1GA8A

Crystal structure of galacosyltransferase lgtc in complex with donor and acceptor sugar analogs.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
278
Chain Sequence
MDIVFAADDNYAAYLCVAAKSVEAAHPDTEIRFHVLDAGISEANRAAVAANLRGGGGNIRFIDVNPEDFAGFPLNIRHISITTYARLKLGEYIADCDKVLYLDIDVLVRDSLTPLWDTDLGDNWLGASIDLFVERQEGYKQKIGMADGEYYFNAGVLLINLKKWRRHDIFKMSSEWVEQYKDVMQYQDQDILNGLFKGGVCYANSRFNFMPTNYAFMASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAWGAERFTELAGSLTTVPEEWRGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSYL TRANSFERASE LGTC
publication title Crystal structure of the retaining galactosyltransferase LgtC from Neisseria meningitidis in complex with donor and acceptor sugar analogs.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 91
structure length 278
sequence length 282
ec nomenclature ec 2.4.1.44: Lipopolysaccharide 3-alpha-galactosyltransferase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1ga8A00
1IINA 1R7VA 1TW1A 2XMEA 4HO3A 4B4BA 1HV9A 2P73A 3FWWA 2RIZA 4DECA 1WT1A 3CU0A 4FRDA 2AE7A 1HM8A 2YC3A 4JD0A 4FRMA 1ZCTA 4EE5A 4AYLA 1FRWA 1EZIA 1V84A 2Q4JA 2RJ7A 4LW6A 1O0RA 3LW6A 3SXBA 4EEOA 4KQLA 1LVWA 1NKHB 3OAMA 5C1HA 3JUJA 1ZI1A 1H7EA 2BO4A 5EJZA 4AYJA 1HJLA 4CJCA 3OKRA 4GBPA 1GQCA 2GGQA 2UX8A 2YCMA 3USRA 5C4BA 4M2AA 1G23A 1MP3A 4MNDA 2MZBA 3PNNA 1HJJA 4EVWA 1H7GA 1H7QA 1YP4A 2Y4MA 4IRPA 2VSHA 3SXCA 1LZ7A 5DDVA 3ZLKA 2FY7A 1G9RA 1YROB 3I0KA 4NANA 2NXVA 2QKXA 4KXOA 4Y6NA 2BO6A 4Y63A 4HO9A 4Y7GA 3BCVA 1QGSA 3V0PA 4FRPA 5C48A 4D11A 1WT2A 2O1FA 1H7FA 2Y7AA 2VFZA 2A8UA 2PA4A 4EE3A 1ZJ1A 2P72A 3D5NA 3I0JA 3DUVA 3Q7UA 5CMGX 3ZGFA 3HL3A 4ZDQA 4IRQA 1LZIA 3I0EA 2RJ6A 1ZJ3A 1ZJ0A 2ZU8A 1VGZA 3POLA 3KIAA 4M28A 1VGTA 2PX7A 5AJPA 1ZDGA 1H5SA 2FYAA 4AC3A 1R7YA 1GWVA 4JISA 1ZDFA 3OH2A 1H4EA 1S4NA 4YS8A 1VGUA 4FROA 3PKQA 3I0IX 5FU8A 3RMVA 5C3BA 1FR9A 1JV1A 4M4KA 3R3IA 3SXAA 5FV9A 2FYDB 5L6VA 2ZU7A 1LL0A 1ZCYA 2P6WA 4KPZA 1H5TA 1ZIZA 5DDTA 4HO8A 5CMIA 2OI6A 3V90A 3SXGA 5CQOA 1GX0A 1INIA 4J18A 1QG8A 1G3LA 1H5RA 1GX4A 1G97A 1W77A 5C49A 3U2WA 3O3PA 4D0ZA 1VGWA 1INJA 3CGXA 1ZI4A 4AAWA 1NMMB 2AM4A 2Y6PA 1I52A 3V0OA 4M2BA 3R2WA 2VD4A 3RMWA 1G93A 3I0LA 2QH5A 2V0KA 3SX5A 3V91A 1XZ6A 4B2XA 1GA8A 3SX7A 1O23B 4FRLA 2I7BA 3BRKX 4D48A 1FXOA 3F1CA 4XWIA 4B3UA 2DPWA 5BXCA 1ZJ2A 4KNRA 1XHBA 3T7OA 1G1LA 4BMAA 3CKJA 4FRBA 4ECMA 3ZGGA 2XWMA 4CVHA 3Q80A 1VZXA 2YC5A 3U2UA 2WVKA 4P02A 2RJ0A 2RIYA 3DJ4A 1W57A 2BO8A 5CQNX 5CQLX 4CJ8A 1QWJA 1JYLA 4KRVA 4E1KA 2X60A 3I0CA 4CJBA 5AJNA 2OI5A 3SXDA 4DDZA 1G95A 5L6SA 1NF5B 4L41C 3U0XA 4DE7A 2YQHA 1ZJPA 1E5KA 1H7HA 3I0GA 3CKOA 1ON8A 2RIXA 3ST8A 1LL2A 2RJ9A 5CQPA 1ZHJA 5C3AA 3IOHA 3USQA 5C38A 1HM9A 4B4MA 4FCEA 4EEGA 1OMZA 4Y62A 4Y9XA 5C1GA 4KC1A 3OC9A 2APCA 2AM5A 1R80A 1HM0A 3K8DA 1OMXA 2XWNA 4FREA 4HOCA 2YQJA 5IFYA 3I0FA 1FXJA 2AH9A 1G2VA 2FFUA 3V8ZA 1TW5A 1MP5A 4MYBA 1TZFA 1WVCA 4K6RA 2QGIA 4B5BA 1ON6A 4HO5A 3OGZA 1VZUA 4FRQA 2Z87A 4EEAA 4NAKA 3ZF8A 3U2VA 2Y4JA 5CQMX 3E25A 2RJ8A 1H5SB 5C8RA 3QVBA 1R7TA 2OEGA 2ZU9A 3V0MA 3OH1A 2JCJA 4HCQA 2X5ZA 3CKNA 5C47A 