A;  3U0X A;  1OMZ A;  4Y7F A;  1FR9 A;  2JCK A;  1JYL A;  2E8B A;  3I0E A;  3DJ4 A;  1JVD A;  5C38 A;  1G0R A;  4FIY A;  1EZI A;  1S4N A;  2A8W A;  5J49 A;  1R7U A;  3K8E A;  4HO8 A;  4XWI A;  1ZI3 A;  1G95 A;  3V0M A;  4DDZ A;  3I0D A;  1G23 A;  2A8U A;  1YRO B;  2VXL A;  1ZI1 A;  1VM8 A;  2V0H A;  1VGU A;  5CMH A;  5FYE A;  5AJN A;  3N9W A;  5C1L A;  1ZJ0 A;  4KNR A;  2RJ1 A;  1H4D A;  4FRL A;  1QGS A;  1LZ0 A;  1H5S A;  2D7R A;  4ECM A;  2V0I A;  1LL0 A;  3F1Y A;  4AC3 A;  1JV3 A;  2WE9 A;  1LL3 A;  3GUE A;  2D0J A;  3LW6 A;  1H5S B;  3D98 A;  1YP3 A;  3JUJ A;  3SX7 A;  3U2X A;  4EEM A;  4Y7T A;  1WT1 A;  2Y4K A;  4KXO A;  2FYB A;  3ZGG A;  4NAL A;  2V0J A;  3OH1 A;  4ARW A;  4Y6U A;  3POL A;  1V84 A;  5EJZ A;  2JCL A;  5AJP A;  4L41 C;  2YC5 A;  4G3P A;  2C0N A;  3ZF8 A;  1H7F A;  4DEC A;  4B5B A;  2OI6 A;  4D11 C;  4KPZ A;  3RMW A;  5C4B A;  3F1C A;  3BCV A;  1H7G A; 
#chains in the Genus database with same CATH homology
 4HO2 A;  4K6R A;  2ICY A;  3R2W A;  5C1G A;  3NGW A;  3V0L A;  5CQO A;  1JV1 A;  3CKQ A;  3O3P A;  3DK5 A;  1R7T A;  3I0J A;  3IOH A;  3CGX A;  2XWN A;  4GBP A;  1FWY A;  1ZCY A;  2PGV A;  5C47 A;  1O23 B;  1ZIZ A;  3ZLK A;  5C36 A;  5C4C A;  1O0R A;  2PA4 A;  2YES A;  3USR A;  1S4O A;  1YP4 A;  4HO3 A;  2WEE A;  3SXG A;  2I7B A;  3U2V A;  1VH1 A;  4HO4 A;  2BO7 A;  3D5N A;  1G1L A;  1R80 A;  3FOQ A;  4KQL A;  2X65 A;  4IRP A;  3RSB A;  4R7P A;  3SXD A;  2W0W A;  1ZCV A;  5FU8 A;  3I0I X;  3CU0 A;  1ZJ1 A;  2OEG A;  4FRH A;  1TVY A;  1LZJ A;  4M4K A;  5FTS A;  2AH9 A;  1GX0 A;  5C1H A;  2YCM A;  5L6S A;  3V0Q A;  2JCJ A;  1H7Q A;  2BO6 A;  1ZCU A;  4B42 A;  1NF5 B;  4C2S A;  4D0Z A;  1IIN A;  2NXV A;  5C3A A;  3CKO A;  4FRP A;  5FTV A;  1XZ6 A;  1HM8 A;  2D7I A;  3SXA A;  3I0H A;  4KT7 A;  1HJJ A;  1GWW A;  2J0A A;  1H4E A;  1W57 A;  3ZGF A;  4FRM A;  1IIM A;  3EE5 A;  1R7X A;  3SX3 A;  1H5T B;  1MP4 A;  1G2V A;  3I0F A;  2Y7A A;  4HO0 A;  4HG6 A;  1V83 A;  4FCE A;  3CKJ A;  1NMM B;  4AAW A;  3U2U A;  3IOJ A;  1ON6 A;  2VSH A;  4MIX A;  3SX8 A;  4Y64 A;  5IDT A;  4CJB A;  2VK9 A;  1FO9 A;  1H5R A;  2YC3 A;  2QKX A;  1W77 A;  