1G1LA

The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). tdp-glucose complex.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
292
structure length
292
Chain Sequence
KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (RmlA).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 98
structure length 292
sequence length 292
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2000-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g1lA00
1GQ9A 1ZIZA 3LW6A 1H7GA 2V0HA 4KC2A 4ASYA 4CJ8A 4FCUA 1ZJ1A 3SXBA 5C1GA 2A8WA 2E3DA 2Y6PA 4HO0A 1NKHB 1FGGA 1MC3A 2VSHA 2AGDA 3T7NA 3ZGFA 1H7TA 3ST8A 2AM3A 2GGOA 1VGUA 1YP3A 3SXCA 1W57A 1GWWA 2D7IA 2Z86A 4HCQA 1ON8A 1YROB 5FUHA 2ZU8A 1FWYA 1TW5A 5EJZA 4BMAA 3U2UA 2JCKA 5JQQA 3SX5A 4Y9XA 3U0XA 1NQIB 3GUEA 4KQLA 5CQOA 5C3DA 3CGXA 1VGZA 2APCA 4LW3A 1H5TB 1JV1A 3BCVA 3POLA 3U2VA 4AC3A 2AE7A 4G87A 3OH2A 4LW6A 1V82A 3F1YA 1HV9A 1QGSA 1H5RB 1ZDGA 1O7OA 3I0LA 1H4CA 5HS2A 2XWLA 4EEGA 4HO5A 2V0IA 2RJ5A 3I0FA 3RSBA 4IRPA 1H7FA 2YESA 4FRMA 5C47A 4FRLA 1FG5N 5C4BA 1E5KA 4EE5A 1I52A 5DDTA 1O0RA 4G3QA 4Y62A 1G95A 1ZJOA 1H5TA 1V84A 4P00A 1H5SD 2RJ6A 4B5BA 2FYAA 4FRAA 5C48A 1GQCA 1JVGA 1H4EA 1S4PA 1INJA 2GGQA 4Y63A 1ON6A 1H5RA 3O3PA 1G0RA 3IOHA 5AJPA 3I0GA 2D7RA 4KPZA 1GX0A 4Y64A 2YCMA 5L6VA 1MP4A 3RMWA 5C8RA 1NWGB 2FFVA 5I1FA 2XMEA 1FXJA 1R81A 4XWIA 3I0IX 2OI7A 1H5SC 1VGWA 1ZI5A 4IRQA 4M28A 1W77A 4NAKA 4EEOA 4J18A 2A8UA 4CJBA 4JISA 5C3AA 1FZWA 3PKPA 3F1CA 3V0PA 5CMGX 4FCEA 1IIMA 1FR8A 3OAMA 2AECA 3PKQA 2XWMA 2RJ4A 1VZTA 3TZTA 1ZI1A 1SS9A 1S4NA 2CU2A 4G3SA 5L6SA 5C38A 1G8OA 2VS5A 4Y7TA 1WVCA 2OEFA 3CKVA 1NHEB 1GA8A 1KWSA 2FYCB 2OI5A 1JV3A 5C1HA 2O1FA 5C4DA 4FRDA 1G1LA 2Y4LA 3D8VA 3I0EA 4MYBA 5FU0A 1EZIA 1TZFA 2YQCA 1HM9A 5C36A 2AM4A 3I0JA 5FV9A 2I7BA 4EVWA 2Z87A 4Y7GA 3V0OA 3CKJA 4KXOA 1FO8A 1WSZA 4G3PA 2W0WA 2RIZA 1LVWA 1WT3A 2MZBA 5IDTA 5CMFX 5CQNX 4ARWA 2UX8A 1ZCUA 1WT2A 4KNXA 2Y4MA 4B2WA 3I0CA 3OGZA 1R7VA 4DDZA 1JYKA 3USQA 1H7QA 3OH1A 3U2XA 1VZXA 3K8DA 4UEGA 3JUKA 1R82A 4YS8A 4FRPA 4M4KA 2V0LA 4D11C 1OMXA 4FRBA 3SX3A 3JTJA 3DUVA 1H5SA 3I0KA 2VD4A 2VXMA 2XWNA 1NMMB 4B3UA 3V8YA 2YQHA 3U2WA 1G97A 3ZGGA 1G23A 3SXDA 5FTSA 2FYBA 1ZJ0A 4FRHA 1VH1A 2AH9A 4EEMA 2BO7A 1ZI4A 4L41C 5J49A 1FO9A 4HG6A 5FYEA 4Y7VA 3V90A 2I5EA 3K8EA 3R2WA 2Y7AA 4B4BA 4AAWA 4ECMA 4CJCA 1WT0A 1R7UA 4HO6A 4NANA 5CQLX 5EJ1A 5CQPA 4E1KA 2XMHA 2RJ7A 4D0ZA 3SPTA 5AJOA 1VH3A 4R7PA 3T7MA 5C1LA 1GX4A 2FFUA 1S4OA 3N9WA 5DDVA 1PZTA 3V0QA 4B4GA 3OKRA 3CKNA 1OQMB 3D5NA 3I0DA 2RIXA 3Q4SA 2X5SA 4KT7A 3CKOA 4MNDA 1G9RA 1OMZA 3FWWA 1LZ0A 2PGVA 3V91A 2Q4JA 1IINA 4P02A 3RMVA 4DECA 5C3BA 2RJ9A 3JUJA 4GBPA 3QVBA 2O1HA 5CQMX 1VPAA 3EE5A 1ZJ2A 3KIAA 1MP5A 3USRA 4ASJA 1YP2A 1LZJA 2BO4A 2QH5A 3NGWA 5FU8A 5IFYA 1G93A 2VSIA 4KRVA 5CMJA 4KC1A 3SXGA 2RIYA 3Q80A 2YQSA 2ZU9A 2WVMA 4Y6NA 3OH4A 3I0HA 1WT1A 2WEEA 1VGTA 1GWVA 1O7QA 2JCJA 2NXVA 3E25A 3IOJA 2ZU7A 2ICXA 1LL3A 1H5SB 1XHBA 2Y4JA 3SXAA 1H7EA 1LL2A 1EYRA 2RJ1A 1TW1A 1H4DA 2P6WA 1HJJA 3SX7A 5C4EA 2PA4A 1ZDFA 1R7TA 1XZ6A 1HJLA 1ZCTA 2V0KA 2YQJA 1VICA 3E26A 2AESA 2RJ8A 4B42A 1FXOA 2FYDB 1Z90A 4Y7UA 1H3MA 1VZUA 5IDSA 4FREA 2VFZA 4B2XA 5AJNA 2PGYA 1ZHJA 4HOCA 3ZLKA 2E8BA 2P73A 1QGQA 2JCOA 5C49A 4NALA 4KPXA 1W55A 2BO8A 2DPWA 3U2TA 4NAIA 2I5KA 4FRQA 1JYLA 2P72A 4Y7FA 5FTVA 3OH3A 3V0LA 5BXCA 3V0MA 4EE3A 4D48A 1QG8A 2FY7A 1R7XA 2VS4A 1TVYA 4KNRA 1LZ7A 3PNNA 4JD0A 2JCLA 3V0NA 1FRWA 4M2BA 4ZDQA 3SX8A 1ZCVA 2O1GA 3TQDA 2X60A 1R80A 3ZLLA 2V0JA 3IOIA 1PZYB 1O23B 2YC3A 1ZJ3A 2D0JA 2OEGA 3U0YA 