5JQQA 3OH0A 3SX3A 2D7IA 1H5SD 1NWGB 1MP4A 2I5EA 2BO7A 1GQ9A 5CMJA 2E8BA 2YQSA 4KT7A 2X65A 3SXEA 1O7QA 1FG5N 1H5TB 4Y6UA 3Q4SA 4FRHA 3JTJA 2W0WA 5J49A 3CKQA 4LW3A 4G87A 2PGVA 2FYBA 1S4PA 5CMHA 1H5RB 1FO8A 2AECA 4KC2A 1VPAA 4HO2A 1KWSA 1FWYA 1TVYA 2OI7A 3V0NA 2YQCA 3IOIA 5AJOA 4B42A 2FFVA 2A8WA 2WVLA 1W55A 3RSBA 2V0LA 4Y7TA 1GWWA 1EYRA 1ZI5A 1O7OA 4B2WA 3V0QA 2VS5A 1JV3A 2VXMA 3I0HA 3F1YA 5FTSA 5C1LA 1JVGA 3JUKA 4ASYA 3EE5A 3TQDA 3NGWA 5EIYA 1VH3A 1H5SC 1H7LA 5C4FA 1MC3A 1VZTA 2X5SA 2Y4KA 4ARWA 3ZLLA 3DK5A 1PZYB 2I5KA 2O1HA 5IDSA 2JCOA 3T7MA 4EE4A 4Y64A 1G0RA 4C2SA 4EEMA 3N9WA 4G3PA 1FGXA 1V82A 1NHEB 1OQMB 2W0VA 1K4VA 2V0JA 5FTVA 5FYEA 1ZJOA 1S4OA 4P00A 3I0DA 1FR8A 3U0YA 2V0HA 4G3SA 4Y7FA 3OH4A 4ASJA 2D7RA 4KNXA 1G8OA 1R7UA 5I1FA 1R82A 4Y7VA 2RITA 4KC4A 1JYKA 1ZI3A 1PZTA 1QGQA 4HO6A 3SX8A 1VICA 2JCLA 2Y4LA 2AESA 1WSZA 4Y7UA 1FO9A 2VSIA 5C4EA 2RJ1A 4FQWA 2Z86A 5FU0A 4KPXA 3FOQA 1NQIB 3CKVA 3IOJA 5C4DA 1ZCUA 2CU2A 3E26A 2PGYA 2JCKA 1H7TA 3V0LA 1VH1A 5HS2A 4FRAA 1YP2A 1LZ0A 3T7NA 5FUHA 5C3DA 2AM3A 3GUEA 5C4CA 1SS9A 1V83A 2RJ4A 3OH3A 2VXLA 2XWLA 1Z90A 1WT0A 2WVMA 3D98A 3U2XA 2VS4A 4BQHA 2D0JA 1LZJA 3PKPA 2VS3A 1R81A 1H3MA 2OEFA 2WEEA 4NAIA 1FGGA 2WE9A 4NALA 1H4CA 1VM8A 3SPTA 5C36A 3D8VA 1IIMA 1JVDA 2WGZA 5EJ1A 5IDTA 4FCUA 4D0TA 2V0IA 4G3QA 2ICXA 3V8YA 1FOAA 2E3DA 4R7PA 2AGDA 1ZCVA 2ICYA 4HG6A 2GGOA 4D11C 1R7XA 4B4GA 2YESA 5CMFX 3TZTA 1LL3A 1WT3A 2WAWA 1FZWA 1H4DA 2FYCB 2O1GA 1YP3A 3K8EA 4HO4A 2RJ5A 3U2TA 4HO0A 4UEGA 2XMHA
chains in the Genus database with same CATH superfamily
1IINA 1R7VA 1TW1A 2XMEA 4HO3A 4B4BA 1HV9A 2P73A 3FWWA 2RIZA 4DECA 1WT1A 3CU0A 4FRDA 2AE7A 1HM8A 2YC3A 4JD0A 4FRMA 1ZCTA 4EE5A 4AYLA 1FRWA 1EZIA 1V84A 2Q4JA 2RJ7A 4LW6A 1O0RA 3LW6A 3SXBA 4EEOA 4KQLA 1LVWA 1NKHB 3OAMA 5C1HA 3JUJA 1ZI1A 1H7EA 2BO4A 5EJZA 4AYJA 1HJLA 4CJCA 3OKRA 4GBPA 1GQCA 2GGQA 2UX8A 2YCMA 3USRA 5C4BA 4M2AA 1G23A 1MP3A 4MNDA 2MZBA 3PNNA 1HJJA 4EVWA 1H7GA 1H7QA 1YP4A 2Y4MA 4IRPA 2VSHA 3SXCA 1LZ7A 5DDVA 3ZLKA 2FY7A 1G9RA 1YROB 3I0KA 4NANA 2NXVA 2QKXA 4KXOA 4Y6NA 2BO6A 4Y63A 4HO9A 4Y7GA 3BCVA 4MIXA 1QGSA 3V0PA 4FRPA 5C48A 4D11A 1WT2A 2O1FA 1H7FA 2Y7AA 2VFZA 2A8UA 2PA4A 4EE3A 1ZJ1A 2P72A 3D5NA 3I0JA 3DUVA 3Q7UA 5CMGX 4Q7CA 3ZGFA 3HL3A 4ZDQA 4IRQA 1LZIA 3I0EA 2RJ6A 1ZJ3A 1ZJ0A 2ZU8A 1VGZA 3POLA 3KIAA 4M28A 1VGTA 2PX7A 5AJPA 1ZDGA 1H5SA 2FYAA 4AC3A 1R7YA 1GWVA 4JISA 1ZDFA 3OH2A 1H4EA 1S4NA 4YS8A 1VGUA 4FROA 3PKQA 3I0IX 5FU8A 3RMVA 5C3BA 1FR9A 1JV1A 4M4KA 3R3IA 3SXAA 5FV9A 2FYDB 5L6VA 2ZU7A 1LL0A 1ZCYA 2P6WA 4KPZA 1H5TA 1ZIZA 5DDTA 4HO8A 5CMIA 2OI6A 3V90A 3SXGA 5CQOA 1GX0A 1INIA 4J18A 1QG8A 1G3LA 1H5RA 1GX4A 1G97A 1W77A 5C49A 3U2WA 3O3PA 4D0ZA 1VGWA 1INJA 3CGXA 1ZI4A 4AAWA 1NMMB 2AM4A 2Y6PA 1I52A 5D92A 3V0OA 4M2BA 3R2WA 2VD4A 3RMWA 1G93A 3I0LA 2QH5A 2V0KA 3SX5A 3V91A 1XZ6A 4B2XA 1GA8A 3SX7A 1O23B 4FRLA 2I7BA 3BRKX 4D48A 1FXOA 4O6MA 3F1CA 4XWIA 4B3UA 2DPWA 5BXCA 1ZJ2A 4KNRA 1XHBA 3T7OA 1G1LA 4BMAA 3CKJA 4FRBA 4ECMA 3ZGGA 2XWMA 4CVHA 2J0BA 1VZXA 3Q80A 2YC5A 3U2UA 2WVKA 4P02A 2RJ0A 2RIYA 3DJ4A 1W57A 2BO8A 5CQNX 5CQLX 