5AJO A;  4EEO A;  1INJ A;  1GX4 A;  2GGO A;  4AYL A;  2RJ5 A;  1WT3 A;  2OEF A;  4D48 A;  5I1F A;  1H5R B;  1VIC A;  4Q7C A;  5C48 A;  5DDT A;  2BO4 A;  3V91 A;  1H5S C;  4P02 A;  2ICX A;  5D92 A;  3RMV A;  2WAW A;  5EIY A;  2XMH A;  4G3S A;  1EYR A;  5CQN X;  1H4C A;  3U0Y A;  4D0T A;  1H7E A;  1QWJ A;  1G3L A;  1MC3 A;  5CQP A;  1LZI A;  2RJ6 A;  1R7Y A;  3PNN A;  4EVW A;  2FFV A;  1INI A;  3FWW A;  5CMI A;  4HO9 A;  1TW1 A;  3OKR A;  4B2X A;  3Q4S A;  2RIY A;  4JIS A;  4KNX A;  1ZHJ A;  3SXE A;  1FXJ A;  4HO6 A;  4CVH A;  4KC4 A;  4Y6N A;  4Y7G A;  4G87 A;  1LL2 A;  1PZY B;  4FCU A;  1ZCT A;  5FV9 A;  3V0P A;  5L6V A;  1ZI5 A;  2RJ7 A;  1G97 A;  3IOI A;  1ZJO A;  4HCQ A;  3V0O A;  1Z90 A;  4YS8 A;  2Y6P A;  2WVM A;  1HM0 A;  5CQM X;  3PKP A;  1ZJ2 A;  2WVK A;  1FGG A;  1WT0 A;  1V82 A;  3BRK X;  2OI7 A;  1MP3 A;  4AYJ A;  4Y7V A;  4ZDQ A;  4B2W A;  1VH3 A;  2VXM A;  1TW5 A;  1R82 A;  4EEA A;  4CJC A;  2VS4 A;  2AGD A;  2X5S A;  1XHB A;  1FXO A;  5FUH A;  3SXC A;  4P00 A;  4FRE A;  5IDS A;  4MYB A;  3PKQ A;  2FY7 A;  1NQI B;  3SXB A;  2ZU8 A;  1QG8 A;  2FYA A;  2O1F A;  4FRD A;  3E26 A;  2RIX A;  4O6M A;  1H7L A;  1LVW A;  3V90 A;  2Z86 A;  3T7O A;  4B4B A;  3I0K A;  5HS2 A;  1VZT A;  2W0V A;  1VGT A;  4KPX A;  1VGZ A;  4KC2 A;  2AM5 A;  5C3B A;  2YQH A;  3I0L A;  1H5T A;  2RJ8 A;  1R7V A;  4ASY A;  3I0C A;  1OMX A;  3QVB A;  1HM9 A;  3U2W A;  1GQC A;  4Y62 A;  2I5K A;  1KWS A;  1PZT A;  4IRQ A;  2AE7 A;  4FQW A;  1SS9 A;  4DE7 A;  1ZJP A;  3SX5 A;  4FIX A;  5CMF X;  2J0B A;  1G93 A;  1FR8 A;  2WVL A;  2O1H A;  4Y9X A;  2QGI A;  1S4P A;  2XWL A;  4O6N A;  5CQL X;  1FG5 N;  2CU2 A;  2RJ0 A;  2UX8 A;  3E25 A;  4LW3 A;  4FRB A;  2Y4L A;  1ZDF A;  4JD0 A;  3OGZ A;  4NAK A;  1TZF A;  1G9R A;  3Q7U A;  3OH3 A;  4EE5 A;  2O1G A;  3JUK A;  2X60 A;  1NHE B;  2APC A;  1YP2 A;  3K8D A;  1K4V A;  1O7Q A;  1QGQ A;  4Y7U A;  4ASJ A;  4MND A;  1GA8 A;  1O7O A;  3V0N A;  1VZX A;  1NKH B;  3CKV A;  3CKN A;  2Y4M A;  5C8R A;  3V8Z A;  5C4E A;  1GWV A;  2FFU A;  3Q80 A;  1I52 A;  2ZU9 A;  1FGX A;  2BO8 A;  2YQC A;  2QH5 A;  3TZT A;  1JVG A;  4B4G A;  3D8V A;  1G8O A;  