4BQHA 2OI6A 3DK5A 3HL3A 1HM0A 4AYJA 2AM5A 2WGZA 3DJ4A 2RITA 4CVHA 2QKXA 2WVLA 4M2AA 4HO9A 1H7LA 5EIYA 2QGIA 4FQWA 4D0TA 4EEAA 2PX7A 2X65A 1V83A 1G3LA 1G2VA 1ZJPA 1R7YA 1VM8A 1YP4A 4FROA 1QWJA 2VXLA 2Y4KA 5C4CA 2W0VA 3T7OA 1FR9A 2RJ0A 2YC5A 4HO3A 4C2SA 4HO8A 1FOAA 1K4VA 3Q7UA 3V8ZA 3FOQA 5C4FA 2BO6A 3CU0A 4KC4A 1FGXA 4HO2A 2WVKA 3OC9A 1NF5B 4Y6UA 4B4MA 1LZIA 1ZCYA 2VS3A 2WAWA 5CMIA 4D11A 4DE7A 5CMHA 1LL0A 4EE4A 4HO4A 3R3IA 3SXEA 2WE9A 1INIA 1H7HA 3ZF8A 1JVDA 4K6RA 3D98A 3OH0A 4AYLA 3CKQA 3BRKX 1ZI3A 1HM8A 1MP3A 2ICYA 2X5ZA
chains in the Genus database with same CATH superfamily
1GQ9A 1ZIZA 3LW6A 1H7GA 2V0HA 4KC2A 4ASYA 4CJ8A 4FCUA 1ZJ1A 3SXBA 5C1GA 2A8WA 2E3DA 2Y6PA 4HO0A 1NKHB 1FGGA 1MC3A 2VSHA 2AGDA 3T7NA 3ZGFA 1H7TA 3ST8A 2AM3A 2GGOA 1VGUA 1YP3A 3SXCA 1W57A 1GWWA 2D7IA 2Z86A 4HCQA 1ON8A 1YROB 5FUHA 2ZU8A 1FWYA 1TW5A 5EJZA 4BMAA 3U2UA 2JCKA 5JQQA 3SX5A 4Y9XA 3U0XA 1NQIB 3GUEA 4KQLA 5CQOA 5C3DA 3CGXA 1VGZA 2APCA 4LW3A 1H5TB 1JV1A 3BCVA 3POLA 3U2VA 4AC3A 2AE7A 4G87A 3OH2A 4LW6A 1V82A 3F1YA 1HV9A 1QGSA 1H5RB 1ZDGA 1O7OA 3I0LA 1H4CA 5HS2A 2XWLA 4EEGA 4HO5A 2V0IA 4Q7CA 2RJ5A 3I0FA 3RSBA 4IRPA 1H7FA 2YESA 4FRMA 5C47A 4FRLA 1FG5N 5C4BA 1E5KA 4EE5A 1I52A 5DDTA 1O0RA 4G3QA 4Y62A 1G95A 1ZJOA 1H5TA 1V84A 4P00A 1H5SD 2RJ6A 4B5BA 2FYAA 4FRAA 5C48A 1GQCA 1JVGA 1H4EA 1S4PA 1INJA 2GGQA 4Y63A 1ON6A 1H5RA 3O3PA 1G0RA 3IOHA 2J0BA 5AJPA 3I0GA 2D7RA 4KPZA 1GX0A 4Y64A 2YCMA 5L6VA 1MP4A 3RMWA 5C8RA 1NWGB 2FFVA 5I1FA 2XMEA 1FXJA 1R81A 4XWIA 3I0IX 2OI7A 1H5SC 1VGWA 1ZI5A 4IRQA 4M28A 1W77A 4NAKA 4EEOA 4J18A 2A8UA 4CJBA 4JISA 5C3AA 1FZWA 3PKPA 3F1CA 3V0PA 5CMGX 4FCEA 1IIMA 1FR8A 3OAMA 2AECA 3PKQA 2XWMA 4MIXA 2RJ4A 1VZTA 3TZTA 1ZI1A 1SS9A 1S4NA 2CU2A 4G3SA 5L6SA 5C38A 1G8OA 2VS5A 4Y7TA 1WVCA 2OEFA 3CKVA 1NHEB 1GA8A 1KWSA 2FYCB 2OI5A 1JV3A 5C1HA 2O1FA 5C4DA 4FRDA 1G1LA 2Y4LA 3D8VA 3I0EA 4MYBA 5FU0A 1EZIA 1TZFA 2YQCA 1HM9A 5C36A 2AM4A 3I0JA 5FV9A 2I7BA 4EVWA 2Z87A 4Y7GA 3V0OA 3CKJA 4KXOA 1FO8A 2C0NA 1WSZA 4G3PA 2W0WA 2RIZA 4O6NA 1LVWA 1WT3A 2MZBA 5IDTA 5CMFX 5CQNX 4ARWA 2UX8A 1ZCUA 1WT2A 4KNXA 2Y4MA 4B2WA 3I0CA 3OGZA 1R7VA 4DDZA 1JYKA 3USQA 1H7QA 3OH1A 3U2XA 1VZXA 3K8DA 4UEGA 3JUKA 1R82A 4YS8A 4FRPA 4M4KA 2V0LA 4D11C 1OMXA 4FRBA 3SX3A 3JTJA 3DUVA 1H5SA 3I0KA 2VD4A 2VXMA 2XWNA 1NMMB 4B3UA 3V8YA 2YQHA 3U2WA 1G97A 3ZGGA 1G23A 3SXDA 5FTSA 2FYBA 1ZJ0A 4FRHA 1VH1A 2AH9A 4EEMA 2BO7A 1ZI4A 4L41C 5J49A 1FO9A 4HG6A 2J0AA 5FYEA 4Y7VA 3V90A 2I5EA 3K8EA 3R2WA 2Y7AA 4B4BA 4AAWA 4ECMA 4CJCA 1WT0A 1R7UA 2VK9A 4HO6A 4NANA 5CQLX 5EJ1A 5CQPA 4E1KA 2XMHA 2RJ7A 4D0ZA 3SPTA 5AJOA 1VH3A 4R7PA 3T7MA 5C1LA 1GX4A 2FFUA 1S4OA 3N9WA 5DDVA 1PZTA 3V0QA 4B4GA 3OKRA 3CKNA 1OQMB 3D5NA 3I0DA 2RIXA 3Q4SA 2X5SA 4KT7A 3CKOA 4MNDA 1G9RA 1OMZA 3FWWA 1LZ0A 2PGVA 3V91A 2Q4JA 1IINA 4P02A 3RMVA 4DECA 5C3BA 2RJ9A 3JUJA 4GBPA 3QVBA 2O1HA 5CQMX 1VPAA 3EE5A 1ZJ2A 3KIAA 1MP5A 3USRA 4ASJA 1YP2A 1LZJA 2BO4A 2QH5A 3NGWA 5FU8A 5IFYA 1G93A 2VSIA 4KRVA 5CMJA 4KC1A 3SXGA 2RIYA 3Q80A 2YQSA 2ZU9A 2WVMA 4Y6NA 3OH4A 3I0HA 1WT1A 2WEEA 1VGTA 1GWVA 1O7QA 2JCJA 2NXVA 3E25A 3IOJA 2ZU7A 2ICXA 1LL3A 1H5SB 1XHBA 2Y4JA 3SXAA 1H7EA 4FIYA 1LL2A 1EYRA 2RJ1A 1TW1A 1H4DA 2P6WA 1HJJA 3SX7A 5C4EA 2PA4A 1ZDFA 1R7TA 1XZ6A 1HJLA 1ZCTA 2V0KA 2YQJA 1VICA 3E26A 2AESA 2RJ8A 4B42A 1FXOA 2FYDB 1Z90A 4Y7UA 1H3MA 1VZUA 5IDSA 4FREA 2VFZA 4B2XA 5AJNA 2PGYA 1ZHJA 4HOCA 3ZLKA 2E8BA 2P73A 1QGQA 2JCOA 5C49A 4NALA 4KPXA 1W55A 2BO8A 2DPWA 3U2TA 4NAIA 2I5KA 4FRQA 1JYLA 2P72A 4Y7FA 5FTVA 3OH3A 3V0LA 5BXCA 3V0MA 4EE3A 4D48A 