4CJ8A 1QWJA 1JYLA 4FIXA 4KRVA 4E1KA 2X60A 3I0CA 4CJBA 5AJNA 2OI5A 3SXDA 4DDZA 1G95A 5L6SA 1NF5B 4L41C 3U0XA 4DE7A 2YQHA 1ZJPA 1E5KA 1H7HA 3I0GA 4O6NA 3CKOA 1ON8A 2RIXA 3ST8A 1LL2A 2RJ9A 5CQPA 1ZHJA 5C3AA 3IOHA 3USQA 5C38A 1HM9A 4B4MA 4FCEA 4EEGA 1OMZA 4Y62A 4Y9XA 5C1GA 4KC1A 3OC9A 2APCA 2AM5A 1R80A 1HM0A 3K8DA 1OMXA 2XWNA 4FREA 4HOCA 2YQJA 5IFYA 2J0AA 3I0FA 1FXJA 2AH9A 1G2VA 2FFUA 3V8ZA 1TW5A 1MP5A 4MYBA 1TZFA 1WVCA 4K6RA 2QGIA 4B5BA 1ON6A 4HO5A 3OGZA 1VZUA 4FRQA 2Z87A 4EEAA 4NAKA 3ZF8A 3U2VA 2Y4JA 5CQMX 3E25A 2RJ8A 1H5SB 5C8RA 3QVBA 1R7TA 2C0NA 2OEGA 2ZU9A 3V0MA 3OH1A 2JCJA 4HCQA 2X5ZA 3CKNA 5C47A 5JQQA 3OH0A 3SX3A 2D7IA 1H5SD 1NWGB 1MP4A 2I5EA 2BO7A 1GQ9A 5CMJA 2E8BA 2YQSA 4KT7A 2X65A 3SXEA 1O7QA 1FG5N 1H5TB 4Y6UA 3Q4SA 4FRHA 3JTJA 2VK9A 2W0WA 5J49A 3CKQA 4LW3A 4G87A 2PGVA 2FYBA 1S4PA 5CMHA 1H5RB 1FO8A 2AECA 4KC2A 1VPAA 4HO2A 1KWSA 1FWYA 1TVYA 2OI7A 3V0NA 2YQCA 3IOIA 5AJOA 4B42A 2FFVA 2A8WA 2WVLA 1W55A 3RSBA 2V0LA 4Y7TA 1GWWA 1EYRA 1ZI5A 1O7OA 4B2WA 3V0QA 2VS5A 1JV3A 2VXMA 3I0HA 3F1YA 5FTSA 5C1LA 1JVGA 3JUKA 4ASYA 3EE5A 3TQDA 3NGWA 5EIYA 1VH3A 1H5SC 1H7LA 5C4FA 1MC3A 1VZTA 4FIYA 2X5SA 2Y4KA 4ARWA 3ZLLA 3DK5A 1PZYB 2I5KA 2O1HA 5IDSA 2JCOA 3T7MA 4EE4A 4Y64A 1G0RA 4C2SA 4EEMA 3N9WA 4G3PA 1FGXA 1V82A 1NHEB 1OQMB 2W0VA 1K4VA 2V0JA 5FTVA 5FYEA 1ZJOA 1S4OA 4P00A 3I0DA 1FR8A 3U0YA 2V0HA 4G3SA 4Y7FA 3OH4A 4ASJA 2D7RA 4KNXA 1G8OA 1R7UA 5I1FA 1R82A 4Y7VA 2RITA 4KC4A 1JYKA 1ZI3A 1PZTA 1QGQA 4HO6A 3SX8A 1VICA 2JCLA 2Y4LA 2AESA 1WSZA 4Y7UA 1FO9A 2VSIA 5C4EA 2RJ1A 4FQWA 2Z86A 5FU0A 4KPXA 3FOQA 1NQIB 3CKVA 3IOJA 5C4DA 1ZCUA 2CU2A 3E26A 2PGYA 2JCKA 1H7TA 3V0LA 1VH1A 5HS2A 4FRAA 1YP2A 1LZ0A 3T7NA 5FUHA 5C3DA 2AM3A 3GUEA 5C4CA 1SS9A 1V83A 2RJ4A 3OH3A 2VXLA 2XWLA 1Z90A 1WT0A 2WVMA 3D98A 3U2XA 2VS4A 4BQHA 2D0JA 1LZJA 3PKPA 2VS3A 1R81A 1H3MA 2OEFA 2WEEA 4NAIA 1FGGA 2WE9A 4NALA 1H4CA 1VM8A 3SPTA 5C36A 3D8VA 1IIMA 1JVDA 2WGZA 5EJ1A 5IDTA 4FCUA 4D0TA 2V0IA 4G3QA 2ICXA 3V8YA 1FOAA 2E3DA 4R7PA 5D91A 2AGDA 1ZCVA 2ICYA 4HG6A 2GGOA 4D11C 1R7XA 4B4GA 2YESA 5CMFX 3TZTA 1LL3A 1WT3A 2WAWA 1FZWA 1H4DA 2FYCB 2O1GA 1YP3A 3K8EA 4HO4A 2RJ5A 3U2TA 4HO0A 4UEGA 2XMHA
chains in the Genus database with same CATH topology
1IINA 1R7VA 1TW1A 2XMEA 4HO3A 4B4BA 1HV9A 2P73A 3FWWA 2RIZA 4DECA 1WT1A 3CU0A 4FRDA 2AE7A 1HM8A 2YC3A 4JD0A 4FRMA 1ZCTA 4EE5A 4AYLA 1FRWA 1EZIA 1V84A 2Q4JA 2RJ7A 4LW6A 1O0RA 3LW6A 3SXBA 4EEOA 4KQLA 1LVWA 1NKHB 3OAMA 5C1HA 3JUJA 1ZI1A 1H7EA 2BO4A 5EJZA 4AYJA 1HJLA 4CJCA 3OKRA 4GBPA 1GQCA 2GGQA 2UX8A 2YCMA 3USRA 5C4BA 4M2AA 1G23A 1MP3A 4MNDA 2MZBA 3PNNA 1HJJA 4EVWA 1H7GA 1H7QA 1YP4A 2Y4MA 4IRPA 2VSHA 3SXCA 1LZ7A 5DDVA 3ZLKA 2FY7A 1G9RA 1YROB 3I0KA 4NANA 2NXVA 2QKXA 4KXOA 4Y6NA 2BO6A 4Y63A 4HO9A 4Y7GA 3BCVA 4MIXA 1QGSA 3V0PA 4FRPA 5C48A 4D11A 1WT2A 2O1FA 1H7FA 2Y7AA 2VFZA 2A8UA 2PA4A 4EE3A 1ZJ1A 2P72A 3D5NA 3I0JA 3DUVA 3Q7UA 5CMGX 4Q7CA 3ZGFA 3HL3A 4ZDQA 4IRQA 1LZIA 3I0EA 2RJ6A 1ZJ3A 1ZJ0A 2ZU8A 1VGZA 3POLA 3KIAA 4M28A 1VGTA 2PX7A 5AJPA 1ZDGA 1H5SA 2FYAA 4AC3A 1R7YA 1GWVA 4JISA 1ZDFA 3OH2A 1H4EA 1S4NA 4YS8A 1VGUA 