1GQ9 A;  5DDV A;  4KRV A;  1H7H A;  2WGZ A;  4UEG A;  1H3M A;  3OH4 A;  4EEG A;  1VGW A;  5C49 A;  2VFZ A;  4M2B A;  1ZI4 A;  4B3U A;  1FRW A;  1LZ7 A;  4D11 A;  2AM4 A;  5C4D A;  3I0G A;  4CJ8 A;  2VSI A;  3U2T A;  3OAM A;  1OQM B;  3USQ A;  2PX7 A;  2YQJ A;  5C3D A;  3R3I A;  2GGQ A;  4NAI A;  5IFY A;  1E5K A;  3KIA A;  2XWM A;  2DPW A;  4E1K A;  4BMA A;  2JCO A;  3ZLL A;  1ZDG A;  4HO5 A;  3HL3 A;  2Z87 A;  1H5S D;  5FU0 A;  5CMJ A;  4G3Q A;  2I5E A;  1VPA A;  3SPT A;  2P72 A;  4FRO A;  1JYK A;  1VZU A;  2XME A;  5JQQ A;  2OI5 A;  2ZU7 A;  3TQD A;  4B4M A;  5C4F A;  4NAN A;  2VS3 A;  3OH0 A;  1MP5 A;  4Y63 A;  3JTJ A;  3ST8 A;  1FOA A;  1ON8 A;  4LW6 A;  5BXC A;  2P6W A;  2RIZ A;  2P73 A;  3V8Y A;  2AES A;  1W55 A;  2RIT A;  4BQH A;  3T7N A;  5EJ1 A;  2V0K A;  1HV9 A;  2AM3 A;  2FYD B;  4M28 A;  2X5Z A;  1WT2 A;  2VD4 A;  1HJL A;  1ZJ3 A;  2AEC A;  4KC1 A;  2MZB A;  4FRA A;  1FO8 A;  2Q4J A;  2RJ9 A;  2Y4J A;  3T7M A;  4M2A A;  3DUV A;  3OH2 A;  2RJ4 A;  4EE3 A;  2PGY A;  2YQS A;  4EE4 A;  4FRQ A;  2FYC B;  4HOC A;  2VS5 A;  5D91 A;  1WVC A;  5CMG X;  1FZW A;  1WSZ A;  1H7T A;  1R81 A;  2E3D A;  1NWG B;  3OC9 A;  4J18 A;  2V0L A;  3U0X A;  1OMZ A;  4Y7F A;  1FR9 A;  2JCK A;  1JYL A;  2E8B A;  3I0E A;  3DJ4 A;  1JVD A;  5C38 A;  1G0R A;  4FIY A;  1EZI A;  1S4N A;  2A8W A;  5J49 A;  1R7U A;  3K8E A;  4HO8 A;  4XWI A;  1ZI3 A;  1G95 A;  3V0M A;  4DDZ A;  3I0D A;  1G23 A;  2A8U A;  1YRO B;  2VXL A;  1ZI1 A;  1VM8 A;  2V0H A;  1VGU A;  5CMH A;  5FYE A;  5AJN A;  3N9W A;  5C1L A;  1ZJ0 A;  4KNR A;  2RJ1 A;  1H4D A;  4FRL A;  1QGS A;  1LZ0 A;  1H5S A;  2D7R A;  4ECM A;  2V0I A;  1LL0 A;  3F1Y A;  4AC3 A;  1JV3 A;  2WE9 A;  1LL3 A;  3GUE A;  2D0J A;  3LW6 A;  1H5S B;  3D98 A;  1YP3 A;  3JUJ A;  3SX7 A;  3U2X A;  4EEM A;  4Y7T A;  1WT1 A;  2Y4K A;  4KXO A;  2FYB A;  3ZGG A;  4NAL A;  2V0J A;  3OH1 A;  4ARW A;  4Y6U A;  3POL A;  1V84 A;  5EJZ A;  2JCL A;  5AJP A;  4L41 C;  2YC5 A;  4G3P A;  2C0N A;  3ZF8 A;  1H7F A;  4DEC A;  4B5B A;  2OI6 A;  4D11 C;  4KPZ A;  3RMW A;  5C4B A;  3F1C A;  3BCV A;  1H7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...