1QG8A 2FY7A 1R7XA 2VS4A 1TVYA 4KNRA 1LZ7A 3PNNA 4JD0A 2JCLA 3V0NA 1FRWA 4M2BA 4ZDQA 3SX8A 1ZCVA 2O1GA 3TQDA 2X60A 1R80A 3ZLLA 2V0JA 3IOIA 1PZYB 1O23B 2YC3A 1ZJ3A 2D0JA 2OEGA 3U0YA 4BQHA 2OI6A 3DK5A 3HL3A 1HM0A 4AYJA 2AM5A 2WGZA 3DJ4A 2RITA 4CVHA 2QKXA 2WVLA 4M2AA 4HO9A 1H7LA 5EIYA 2QGIA 4FQWA 4D0TA 4EEAA 2PX7A 2X65A 1V83A 1G3LA 1G2VA 1ZJPA 1R7YA 4O6MA 1VM8A 1YP4A 4FROA 1QWJA 2VXLA 2Y4KA 5C4CA 2W0VA 3T7OA 1FR9A 2RJ0A 2YC5A 4HO3A 4C2SA 4HO8A 1FOAA 1K4VA 3Q7UA 3V8ZA 3FOQA 5D92A 5C4FA 2BO6A 3CU0A 4KC4A 1FGXA 4FIXA 4HO2A 2WVKA 3OC9A 1NF5B 4Y6UA 4B4MA 1LZIA 1ZCYA 2VS3A 2WAWA 5CMIA 4D11A 4DE7A 5CMHA 1LL0A 4EE4A 4HO4A 3R3IA 3SXEA 2WE9A 1INIA 1H7HA 3ZF8A 5D91A 1JVDA 4K6RA 3D98A 3OH0A 4AYLA 3CKQA 3BRKX 1ZI3A 1HM8A 1MP3A 2ICYA 2X5ZA
chains in the Genus database with same CATH topology
1GQ9A 1ZIZA 3LW6A 1H7GA 2V0HA 4KC2A 4ASYA 4CJ8A 4FCUA 1ZJ1A 3SXBA 5C1GA 2A8WA 2E3DA 2Y6PA 4HO0A 1NKHB 1FGGA 1MC3A 2VSHA 2AGDA 3T7NA 3ZGFA 1H7TA 3ST8A 2AM3A 2GGOA 1VGUA 1YP3A 3SXCA 1W57A 1GWWA 2D7IA 2Z86A 4HCQA 1ON8A 1YROB 5FUHA 2ZU8A 1FWYA 1TW5A 5EJZA 4BMAA 3U2UA 2JCKA 5JQQA 3SX5A 4Y9XA 3U0XA 1NQIB 3GUEA 4KQLA 5CQOA 5C3DA 3CGXA 1VGZA 2APCA 4LW3A 1H5TB 1JV1A 3BCVA 3POLA 3U2VA 4AC3A 2AE7A 4G87A 3OH2A 4LW6A 1V82A 3F1YA 1HV9A 1QGSA 1H5RB 1ZDGA 1O7OA 3I0LA 1H4CA 5HS2A 2XWLA 4EEGA 4HO5A 2V0IA 4Q7CA 2RJ5A 3I0FA 3RSBA 4IRPA 1H7FA 2YESA 4FRMA 5C47A 4FRLA 1FG5N 5C4BA 1E5KA 4EE5A 1I52A 5DDTA 1O0RA 4G3QA 4Y62A 1G95A 1ZJOA 1H5TA 1V84A 4P00A 1H5SD 2RJ6A 4B5BA 2FYAA 4FRAA 5C48A 1GQCA 1JVGA 1H4EA 1S4PA 1INJA 2GGQA 4Y63A 1ON6A 1H5RA 3O3PA 1G0RA 3IOHA 2J0BA 5AJPA 3I0GA 2D7RA 4KPZA 1GX0A 4Y64A 2YCMA 5L6VA 1MP4A 3RMWA 5C8RA 1NWGB 2FFVA 5I1FA 2XMEA 1FXJA 1R81A 4XWIA 3I0IX 2OI7A 1H5SC 1VGWA 1ZI5A 4IRQA 4M28A 1W77A 4NAKA 4EEOA 4J18A 2A8UA 4CJBA 4JISA 5C3AA 1FZWA 3PKPA 3F1CA 3V0PA 5CMGX 4FCEA 1IIMA 1FR8A 3OAMA 2AECA 3PKQA 2XWMA 4MIXA 2RJ4A 1VZTA 3TZTA 1ZI1A 1SS9A 1S4NA 2CU2A 4G3SA 5L6SA 5C38A 1G8OA 2VS5A 4Y7TA 1WVCA 2OEFA 3CKVA 1NHEB 1GA8A 1KWSA 2FYCB 2OI5A 1JV3A 5C1HA 2O1FA 5C4DA 4FRDA 1G1LA 2Y4LA 3D8VA 3I0EA 4MYBA 5FU0A 1EZIA 1TZFA 2YQCA 1HM9A 5C36A 2AM4A 3I0JA 5FV9A 2I7BA 4EVWA 2Z87A 4Y7GA 3V0OA 3CKJA 4KXOA 1FO8A 2C0NA 1WSZA 4G3PA 2W0WA 2RIZA 4O6NA 1LVWA 1WT3A 2MZBA 5IDTA 5CMFX 5CQNX 4ARWA 2UX8A 1ZCUA 1WT2A 4KNXA 2Y4MA 4B2WA 3I0CA 3OGZA 1R7VA 4DDZA 1JYKA 3USQA 1H7QA 3OH1A 3U2XA 1VZXA 3K8DA 4UEGA 3JUKA 1R82A 4YS8A 4FRPA 4M4KA 2V0LA 4D11C 1OMXA 4FRBA 3SX3A 3JTJA 3DUVA 1H5SA 3I0KA 2VD4A 2VXMA 2XWNA 1NMMB 4B3UA 3V8YA 2YQHA 3U2WA 1G97A 3ZGGA 1G23A 3SXDA 5FTSA 2FYBA 1ZJ0A 4FRHA 1VH1A 2AH9A 4EEMA 2BO7A 1ZI4A 4L41C 5J49A 1FO9A 4HG6A 2J0AA 5FYEA 4Y7VA 3V90A 2I5EA 3K8EA 3R2WA 2Y7AA 4B4BA 4AAWA 4ECMA 4CJCA 1WT0A 1R7UA 2VK9A 4HO6A 4NANA 5CQLX 5EJ1A 5CQPA 4E1KA 2XMHA 2RJ7A 4D0ZA 3SPTA 5AJOA 1VH3A 4R7PA 3T7MA 5C1LA 1GX4A 2FFUA 1S4OA 3N9WA 5DDVA 1PZTA 3V0QA 4B4GA 3OKRA 3CKNA 1OQMB 3D5NA 3I0DA 2RIXA 3Q4SA 2X5SA 4KT7A 3CKOA 4MNDA 1G9RA 1OMZA 3FWWA 1LZ0A 2PGVA 3V91A 2Q4JA 1IINA 4P02A 3RMVA 4DECA 5C3BA 2RJ9A 3JUJA 4GBPA 3QVBA 2O1HA 5CQMX 1VPAA 3EE5A 1ZJ2A 3KIAA 1MP5A 3USRA 4ASJA 1YP2A 1LZJA 2BO4A 2QH5A 3NGWA 5FU8A 5IFYA 1G93A 2VSIA 4KRVA 5CMJA 4KC1A 3SXGA 2RIYA 3Q80A 2YQSA 2ZU9A 2WVMA 4Y6NA 3OH4A 3I0HA 1WT1A 2WEEA 1VGTA 1GWVA 1O7QA 2JCJA 2NXVA 3E25A 3IOJA 2ZU7A 2ICXA 1LL3A 1H5SB 1XHBA 2Y4JA 3SXAA 1H7EA 4FIYA 1LL2A 1EYRA 2RJ1A 1TW1A 1H4DA 2P6WA 1HJJA 3SX7A 5C4EA 2PA4A 1ZDFA 1R7TA 1XZ6A 1HJLA 1ZCTA 2V0KA 2YQJA 1VICA 3E26A 2AESA 2RJ8A 4B42A 1FXOA 2FYDB 1Z90A 4Y7UA 1H3MA 1VZUA 