4FROA 3PKQA 3I0IX 5FU8A 3RMVA 5C3BA 1FR9A 1JV1A 4M4KA 3R3IA 3SXAA 5FV9A 2FYDB 5L6VA 2ZU7A 1LL0A 1ZCYA 2P6WA 4KPZA 1H5TA 1ZIZA 5DDTA 4HO8A 5CMIA 2OI6A 3V90A 3SXGA 5CQOA 1GX0A 1INIA 4J18A 1QG8A 1G3LA 1H5RA 1GX4A 1G97A 1W77A 5C49A 3U2WA 3O3PA 4D0ZA 1VGWA 1INJA 3CGXA 1ZI4A 4AAWA 1NMMB 2AM4A 2Y6PA 1I52A 5D92A 3V0OA 4M2BA 3R2WA 2VD4A 3RMWA 1G93A 3I0LA 2QH5A 2V0KA 3SX5A 3V91A 1XZ6A 4B2XA 1GA8A 3SX7A 1O23B 4FRLA 2I7BA 3BRKX 4D48A 1FXOA 4O6MA 3F1CA 4XWIA 4B3UA 2DPWA 5BXCA 1ZJ2A 4KNRA 1XHBA 3T7OA 1G1LA 4BMAA 3CKJA 4FRBA 4ECMA 3ZGGA 2XWMA 4CVHA 2J0BA 1VZXA 3Q80A 2YC5A 3U2UA 2WVKA 4P02A 2RJ0A 2RIYA 3DJ4A 1W57A 2BO8A 5CQNX 5CQLX 4CJ8A 1QWJA 1JYLA 4FIXA 4KRVA 4E1KA 2X60A 3I0CA 4CJBA 5AJNA 2OI5A 3SXDA 4DDZA 1G95A 5L6SA 1NF5B 4L41C 3U0XA 4DE7A 2YQHA 1ZJPA 1E5KA 1H7HA 3I0GA 4O6NA 3CKOA 1ON8A 2RIXA 3ST8A 1LL2A 2RJ9A 5CQPA 1ZHJA 5C3AA 3IOHA 3USQA 5C38A 1HM9A 4B4MA 4FCEA 4EEGA 1OMZA 4Y62A 4Y9XA 5C1GA 4KC1A 3OC9A 2APCA 2AM5A 1R80A 1HM0A 3K8DA 1OMXA 2XWNA 4FREA 4HOCA 2YQJA 5IFYA 2J0AA 3I0FA 1FXJA 2AH9A 1G2VA 2FFUA 3V8ZA 1TW5A 1MP5A 4MYBA 1TZFA 1WVCA 4K6RA 2QGIA 4B5BA 1ON6A 4HO5A 3OGZA 1VZUA 4FRQA 2Z87A 4EEAA 4NAKA 3ZF8A 3U2VA 2Y4JA 5CQMX 3E25A 2RJ8A 1H5SB 5C8RA 3QVBA 1R7TA 2C0NA 2OEGA 2ZU9A 3V0MA 3OH1A 2JCJA 4HCQA 2X5ZA 3CKNA 5C47A 5JQQA 3OH0A 3SX3A 2D7IA 1H5SD 1NWGB 1MP4A 2I5EA 2BO7A 1GQ9A 5CMJA 2E8BA 2YQSA 4KT7A 2X65A 3SXEA 1O7QA 1FG5N 1H5TB 4Y6UA 3Q4SA 4FRHA 3JTJA 2VK9A 2W0WA 5J49A 3CKQA 4LW3A 4G87A 2PGVA 2FYBA 1S4PA 5CMHA 1H5RB 1FO8A 2AECA 4KC2A 1VPAA 4HO2A 1KWSA 1FWYA 1TVYA 2OI7A 3V0NA 2YQCA 3IOIA 5AJOA 4B42A 2FFVA 2A8WA 2WVLA 1W55A 3RSBA 2V0LA 4Y7TA 1GWWA 1EYRA 1ZI5A 1O7OA 4B2WA 3V0QA 2VS5A 1JV3A 2VXMA 3I0HA 3F1YA 5FTSA 5C1LA 1JVGA 3JUKA 4ASYA 3EE5A 3TQDA 3NGWA 5EIYA 1VH3A 1H5SC 1H7LA 5C4FA 1MC3A 1VZTA 4FIYA 2X5SA 2Y4KA 4ARWA 3ZLLA 3DK5A 1PZYB 2I5KA 2O1HA 5IDSA 2JCOA 3T7MA 4EE4A 4Y64A 1G0RA 4C2SA 4EEMA 3N9WA 4G3PA 1FGXA 1V82A 1NHEB 1OQMB 2W0VA 1K4VA 2V0JA 5FTVA 5FYEA 1ZJOA 1S4OA 4P00A 3I0DA 1FR8A 3U0YA 2V0HA 4G3SA 4Y7FA 3OH4A 4ASJA 2D7RA 4KNXA 1G8OA 1R7UA 5I1FA 1R82A 4Y7VA 2RITA 4KC4A 1JYKA 1ZI3A 1PZTA 1QGQA 4HO6A 3SX8A 1VICA 2JCLA 2Y4LA 2AESA 1WSZA 4Y7UA 1FO9A 2VSIA 5C4EA 2RJ1A 4FQWA 2Z86A 5FU0A 4KPXA 3FOQA 1NQIB 3CKVA 3IOJA 5C4DA 1ZCUA 2CU2A 3E26A 2PGYA 2JCKA 1H7TA 3V0LA 1VH1A 5HS2A 4FRAA 1YP2A 1LZ0A 3T7NA 5FUHA 5C3DA 2AM3A 3GUEA 5C4CA 1SS9A 1V83A 2RJ4A 3OH3A 2VXLA 2XWLA 1Z90A 1WT0A 2WVMA 3D98A 3U2XA 2VS4A 4BQHA 2D0JA 1LZJA 3PKPA 2VS3A 1R81A 1H3MA 2OEFA 2WEEA 4NAIA 1FGGA 2WE9A 4NALA 1H4CA 1VM8A 3SPTA 5C36A 3D8VA 1IIMA 1JVDA 2WGZA 5EJ1A 5IDTA 4FCUA 4D0TA 2V0IA 4G3QA 2ICXA 3V8YA 1FOAA 2E3DA 4R7PA 5D91A 2AGDA 1ZCVA 2ICYA 4HG6A 2GGOA 4D11C 1R7XA 4B4GA 2YESA 5CMFX 3TZTA 1LL3A 1WT3A 2WAWA 1FZWA 1H4DA 2FYCB 2O1GA 1YP3A 3K8EA 4HO4A 2RJ5A 3U2TA 4HO0A 4UEGA 2XMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIN A;  1R7V A;  1TW1 A;  2XME A;  4HO3 A;  4B4B A;  1HV9 A;  2P73 A;  3FWW A;  2RIZ A;  4DEC A;  1WT1 A;  3CU0 A;  4FRD A;  2AE7 A;  1HM8 A;  2YC3 A;  4JD0 A;  4FRM A;  1ZCT A;  4EE5 A;  4AYL A;  1FRW A;  1EZI A;  1V84 A;  2Q4J A;  2RJ7 A;  4LW6 A;  1O0R A;  3LW6 A;  3SXB A;  4EEO A;  4KQL A;  1LVW A;  1NKH B;  3OAM A;  5C1H A;  3JUJ A;  1ZI1 A;  1H7E A;  2BO4 A;  5EJZ A;  4AYJ A;  1HJL A;  4CJC A;  3OKR A;  4GBP A;  1GQC A;  2GGQ A;  2UX8 A;  2YCM A;  3USR A;  5C4B A;  4M2A A;  1G23 A;  1MP3 A;  4MND A;  2MZB A;  3PNN A;  1HJJ A;  4EVW A;  1H7G A;  1H7Q A;  1YP4 A;  2Y4M A;  4IRP A;  2VSH A;  3SXC A;  1LZ7 A;  5DDV A;  3ZLK A;  2FY7 A;  1G9R A;  1YRO B;  3I0K A;  4NAN A;  2NXV A;  2QKX A;  4KXO A;  4Y6N A;  2BO6 A;  4Y63 A;  4HO9 A;  4Y7G A;  3BCV A;  1QGS A;  3V0P A;  4FRP A;  5C48 A;  4D11 A;  1WT2 A;  2O1F A;  1H7F A;  2Y7A A;  2VFZ A;  2A8U A;  2PA4 A;  4EE3 A;  1ZJ1 A;  2P72 A;  3D5N A;  3I0J A;  3DUV A;  3Q7U A;  5CMG X;  3ZGF A;  3HL3 A;  4ZDQ A;  4IRQ A;  1LZI A;  3I0E A;  2RJ6 A;  1ZJ3 A;  1ZJ0 A;  2ZU8 A;  1VGZ A;  3POL A;  3KIA A;  4M28 A;  1VGT A;  2PX7 A;  5AJP A;  1ZDG A;  1H5S A;  2FYA A;  4AC3 A;  1R7Y A;  1GWV A;  4JIS A;  1ZDF A;  3OH2 A;  1H4E A;  1S4N A;  4YS8 A;  1VGU A;  4FRO A;  3PKQ A;  3I0I X;  5FU8 A;  3RMV A;  5C3B A;  1FR9 A;  1JV1 A;  4M4K A;  3R3I A;  3SXA A;  5FV9 A;  2FYD B;  5L6V A;  2ZU7 A;  1LL0 A;  1ZCY A;  2P6W A;  4KPZ A;  1H5T A;  1ZIZ A;  5DDT A;  4HO8 A;  5CMI A;  2OI6 A;  3V90 A;  3SXG A;  5CQO A;  1GX0 A;  1INI A;  4J18 A;  1QG8 A;  1G3L A;  1H5R A;  1GX4 A;  1G97 A;  1W77 A;  5C49 A;  3U2W A;  3O3P A;  4D0Z A;  1VGW A;  1INJ A;  3CGX A;  1ZI4 A;  4AAW A;  1NMM B;  2AM4 A;  2Y6P A;  1I52 A;  3V0O A;  4M2B A;  3R2W A;  2VD4 A;  3RMW A;  1G93 A;  3I0L A;  2QH5 A;  2V0K A;  3SX5 A;  3V91 A;  1XZ6 A;  4B2X A;  1GA8 A;  3SX7 A;  1O23 B;  4FRL A;  2I7B A;  3BRK X;  4D48 A;  1FXO A;  3F1C A;  4XWI A;  4B3U A;  2DPW A;  5BXC A;  1ZJ2 A;  4KNR A;  1XHB A;  3T7O A;  1G1L A;  4BMA A;  3CKJ A;  4FRB A;  4ECM A;  3ZGG A;  2XWM A;  4CVH A;  3Q80 A;  1VZX A;  2YC5 A;  3U2U A;  2WVK A;  4P02 A;  2RJ0 A;  2RIY A;  3DJ4 A;  1W57 A;  2BO8 A;  5CQN X;  5CQL X;  4CJ8 A;  1QWJ A;  1JYL A;  4KRV A;  4E1K A;  2X60 A;  3I0C A;  4CJB A;  5AJN A;  2OI5 A;  3SXD A;  4DDZ A;  1G95 A;  5L6S A;  1NF5 B;  4L41 C;  3U0X A;  4DE7 A;  2YQH A;  1ZJP A;  1E5K A;  1H7H A;  3I0G A;  3CKO A;  1ON8 A;  2RIX A;  3ST8 A;  1LL2 A;  2RJ9 A;  5CQP A;  1ZHJ A;  5C3A A;  3IOH A;  3USQ A;  5C38 A;  1HM9 A;  4B4M A;  4FCE A;  4EEG A;  1OMZ A;  4Y62 A;  4Y9X A;  5C1G A;  4KC1 A;  3OC9 A;  2APC A;  2AM5 A;  1R80 A;  1HM0 A;  3K8D A;  1OMX A;  2XWN A;  4FRE A;  4HOC A;  2YQJ A;  5IFY A;  3I0F A;  1FXJ A;  2AH9 A;  1G2V A;  2FFU A;  3V8Z A;  1TW5 A;  1MP5 A;  4MYB A;  1TZF A;  1WVC A;  4K6R A;  2QGI A;  4B5B A;  1ON6 A;  4HO5 A;  3OGZ A;  1VZU A;  4FRQ A;  2Z87 A;  4EEA A;  4NAK A;  3ZF8 A;  3U2V A;  2Y4J A;  5CQM X;  3E25 A;  2RJ8 A;  1H5S B;  5C8R A;  3QVB A;  1R7T A;  2OEG A;  2ZU9 A;  3V0M A;  3OH1 A;  2JCJ A;  4HCQ A;  2X5Z A;  3CKN A;  5C47 A;  5JQQ A;  3OH0 A;  3SX3 A;  2D7I A;  1H5S D;  1NWG B;  1MP4 A;  2I5E A;  2BO7 A;  1GQ9 A;  5CMJ A;  2E8B A;  2YQS A;  4KT7 A;  2X65 A;  3SXE A;  