5IDSA 4FREA 2VFZA 4B2XA 5AJNA 2PGYA 1ZHJA 4HOCA 3ZLKA 2E8BA 2P73A 1QGQA 2JCOA 5C49A 4NALA 4KPXA 1W55A 2BO8A 2DPWA 3U2TA 4NAIA 2I5KA 4FRQA 1JYLA 2P72A 4Y7FA 5FTVA 3OH3A 3V0LA 5BXCA 3V0MA 4EE3A 4D48A 1QG8A 2FY7A 1R7XA 2VS4A 1TVYA 4KNRA 1LZ7A 3PNNA 4JD0A 2JCLA 3V0NA 1FRWA 4M2BA 4ZDQA 3SX8A 1ZCVA 2O1GA 3TQDA 2X60A 1R80A 3ZLLA 2V0JA 3IOIA 1PZYB 1O23B 2YC3A 1ZJ3A 2D0JA 2OEGA 3U0YA 4BQHA 2OI6A 3DK5A 3HL3A 1HM0A 4AYJA 2AM5A 2WGZA 3DJ4A 2RITA 4CVHA 2QKXA 2WVLA 4M2AA 4HO9A 1H7LA 5EIYA 2QGIA 4FQWA 4D0TA 4EEAA 2PX7A 2X65A 1V83A 1G3LA 1G2VA 1ZJPA 1R7YA 4O6MA 1VM8A 1YP4A 4FROA 1QWJA 2VXLA 2Y4KA 5C4CA 2W0VA 3T7OA 1FR9A 2RJ0A 2YC5A 4HO3A 4C2SA 4HO8A 1FOAA 1K4VA 3Q7UA 3V8ZA 3FOQA 5D92A 5C4FA 2BO6A 3CU0A 4KC4A 1FGXA 4FIXA 4HO2A 2WVKA 3OC9A 1NF5B 4Y6UA 4B4MA 1LZIA 1ZCYA 2VS3A 2WAWA 5CMIA 4D11A 4DE7A 5CMHA 1LL0A 4EE4A 4HO4A 3R3IA 3SXEA 2WE9A 1INIA 1H7HA 3ZF8A 5D91A 1JVDA 4K6RA 3D98A 3OH0A 4AYLA 3CKQA 3BRKX 1ZI3A 1HM8A 1MP3A 2ICYA 2X5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQ9 A;  1ZIZ A;  3LW6 A;  1H7G A;  2V0H A;  4KC2 A;  4ASY A;  4CJ8 A;  4FCU A;  1ZJ1 A;  3SXB A;  5C1G A;  2A8W A;  2E3D A;  2Y6P A;  4HO0 A;  1NKH B;  1FGG A;  1MC3 A;  2VSH A;  2AGD A;  3T7N A;  3ZGF A;  1H7T A;  3ST8 A;  2AM3 A;  2GGO A;  1VGU A;  1YP3 A;  3SXC A;  1W57 A;  1GWW A;  2D7I A;  2Z86 A;  4HCQ A;  1ON8 A;  1YRO B;  5FUH A;  2ZU8 A;  1FWY A;  1TW5 A;  5EJZ A;  4BMA A;  3U2U A;  2JCK A;  5JQQ A;  3SX5 A;  4Y9X A;  3U0X A;  1NQI B;  3GUE A;  4KQL A;  5CQO A;  5C3D A;  3CGX A;  1VGZ A;  2APC A;  4LW3 A;  1H5T B;  1JV1 A;  3BCV A;  3POL A;  3U2V A;  4AC3 A;  2AE7 A;  4G87 A;  3OH2 A;  4LW6 A;  1V82 A;  3F1Y A;  1HV9 A;  1QGS A;  1H5R B;  1ZDG A;  1O7O A;  3I0L A;  1H4C A;  5HS2 A;  2XWL A;  4EEG A;  4HO5 A;  2V0I A;  2RJ5 A;  3I0F A;  3RSB A;  4IRP A;  1H7F A;  2YES A;  4FRM A;  5C47 A;  4FRL A;  1FG5 N;  5C4B A;  1E5K A;  4EE5 A;  1I52 A;  5DDT A;  1O0R A;  4G3Q A;  4Y62 A;  1G95 A;  1ZJO A;  1H5T A;  1V84 A;  4P00 A;  1H5S D;  2RJ6 A;  4B5B A;  2FYA A;  4FRA A;  5C48 A;  1GQC A;  1JVG A;  1H4E A;  1S4P A;  1INJ A;  2GGQ A;  4Y63 A;  1ON6 A;  1H5R A;  3O3P A;  1G0R A;  3IOH A;  5AJP A;  3I0G A;  2D7R A;  4KPZ A;  1GX0 A;  4Y64 A;  2YCM A;  5L6V A;  1MP4 A;  3RMW A;  5C8R A;  1NWG B;  2FFV A;  5I1F A;  2XME A;  1FXJ A;  1R81 A;  4XWI A;  3I0I X;  2OI7 A;  1H5S C;  1VGW A;  1ZI5 A;  4IRQ A;  4M28 A;  1W77 A;  4NAK A;  4EEO A;  4J18 A;  2A8U A;  4CJB A;  4JIS A;  5C3A A;  1FZW A;  3PKP A;  3F1C A;  3V0P A;  5CMG X;  4FCE A;  1IIM A;  1FR8 A;  3OAM A;  2AEC A;  3PKQ A;  2XWM A;  2RJ4 A;  1VZT A;  3TZT A;  1ZI1 A;  1SS9 A;  1S4N A;  2CU2 A;  4G3S A;  5L6S A;  5C38 A;  1G8O A;  2VS5 A;  4Y7T A;  1WVC A;  2OEF A;  3CKV A;  1NHE B;  1GA8 A;  1KWS A;  2FYC B;  2OI5 A;  1JV3 A;  5C1H A;  2O1F A;  5C4D A;  4FRD A;  1G1L A;  2Y4L A;  3D8V A;  3I0E A;  4MYB A;  5FU0 A;  1EZI A;  1TZF A;  2YQC A;  1HM9 A;  5C36 A;  2AM4 A;  3I0J A;  5FV9 A;  2I7B A;  4EVW A;  2Z87 A;  4Y7G A;  3V0O A;  3CKJ A;  4KXO A;  1FO8 A;  1WSZ A;  4G3P A;  2W0W A;  2RIZ A;  1LVW A;  1WT3 A;  2MZB A;  5IDT A;  5CMF X;  5CQN X;  4ARW A;  2UX8 A;  1ZCU A;  1WT2 A;  4KNX A;  2Y4M A;  4B2W A;  3I0C A;  3OGZ A;  1R7V A;  4DDZ A;  1JYK A;  3USQ A;  1H7Q A;  3OH1 A;  3U2X A;  1VZX A;  3K8D A;  4UEG A;  3JUK A;  1R82 A;  4YS8 A;  4FRP A;  4M4K A;  2V0L A;  4D11 C;  1OMX A;  4FRB A;  3SX3 A;  3JTJ A;  3DUV A;  1H5S A;  3I0K A;  2VD4 A;  2VXM A;  2XWN A;  1NMM B;  4B3U A;  3V8Y A;  