1O7Q A;  1FG5 N;  1H5T B;  4Y6U A;  3Q4S A;  4FRH A;  3JTJ A;  2W0W A;  5J49 A;  3CKQ A;  4LW3 A;  4G87 A;  2PGV A;  2FYB A;  1S4P A;  5CMH A;  1H5R B;  1FO8 A;  2AEC A;  4KC2 A;  1VPA A;  4HO2 A;  1KWS A;  1FWY A;  1TVY A;  2OI7 A;  3V0N A;  2YQC A;  3IOI A;  5AJO A;  4B42 A;  2FFV A;  2A8W A;  2WVL A;  1W55 A;  3RSB A;  2V0L A;  4Y7T A;  1GWW A;  1EYR A;  1ZI5 A;  1O7O A;  4B2W A;  3V0Q A;  2VS5 A;  1JV3 A;  2VXM A;  3I0H A;  3F1Y A;  5FTS A;  5C1L A;  1JVG A;  3JUK A;  4ASY A;  3EE5 A;  3TQD A;  3NGW A;  5EIY A;  1VH3 A;  1H5S C;  1H7L A;  5C4F A;  1MC3 A;  1VZT A;  2X5S A;  2Y4K A;  4ARW A;  3ZLL A;  3DK5 A;  1PZY B;  2I5K A;  2O1H A;  5IDS A;  2JCO A;  3T7M A;  4EE4 A;  4Y64 A;  1G0R A;  4C2S A;  4EEM A;  3N9W A;  4G3P A;  1FGX A;  1V82 A;  1NHE B;  1OQM B;  2W0V A;  1K4V A;  2V0J A;  5FTV A;  5FYE A;  1ZJO A;  1S4O A;  4P00 A;  3I0D A;  1FR8 A;  3U0Y A;  2V0H A;  4G3S A;  4Y7F A;  3OH4 A;  4ASJ A;  2D7R A;  4KNX A;  1G8O A;  1R7U A;  5I1F A;  1R82 A;  4Y7V A;  2RIT A;  4KC4 A;  1JYK A;  1ZI3 A;  1PZT A;  1QGQ A;  4HO6 A;  3SX8 A;  1VIC A;  2JCL A;  2Y4L A;  2AES A;  1WSZ A;  4Y7U A;  1FO9 A;  2VSI A;  5C4E A;  2RJ1 A;  4FQW A;  2Z86 A;  5FU0 A;  4KPX A;  3FOQ A;  1NQI B;  3CKV A;  3IOJ A;  5C4D A;  1ZCU A;  2CU2 A;  3E26 A;  2PGY A;  2JCK A;  1H7T A;  3V0L A;  1VH1 A;  5HS2 A;  4FRA A;  1YP2 A;  1LZ0 A;  3T7N A;  5FUH A;  5C3D A;  2AM3 A;  3GUE A;  5C4C A;  1SS9 A;  1V83 A;  2RJ4 A;  3OH3 A;  2VXL A;  2XWL A;  1Z90 A;  1WT0 A;  2WVM A;  3D98 A;  3U2X A;  2VS4 A;  4BQH A;  2D0J A;  1LZJ A;  3PKP A;  2VS3 A;  1R81 A;  1H3M A;  2OEF A;  2WEE A;  4NAI A;  1FGG A;  2WE9 A;  4NAL A;  1H4C A;  1VM8 A;  3SPT A;  5C36 A;  3D8V A;  1IIM A;  1JVD A;  2WGZ A;  5EJ1 A;  5IDT A;  4FCU A;  4D0T A;  2V0I A;  4G3Q A;  2ICX A;  3V8Y A;  1FOA A;  2E3D A;  4R7P A;  2AGD A;  1ZCV A;  2ICY A;  4HG6 A;  2GGO A;  4D11 C;  1R7X A;  4B4G A;  2YES A;  5CMF X;  3TZT A;  1LL3 A;  1WT3 A;  2WAW A;  1FZW A;  1H4D A;  2FYC B;  2O1G A;  1YP3 A;  3K8E A;  4HO4 A;  2RJ5 A;  3U2T A;  4HO0 A;  4UEG A;  2XMH A; 
#chains in the Genus database with same CATH topology
 1IIN A;  1R7V A;  1TW1 A;  2XME A;  4HO3 A;  4B4B A;  1HV9 A;  2P73 A;  3FWW A;  2RIZ A;  4DEC A;  1WT1 A;  3CU0 A;  4FRD A;  2AE7 A;  1HM8 A;  2YC3 A;  4JD0 A;  4FRM A;  1ZCT A;  4EE5 A;  4AYL A;  1FRW A;  1EZI A;  1V84 A;  2Q4J A;  2RJ7 A;  4LW6 A;  1O0R A;  3LW6 A;  3SXB A;  4EEO A;  4KQL A;  1LVW A;  1NKH B;  3OAM A;  5C1H A;  3JUJ A;  1ZI1 A;  1H7E A;  2BO4 A;  5EJZ A;  4AYJ A;  1HJL A;  4CJC A;  3OKR A;  4GBP A;  1GQC A;  2GGQ A;  2UX8 A;  2YCM A;  3USR A;  5C4B A;  4M2A A;  1G23 A;  1MP3 A;  4MND A;  2MZB A;  3PNN A;  1HJJ A;  4EVW A;  1H7G A;  1H7Q A;  1YP4 A;  2Y4M A;  4IRP A;  2VSH A;  3SXC A;  1LZ7 A;  5DDV A;  3ZLK A;  2FY7 A;  1G9R A;  1YRO B;  3I0K A;  4NAN A;  2NXV A;  2QKX A;  4KXO A;  4Y6N A;  2BO6 A;  4Y63 A;  4HO9 A;  4Y7G A;  3BCV A;  4MIX A;  1QGS A;  3V0P A;  4FRP A;  5C48 A;  4D11 A;  1WT2 A;  2O1F A;  1H7F A;  2Y7A A;  2VFZ A;  2A8U