2YQH A;  3U2W A;  1G97 A;  3ZGG A;  1G23 A;  3SXD A;  5FTS A;  2FYB A;  1ZJ0 A;  4FRH A;  1VH1 A;  2AH9 A;  4EEM A;  2BO7 A;  1ZI4 A;  4L41 C;  5J49 A;  1FO9 A;  4HG6 A;  5FYE A;  4Y7V A;  3V90 A;  2I5E A;  3K8E A;  3R2W A;  2Y7A A;  4B4B A;  4AAW A;  4ECM A;  4CJC A;  1WT0 A;  1R7U A;  4HO6 A;  4NAN A;  5CQL X;  5EJ1 A;  5CQP A;  4E1K A;  2XMH A;  2RJ7 A;  4D0Z A;  3SPT A;  5AJO A;  1VH3 A;  4R7P A;  3T7M A;  5C1L A;  1GX4 A;  2FFU A;  1S4O A;  3N9W A;  5DDV A;  1PZT A;  3V0Q A;  4B4G A;  3OKR A;  3CKN A;  1OQM B;  3D5N A;  3I0D A;  2RIX A;  3Q4S A;  2X5S A;  4KT7 A;  3CKO A;  4MND A;  1G9R A;  1OMZ A;  3FWW A;  1LZ0 A;  2PGV A;  3V91 A;  2Q4J A;  1IIN A;  4P02 A;  3RMV A;  4DEC A;  5C3B A;  2RJ9 A;  3JUJ A;  4GBP A;  3QVB A;  2O1H A;  5CQM X;  1VPA A;  3EE5 A;  1ZJ2 A;  3KIA A;  1MP5 A;  3USR A;  4ASJ A;  1YP2 A;  1LZJ A;  2BO4 A;  2QH5 A;  3NGW A;  5FU8 A;  5IFY A;  1G93 A;  2VSI A;  4KRV A;  5CMJ A;  4KC1 A;  3SXG A;  2RIY A;  3Q80 A;  2YQS A;  2ZU9 A;  2WVM A;  4Y6N A;  3OH4 A;  3I0H A;  1WT1 A;  2WEE A;  1VGT A;  1GWV A;  1O7Q A;  2JCJ A;  2NXV A;  3E25 A;  3IOJ A;  2ZU7 A;  2ICX A;  1LL3 A;  1H5S B;  1XHB A;  2Y4J A;  3SXA A;  1H7E A;  1LL2 A;  1EYR A;  2RJ1 A;  1TW1 A;  1H4D A;  2P6W A;  1HJJ A;  3SX7 A;  5C4E A;  2PA4 A;  1ZDF A;  1R7T A;  1XZ6 A;  1HJL A;  1ZCT A;  2V0K A;  2YQJ A;  1VIC A;  3E26 A;  2AES A;  2RJ8 A;  4B42 A;  1FXO A;  2FYD B;  1Z90 A;  4Y7U A;  1H3M A;  1VZU A;  5IDS A;  4FRE A;  2VFZ A;  4B2X A;  5AJN A;  2PGY A;  1ZHJ A;  4HOC A;  3ZLK A;  2E8B A;  2P73 A;  1QGQ A;  2JCO A;  5C49 A;  4NAL A;  4KPX A;  1W55 A;  2BO8 A;  2DPW A;  3U2T A;  4NAI A;  2I5K A;  4FRQ A;  1JYL A;  2P72 A;  4Y7F A;  5FTV A;  3OH3 A;  3V0L A;  5BXC A;  3V0M A;  4EE3 A;  4D48 A;  1QG8 A;  2FY7 A;  1R7X A;  2VS4 A;  1TVY A;  4KNR A;  1LZ7 A;  3PNN A;  4JD0 A;  2JCL A;  3V0N A;  1FRW A;  4M2B A;  4ZDQ A;  3SX8 A;  1ZCV A;  2O1G A;  3TQD A;  2X60 A;  1R80 A;  3ZLL A;  2V0J A;  3IOI A;  1PZY B;  1O23 B;  2YC3 A;  1ZJ3 A;  2D0J A;  2OEG A;  3U0Y A;  4BQH A;  2OI6 A;  3DK5 A;  3HL3 A;  1HM0 A;  4AYJ A;  2AM5 A;  2WGZ A;  3DJ4 A;  2RIT A;  4CVH A;  2QKX A;  2WVL A;  4M2A A;  4HO9 A;  1H7L A;  5EIY A;  2QGI A;  4FQW A;  4D0T A;  4EEA A;  2PX7 A;  2X65 A;  1V83 A;  1G3L A;  1G2V A;  1ZJP A;  1R7Y A;  1VM8 A;  1YP4 A;  4FRO A;  1QWJ A;  2VXL A;  2Y4K A;  5C4C A;  2W0V A;  3T7O A;  1FR9 A;  2RJ0 A;  2YC5 A;  4HO3 A;  4C2S A;  4HO8 A;  1FOA A;  1K4V A;  3Q7U A;  3V8Z A;  3FOQ A;  5C4F A;  2BO6 A;  3CU0 A;  4KC4 A;  1FGX A;  4HO2 A;  2WVK A;  3OC9 A;  1NF5 B;  4Y6U A;  4B4M A;  1LZI A;  1ZCY A;  2VS3 A;  2WAW A;  5CMI A;  4D11 A;  4DE7 A;  5CMH A;  1LL0 A;  4EE4 A;  4HO4 A;  3R3I A;  3SXE A;  2WE9 A;  1INI A;  1H7H A;  3ZF8 A;  1JVD A;  4K6R A;  3D98 A;  3OH0 A;  4AYL A;  3CKQ A;  3BRK X;  1ZI3 A;  1HM8 A;  1MP3 A;  2ICY A;  2X5Z A; 
#chains in the Genus database with same CATH topology
 1GQ9 A;  1ZIZ A;  3LW6 A;  1H7G A;  2V0H A;  4KC2 A;  4ASY A;  4CJ8 A;  4FCU A;  1ZJ1 A;  3SXB A;  5C1G A;  2A8W A;  2E3D A;  2Y6P A;  4HO0 A;  1NKH B;  1FGG A;  1MC3 A;  2VSH A;  2AGD A;  3T7N A;  3ZGF A;  1H7T A;  3ST8 A;  2AM3 A;  2GGO A;  1VGU A;  1YP3 A;  3SXC A;  1W57 A;  1GWW A;  2D7I A;  2Z86 A;  4HCQ A;  1ON8 A;  1YRO B;  5FUH A;  2ZU8 A;  1FWY A;  1TW5 A;  5EJZ A;  4BMA A;  3U2U A;  2JCK A;  5JQQ A;  3SX5 A;  4Y9X A;  3U0X A;  1NQI B;  3GUE A;  4KQL A;  5CQO A;  5C3D A;  3CGX A;  1VGZ A;  2APC A;  4LW3 A;  1H5T B;  1JV1 A;  3BCV A;  3POL A;  3U2V A;  4AC3 A;  2AE7 A;  4G87 A;  3OH2 A;  4LW6 A;  1V82 A;  3F1Y A;  1HV9 A;  1QGS A;  1H5R B;  1ZDG A;  1O7O A;  3I0L A;  1H4C A;  5HS2 A;  2XWL A;  4EEG A;  4HO5 A;  2V0I A;  4Q7C A;  2RJ5 A;  3I0F A;  3RSB A;  4IRP A;  1H7F A;  2YES A;  4FRM A;  5C47 A;  4FRL A;  1FG5 N;  5C4B A;  1E5K A;  4EE5 A;  1I52 A;  5DDT A;  1O0R A;  4G3Q A;  4Y62 A;  1G95 A;  1ZJO A;  1H5T A;  1V84 A;  4P00 A;  1H5S D;  2RJ6 A;  4B5B A;  2FYA A;  4FRA A;  5C48 A;  1GQC A;  1JVG A;  1H4E A;  1S4P A;  1INJ A;  2GGQ A;  4Y63 A;  1ON6 A;  1H5R A;  3O3P A;  1G0R A;  3IOH A;  2J0B A;  5AJP A;  3I0G A;  2D7R A;  4KPZ A;  1GX0 A;  4Y64 A;  2YCM A;  5L6V A;  1MP4 A;  3RMW A;  5C8R A;  1NWG B;  2FFV A;  5I1F A;  2XME A;  1FXJ A;  1R81 A;  4XWI A;  3I0I X;  2OI7 A;  1H5S C;  1VGW A;  1ZI5 A;  4IRQ A;  4M28 A;  1W77 A;  4NAK A;  4EEO A;  4J18 A;  2A8U A;  4CJB A;  4JIS A;  5C3A A;  1FZW A;  3PKP A;  3F1C A;  3V0P A;  5CMG X;  4FCE A;  1IIM A;  1FR8 A;  3OAM A;  2AEC A;  3PKQ A;  2XWM A;  4MIX A;  2RJ4 A;  1VZT A;  3TZT A;  1ZI1 A;  1SS9 A;  1S4N A;  2CU2 A;  4G3S A;  5L6S A;  5C38 A;  1G8O A;  2VS5 A;  4Y7T A;  1WVC A;  2OEF A;  3CKV A;  1NHE B;  1GA8 A;  1KWS A;  2FYC B;  2OI5 A;  1JV3 A;  5C1H A;  2O1F A;  5C4D A;  4FRD A;  1G1L A;  2Y4L A;  3D8V A;  3I0E A;  4MYB A;  5FU0 A;  1EZI A;  1TZF A;  2YQC A;  1HM9 A;  5C36 A;  2AM4 A;  3I0J A;  5FV9 A;  2I7B A;  4EVW A;  2Z87 A;  4Y7G A;  3V0O A;  3CKJ A;  4KXO A;  1FO8 A;  2C0N A;  1WSZ A;  4G3P A;  2W0W A;  2RIZ A;  4O6N A;  1LVW A;  1WT3 A;  2MZB A;  5IDT A;  5CMF X;  5CQN X;  4ARW A;  2UX8 A;  1ZCU A;  1WT2 A;  4KNX A;  2Y4M A;  4B2W A;  3I0C A;  3OGZ A;  1R7V A;  4DDZ A;  1JYK A;  3USQ A;  1H7Q A;  3OH1 A;  3U2X A;  1VZX A;  3K8D A;  4UEG A;  3JUK A;  1R82 A;  4YS8 A;  4FRP A;  4M4K A;  2V0L A;  4D11 C;  1OMX A;  4FRB A;  3SX3 A;  3JTJ A;  3DUV A;  1H5S A;  3I0K A;  2VD4 A;  2VXM A;  2XWN A;  1NMM B;  4B3U A;  3V8Y A;  2YQH A;  3U2W A;  1G97 A;  3ZGG A;  1G23 A;  3SXD A;  5FTS A;  2FYB A;  1ZJ0 A;  4FRH A;  1VH1 A;  2AH9 A;  4EEM A;  2BO7 A;  1ZI4 A;  4L41 C;  5J49 A;  1FO9 A;  4HG6 A;  2J0A A;  5FYE A;  4Y7V A;  3V90 A;  2I5E A;  3K8E A;  3R2W A;  2Y7A A;  4B4B A;  4AAW A;  4ECM A;  4CJC A;  1WT0 A;  1R7U A;  2VK9 A;  4HO6 A;  4NAN A;  5CQL X;  5EJ1 A;  5CQP A;  4E1K A;  2XMH A;  2RJ7 A;  4D0Z A;  3SPT A;  5AJO A;  1VH3 A;  4R7P A;  3T7M A;  5C1L A;  1GX4 A;  2FFU A;  1S4O A;  3N9W A;  5DDV A;  1PZT A;  3V0Q A;  4B4G A;  3OKR A;  3CKN A;  1OQM B;  3D5N A;  3I0D A;  2RIX A;  3Q4S A;  2X5S A;  4KT7 A;  3CKO A;  4MND A;  1G9R A;  1OMZ A;  3FWW A;  1LZ0 A;  2PGV A;  3V91 A;  2Q4J A;  1IIN A;  4P02 A;  3RMV A;  4DEC A;  5C3B A;  2RJ9 A;  3JUJ A;  4GBP A;  3QVB A;  2O1H A;  5CQM X;  1VPA A;  3EE5 A;  1ZJ2 A;  3KIA A;  1MP5 A;  3USR A;  4ASJ A;  1YP2 A;  1LZJ A;  2BO4 A;  2QH5 A;  3NGW A;  5FU8 A;  5IFY A;  1G93 A;  2VSI A;  4KRV A;  5CMJ A;  4KC1 A;  3SXG A;  2RIY A;  3Q80 A;  2YQS A;  2ZU9 A;  2WVM A;  4Y6N A;  3OH4 A;  3I0H A;  1WT1 A;  2WEE A;  1VGT A;  1GWV A;  1O7Q A;  2JCJ A;  2NXV A;  3E25 A;  3IOJ A;  2ZU7 A;  2ICX A;  1LL3 A;  1H5S B;  1XHB A;  2Y4J A;  3SXA A;  1H7E A;  4FIY A;  1LL2 A;  1EYR A;  2RJ1 A;  1TW1 A;  1H4D A;  2P6W A;  1HJJ A;  3SX7 A;  5C4E A;  2PA4 A;  1ZDF A;  1R7T A;  1XZ6 A;  1HJL A;  1ZCT A;  2V0K A;  2YQJ A;  1VIC A;  3E26 A;  2AES A;  2RJ8 A;  4B42 A;  1FXO A;  2FYD B;  1Z90 A;  4Y7U A;  1H3M A;  1VZU A;  5IDS A;  4FRE A;  2VFZ A;  4B2X A;  