A;  2PA4 A;  4EE3 A;  1ZJ1 A;  2P72 A;  3D5N A;  3I0J A;  3DUV A;  3Q7U A;  5CMG X;  4Q7C A;  3ZGF A;  3HL3 A;  4ZDQ A;  4IRQ A;  1LZI A;  3I0E A;  2RJ6 A;  1ZJ3 A;  1ZJ0 A;  2ZU8 A;  1VGZ A;  3POL A;  3KIA A;  4M28 A;  1VGT A;  2PX7 A;  5AJP A;  1ZDG A;  1H5S A;  2FYA A;  4AC3 A;  1R7Y A;  1GWV A;  4JIS A;  1ZDF A;  3OH2 A;  1H4E A;  1S4N A;  4YS8 A;  1VGU A;  4FRO A;  3PKQ A;  3I0I X;  5FU8 A;  3RMV A;  5C3B A;  1FR9 A;  1JV1 A;  4M4K A;  3R3I A;  3SXA A;  5FV9 A;  2FYD B;  5L6V A;  2ZU7 A;  1LL0 A;  1ZCY A;  2P6W A;  4KPZ A;  1H5T A;  1ZIZ A;  5DDT A;  4HO8 A;  5CMI A;  2OI6 A;  3V90 A;  3SXG A;  5CQO A;  1GX0 A;  1INI A;  4J18 A;  1QG8 A;  1G3L A;  1H5R A;  1GX4 A;  1G97 A;  1W77 A;  5C49 A;  3U2W A;  3O3P A;  4D0Z A;  1VGW A;  1INJ A;  3CGX A;  1ZI4 A;  4AAW A;  1NMM B;  2AM4 A;  2Y6P A;  1I52 A;  5D92 A;  3V0O A;  4M2B A;  3R2W A;  2VD4 A;  3RMW A;  1G93 A;  3I0L A;  2QH5 A;  2V0K A;  3SX5 A;  3V91 A;  1XZ6 A;  4B2X A;  1GA8 A;  3SX7 A;  1O23 B;  4FRL A;  2I7B A;  3BRK X;  4D48 A;  1FXO A;  4O6M A;  3F1C A;  4XWI A;  4B3U A;  2DPW A;  5BXC A;  1ZJ2 A;  4KNR A;  1XHB A;  3T7O A;  1G1L A;  4BMA A;  3CKJ A;  4FRB A;  4ECM A;  3ZGG A;  2XWM A;  4CVH A;  2J0B A;  1VZX A;  3Q80 A;  2YC5 A;  3U2U A;  2WVK A;  4P02 A;  2RJ0 A;  2RIY A;  3DJ4 A;  1W57 A;  2BO8 A;  5CQN X;  5CQL X;  4CJ8 A;  1QWJ A;  1JYL A;  4FIX A;  4KRV A;  4E1K A;  2X60 A;  3I0C A;  4CJB A;  5AJN A;  2OI5 A;  3SXD A;  4DDZ A;  1G95 A;  5L6S A;  1NF5 B;  4L41 C;  3U0X A;  4DE7 A;  2YQH A;  1ZJP A;  1E5K A;  1H7H A;  3I0G A;  4O6N A;  3CKO A;  1ON8 A;  2RIX A;  3ST8 A;  1LL2 A;  2RJ9 A;  5CQP A;  1ZHJ A;  5C3A A;  3IOH A;  3USQ A;  5C38 A;  1HM9 A;  4B4M A;  4FCE A;  4EEG A;  1OMZ A;  4Y62 A;  4Y9X A;  5C1G A;  4KC1 A;  3OC9 A;  2APC A;  2AM5 A;  1R80 A;  1HM0 A;  3K8D A;  1OMX A;  2XWN A;  4FRE A;  4HOC A;  2YQJ A;  5IFY A;  2J0A A;  3I0F A;  1FXJ A;  2AH9 A;  1G2V A;  2FFU A;  3V8Z A;  1TW5 A;  1MP5 A;  4MYB A;  1TZF A;  1WVC A;  4K6R A;  2QGI A;  4B5B A;  1ON6 A;  4HO5 A;  3OGZ A;  1VZU A;  4FRQ A;  2Z87 A;  4EEA A;  4NAK A;  3ZF8 A;  3U2V A;  2Y4J A;  5CQM X;  3E25 A;  2RJ8 A;  1H5S B;  5C8R A;  3QVB A;  1R7T A;  2C0N A;  2OEG A;  2ZU9 A;  3V0M A;  3OH1 A;  2JCJ A;  4HCQ A;  2X5Z A;  3CKN A;  5C47 A;  5JQQ A;  3OH0 A;  3SX3 A;  2D7I A;  1H5S D;  1NWG B;  1MP4 A;  2I5E A;  2BO7 A;  1GQ9 A;  5CMJ A;  2E8B A;  2YQS A;  4KT7 A;  2X65 A;  3SXE A;  1O7Q A;  1FG5 N;  1H5T B;  4Y6U A;  3Q4S A;  4FRH A;  3JTJ A;  2VK9 A;  2W0W A;  5J49 A;  3CKQ A;  4LW3 A;  4G87 A;  2PGV A;  2FYB A;  1S4P A;  5CMH A;  1H5R B;  1FO8 A;  2AEC A;  4KC2 A;  1VPA A;  4HO2 A;  1KWS A;  1FWY A;  1TVY A;  2OI7 A;  3V0N A;  2YQC A;  3IOI A;  5AJO A;  4B42 A;  2FFV A;  2A8W A;  2WVL A;  1W55 A;  3RSB A;  2V0L A;  4Y7T A;  1GWW A;  1EYR A;  1ZI5 A;  1O7O A;  4B2W A;  3V0Q A;  2VS5 A;  1JV3 A;  2VXM A;  3I0H A;  3F1Y A;  5FTS A;  5C1L A;  1JVG A;  3JUK A;  4ASY A;  3EE5 A;  3TQD A;  3NGW A;  5EIY A;  1VH3 A;  1H5S C;  1H7L A;  5C4F A;  1MC3 A;  1VZT A;  