5AJN A;  2PGY A;  1ZHJ A;  4HOC A;  3ZLK A;  2E8B A;  2P73 A;  1QGQ A;  2JCO A;  5C49 A;  4NAL A;  4KPX A;  1W55 A;  2BO8 A;  2DPW A;  3U2T A;  4NAI A;  2I5K A;  4FRQ A;  1JYL A;  2P72 A;  4Y7F A;  5FTV A;  3OH3 A;  3V0L A;  5BXC A;  3V0M A;  4EE3 A;  4D48 A;  1QG8 A;  2FY7 A;  1R7X A;  2VS4 A;  1TVY A;  4KNR A;  1LZ7 A;  3PNN A;  4JD0 A;  2JCL A;  3V0N A;  1FRW A;  4M2B A;  4ZDQ A;  3SX8 A;  1ZCV A;  2O1G A;  3TQD A;  2X60 A;  1R80 A;  3ZLL A;  2V0J A;  3IOI A;  1PZY B;  1O23 B;  2YC3 A;  1ZJ3 A;  2D0J A;  2OEG A;  3U0Y A;  4BQH A;  2OI6 A;  3DK5 A;  3HL3 A;  1HM0 A;  4AYJ A;  2AM5 A;  2WGZ A;  3DJ4 A;  2RIT A;  4CVH A;  2QKX A;  2WVL A;  4M2A A;  4HO9 A;  1H7L A;  5EIY A;  2QGI A;  4FQW A;  4D0T A;  4EEA A;  2PX7 A;  2X65 A;  1V83 A;  1G3L A;  1G2V A;  1ZJP A;  1R7Y A;  4O6M A;  1VM8 A;  1YP4 A;  4FRO A;  1QWJ A;  2VXL A;  2Y4K A;  5C4C A;  2W0V A;  3T7O A;  1FR9 A;  2RJ0 A;  2YC5 A;  4HO3 A;  4C2S A;  4HO8 A;  1FOA A;  1K4V A;  3Q7U A;  3V8Z A;  3FOQ A;  5D92 A;  5C4F A;  2BO6 A;  3CU0 A;  4KC4 A;  1FGX A;  4FIX A;  4HO2 A;  2WVK A;  3OC9 A;  1NF5 B;  4Y6U A;  4B4M A;  1LZI A;  1ZCY A;  2VS3 A;  2WAW A;  5CMI A;  4D11 A;  4DE7 A;  5CMH A;  1LL0 A;  4EE4 A;  4HO4 A;  3R3I A;  3SXE A;  2WE9 A;  1INI A;  1H7H A;  3ZF8 A;  5D91 A;  1JVD A;  4K6R A;  3D98 A;  3OH0 A;  4AYL A;  3CKQ A;  3BRK X;  1ZI3 A;  1HM8 A;  1MP3 A;  2ICY A;  2X5Z A; 
#chains in the Genus database with same CATH homology
 1GQ9 A;  1ZIZ A;  3LW6 A;  1H7G A;  2V0H A;  4KC2 A;  4ASY A;  4CJ8 A;  4FCU A;  1ZJ1 A;  3SXB A;  5C1G A;  2A8W A;  2E3D A;  2Y6P A;  4HO0 A;  1NKH B;  1FGG A;  1MC3 A;  2VSH A;  2AGD A;  3T7N A;  3ZGF A;  1H7T A;  3ST8 A;  2AM3 A;  2GGO A;  1VGU A;  1YP3 A;  3SXC A;  1W57 A;  1GWW A;  2D7I A;  2Z86 A;  4HCQ A;  1ON8 A;  1YRO B;  5FUH A;  2ZU8 A;  1FWY A;  1TW5 A;  5EJZ A;  4BMA A;  3U2U A;  2JCK A;  5JQQ A;  3SX5 A;  4Y9X A;  3U0X A;  1NQI B;  3GUE A;  4KQL A;  5CQO A;  5C3D A;  3CGX A;  1VGZ A;  2APC A;  4LW3 A;  1H5T B;  1JV1 A;  3BCV A;  3POL A;  3U2V A;  4AC3 A;  2AE7 A;  4G87 A;  3OH2 A;  4LW6 A;  1V82 A;  3F1Y A;  1HV9 A;  1QGS A;  1H5R B;  1ZDG A;  1O7O A;  3I0L A;  1H4C A;  5HS2 A;  2XWL A;  4EEG A;  4HO5 A;  2V0I A;  4Q7C A;  2RJ5 A;  3I0F A;  3RSB A;  4IRP A;  1H7F A;  2YES A;  4FRM A;  5C47 A;  4FRL A;  1FG5 N;  5C4B A;  1E5K A;  4EE5 A;  1I52 A;  5DDT A;  1O0R A;  4G3Q A;  4Y62 A;  1G95 A;  1ZJO A;  1H5T A;  1V84 A;  4P00 A;  1H5S D;  2RJ6 A;  4B5B A;  2FYA A;  4FRA A;  5C48 A;  1GQC A;  1JVG A;  1H4E A;  1S4P A;  1INJ A;  2GGQ A;  4Y63 A;  1ON6 A;  1H5R A;  3O3P A;  1G0R A;  3IOH A;  2J0B A;  5AJP A;  3I0G A;  2D7R A;  4KPZ A;  1GX0 A;  4Y64 A;  2YCM A;  5L6V A;  1MP4 A;  3RMW A;  5C8R A;  1NWG B;  2FFV A;  5I1F A;  2XME A;  1FXJ A;  1R81 A;  4XWI A;  3I0I X;  2OI7 A;  1H5S C;  1VGW A;  1ZI5 A;  4IRQ A;  4M28 A;  1W77 A;  4NAK A;  4EEO A;  4J18 A;  2A8U A;  4CJB A;  4JIS A;  5C3A A;  1FZW A;  3PKP A;  3F1C A;  3V0P A;  5CMG X;  4FCE A;  1IIM A;  1FR8 A;  3OAM A;  2AEC A;  3PKQ A;  2XWM A;  4MIX A;  2RJ4 A;  1VZT A;  3TZT A;  1ZI1 A;  1SS9 A;  1S4N A;  2CU2 A;  4G3S A;  5L6S A;  5C38 A;  1G8O A;  2VS5 A;  4Y7T A;  1WVC A;  2OEF A;  3CKV A;  1NHE B;  1GA8 A;  1KWS A;  2FYC B;  2OI5 A;  1JV3 A;  5C1H A;  2O1F A;  5C4D A;  4FRD A;  1G1L A;  2Y4L A;  3D8V A;  3I0E A;  4MYB A;  5FU0 A;  1EZI A;  1TZF A;  2YQC A;  1HM9 A;  5C36 A;  2AM4 A;  3I0J A;  5FV9 A;  2I7B A;  4EVW A;  2Z87 A;  4Y7G A;  3V0O A;  3CKJ A;  4KXO A;  1FO8 A;  2C0N A;  1WSZ A;  4G3P A;  2W0W A;  2RIZ A;  4O6N A;  1LVW A;  1WT3 A;  2MZB A;  5IDT A;  5CMF X;  5CQN X;  4ARW A;  2UX8 A;  1ZCU A;  1WT2 A;  4KNX A;  2Y4M A;  4B2W A;  3I0C A;  3OGZ A;  1R7V A;  4DDZ A;  1JYK A;  3USQ A;  1H7Q A;  3OH1 A;  3U2X A;  1VZX A;  3K8D A;  4UEG A;  3JUK A;  1R82 A;  4YS8 A;  4FRP A;  4M4K A;  2V0L A;  4D11 C;  1OMX A;  4FRB A;  3SX3 A;  3JTJ A;  3DUV A;  1H5S A;  3I0K A;  2VD4 A;  2VXM A;  2XWN A;  1NMM B;  4B3U A;  3V8Y A;  2YQH A;  3U2W A;  1G97 A;  3ZGG A;  1G23 A;  3SXD A;  5FTS A;  2FYB A;  1ZJ0 A;  4FRH A;  1VH1 A;  2AH9 A;  4EEM A;  2BO7 A;  1ZI4 A;  4L41 C;  5J49 A;  1FO9 A;  4HG6 A;  2J0A A;  5FYE A;  4Y7V A;  3V90 A;  2I5E A;  3K8E A;  3R2W A;  2Y7A A;  4B4B A;  4AAW A;  4ECM A;  4CJC A;  1WT0 A;  1R7U A;  2VK9 A;  4HO6 A;  4NAN A;  5CQL X;  5EJ1 A;  5CQP A;  4E1K A;  2XMH A;  2RJ7 A;  4D0Z A;  3SPT A;  5AJO A;  1VH3 A;  4R7P A;  3T7M A;  5C1L A;  1GX4 A;  2FFU A;  1S4O A;  3N9W A;  5DDV A;  1PZT A;  3V0Q A;  4B4G A;  3OKR A;  3CKN A;  1OQM B;  3D5N A;  3I0D A;  2RIX A;  3Q4S A;  2X5S A;  4KT7 A;  3CKO A;  4MND A;  1G9R A;  1OMZ A;  3FWW A;  1LZ0 A;  2PGV A;  3V91 A;  2Q4J A;  1IIN A;  4P02 A;  3RMV A;  4DEC A;  5C3B A;  2RJ9 A;  3JUJ A;  4GBP A;  3QVB A;  2O1H A;  5CQM X;  1VPA A;  3EE5 A;  1ZJ2 A;  3KIA A;  1MP5 A;  3USR A;  4ASJ A;  1YP2 A;  1LZJ A;  2BO4 A;  2QH5 A;  3NGW A;  5FU8 A;  5IFY A;  1G93 A;  2VSI A;  4KRV A;  5CMJ A;  4KC1 A;  3SXG A;  2RIY A;  3Q80 A;  2YQS A;  2ZU9 A;  2WVM A;  4Y6N A;  3OH4 A;  3I0H A;  1WT1 A;  2WEE A;  1VGT A;  1GWV A;  1O7Q A;  2JCJ A;  2NXV A;  3E25 A;  3IOJ A;  2ZU7 A;  2ICX A;  1LL3 A;  1H5S B;  1XHB A;  2Y4J A;  3SXA A;  1H7E A;  4FIY A;  1LL2 A;  1EYR A;  2RJ1 A;  1TW1 A;  1H4D A;  2P6W A;  1HJJ A;  3SX7 A;  5C4E A;  2PA4 A;  1ZDF A;  1R7T A;  1XZ6 A;  1HJL A;  1ZCT A;  2V0K A;  2YQJ A;  1VIC A;  3E26 A;  2AES A;  2RJ8 A;  4B42 A;  1FXO A;  2FYD B;  1Z90 A;  4Y7U A;  1H3M A;  1VZU A;  5IDS A;  4FRE A;  2VFZ A;  4B2X A;  5AJN A;  2PGY A;  1ZHJ A;  4HOC A;  3ZLK A;  2E8B A;  2P73 A;  1QGQ A;  2JCO A;  5C49 A;  4NAL A;  4KPX A;  1W55 A;  2BO8 A;  2DPW A;  3U2T A;  4NAI A;  2I5K A;  4FRQ A;  1JYL A;  2P72 A;  4Y7F A;  5FTV A;  3OH3 A;  3V0L A;  5BXC A;  3V0M A;  4EE3 A;  4D48 A;  1QG8 A;  2FY7 A;  1R7X A;  2VS4 A;  1TVY A;  4KNR A;  1LZ7 A;  3PNN A;  4JD0 A;  2JCL A;  3V0N A;  1FRW A;  4M2B A;  4ZDQ A;  3SX8 A;  1ZCV A;  2O1G A;  3TQD A;  2X60 A;  1R80 A;  3ZLL A;  2V0J A;  3IOI A;  1PZY B;  1O23 B;  2YC3 A;  1ZJ3 A;  2D0J A;  2OEG A;  3U0Y A;  4BQH A;  2OI6 A;  3DK5 A;  3HL3 A;  1HM0 A;  4AYJ A;  2AM5 A;  2WGZ A;  3DJ4 A;  2RIT A;  4CVH A;  2QKX A;  2WVL A;  4M2A A;  4HO9 A;  1H7L A;  5EIY A;  2QGI A;  4FQW A;  4D0T A;  4EEA A;  2PX7 A;  2X65 A;  1V83 A;  1G3L A;  1G2V A;  1ZJP A;  1R7Y A;  4O6M A;  1VM8 A;  1YP4 A;  4FRO A;  1QWJ A;  2VXL A;  2Y4K A;  5C4C A;  2W0V A;  3T7O A;  1FR9 A;  2RJ0 A;  2YC5 A;  4HO3 A;  4C2S A;  4HO8 A;  1FOA A;  1K4V A;  3Q7U A;  3V8Z A;  3FOQ A;  5D92 A;  5C4F A;  2BO6 A;  3CU0 A;  4KC4 A;  1FGX A;  4FIX A;  4HO2 A;  2WVK A;  3OC9 A;  1NF5 B;  4Y6U A;  4B4M A;  1LZI A;  1ZCY A;  2VS3 A;  2WAW A;  5CMI A;  4D11 A;  4DE7 A;  5CMH A;  1LL0 A;  4EE4 A;  4HO4 A;  3R3I A;  3SXE A;  2WE9 A;  1INI A;  1H7H A;  3ZF8 A;  5D91 A;  1JVD A;  4K6R A;  3D98 A;  3OH0 A;  4AYL A;  3CKQ A;  3BRK X;  1ZI3 A;  1HM8 A;  1MP3 A;  2ICY A;  2X5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...