4FIY A;  2X5S A;  2Y4K A;  4ARW A;  3ZLL A;  3DK5 A;  1PZY B;  2I5K A;  2O1H A;  5IDS A;  2JCO A;  3T7M A;  4EE4 A;  4Y64 A;  1G0R A;  4C2S A;  4EEM A;  3N9W A;  4G3P A;  1FGX A;  1V82 A;  1NHE B;  1OQM B;  2W0V A;  1K4V A;  2V0J A;  5FTV A;  5FYE A;  1ZJO A;  1S4O A;  4P00 A;  3I0D A;  1FR8 A;  3U0Y A;  2V0H A;  4G3S A;  4Y7F A;  3OH4 A;  4ASJ A;  2D7R A;  4KNX A;  1G8O A;  1R7U A;  5I1F A;  1R82 A;  4Y7V A;  2RIT A;  4KC4 A;  1JYK A;  1ZI3 A;  1PZT A;  1QGQ A;  4HO6 A;  3SX8 A;  1VIC A;  2JCL A;  2Y4L A;  2AES A;  1WSZ A;  4Y7U A;  1FO9 A;  2VSI A;  5C4E A;  2RJ1 A;  4FQW A;  2Z86 A;  5FU0 A;  4KPX A;  3FOQ A;  1NQI B;  3CKV A;  3IOJ A;  5C4D A;  1ZCU A;  2CU2 A;  3E26 A;  2PGY A;  2JCK A;  1H7T A;  3V0L A;  1VH1 A;  5HS2 A;  4FRA A;  1YP2 A;  1LZ0 A;  3T7N A;  5FUH A;  5C3D A;  2AM3 A;  3GUE A;  5C4C A;  1SS9 A;  1V83 A;  2RJ4 A;  3OH3 A;  2VXL A;  2XWL A;  1Z90 A;  1WT0 A;  2WVM A;  3D98 A;  3U2X A;  2VS4 A;  4BQH A;  2D0J A;  1LZJ A;  3PKP A;  2VS3 A;  1R81 A;  1H3M A;  2OEF A;  2WEE A;  4NAI A;  1FGG A;  2WE9 A;  4NAL A;  1H4C A;  1VM8 A;  3SPT A;  5C36 A;  3D8V A;  1IIM A;  1JVD A;  2WGZ A;  5EJ1 A;  5IDT A;  4FCU A;  4D0T A;  2V0I A;  4G3Q A;  2ICX A;  3V8Y A;  1FOA A;  2E3D A;  4R7P A;  5D91 A;  2AGD A;  1ZCV A;  2ICY A;  4HG6 A;  2GGO A;  4D11 C;  1R7X A;  4B4G A;  2YES A;  5CMF X;  3TZT A;  1LL3 A;  1WT3 A;  2WAW A;  1FZW A;  1H4D A;  2FYC B;  2O1G A;  1YP3 A;  3K8E A;  4HO4 A;  2RJ5 A;  3U2T A;  4HO0 A;  4UEG A;  2XMH A; 
#chains in the Genus database with same CATH homology
 1IIN A;  1R7V A;  1TW1 A;  2XME A;  4HO3 A;  4B4B A;  1HV9 A;  2P73 A;  3FWW A;  2RIZ A;  4DEC A;  1WT1 A;  3CU0 A;  4FRD A;  2AE7 A;  1HM8 A;  2YC3 A;  4JD0 A;  4FRM A;  1ZCT A;  4EE5 A;  4AYL A;  1FRW A;  1EZI A;  1V84 A;  2Q4J A;  2RJ7 A;  4LW6 A;  1O0R A;  3LW6 A;  3SXB A;  4EEO A;  4KQL A;  1LVW A;  1NKH B;  3OAM A;  5C1H A;  3JUJ A;  1ZI1 A;  1H7E A;  2BO4 A;  5EJZ A;  4AYJ A;  1HJL A;  4CJC A;  3OKR A;  4GBP A;  1GQC A;  2GGQ A;  2UX8 A;  2YCM A;  3USR A;  5C4B A;  4M2A A;  1G23 A;  1MP3 A;  4MND A;  2MZB A;  3PNN A;  1HJJ A;  4EVW A;  1H7G A;  1H7Q A;  1YP4 A;  2Y4M A;  4IRP A;  2VSH A;  3SXC A;  1LZ7 A;  5DDV A;  3ZLK A;  2FY7 A;  1G9R A;  1YRO B;  3I0K A;  4NAN A;  2NXV A;  2QKX A;  4KXO A;  4Y6N A;  2BO6 A;  4Y63 A;  4HO9 A;  4Y7G A;  3BCV A;  4MIX A;  1QGS A;  3V0P A;  4FRP A;  5C48 A;  4D11 A;  1WT2 A;  2O1F A;  1H7F A;  2Y7A A;  2VFZ A;  2A8U A;  2PA4 A;  4EE3 A;  1ZJ1 A;  2P72 A;  3D5N A;  3I0J A;  3DUV A;  3Q7U A;  5CMG X;  4Q7C A;  3ZGF A;  3HL3 A;  4ZDQ A;  4IRQ A;  1LZI A;  3I0E A;  2RJ6 A;  1ZJ3 A;  1ZJ0 A;  2ZU8 A;  1VGZ A;  3POL A;  3KIA A;  4M28 A;  1VGT A;  2PX7 A;  5AJP A;  1ZDG A;  1H5S A;  2FYA A;  4AC3 A;  1R7Y A;  1GWV A;  4JIS A;  1ZDF A;  3OH2 A;  1H4E A;  1S4N A;  4YS8 A;  1VGU A;  4FRO A;  3PKQ A;  3I0I X;  5FU8 A;  3RMV A;  5C3B A;  1FR9 A;  1JV1 A;  4M4K A;  3R3I A;  3SXA A;  5FV9 A;  2FYD B;  5L6V A;  2ZU7 A;  1LL0 A;  1ZCY A;  2P6W A;  4KPZ A;  1H5T A;  1ZIZ A;  5DDT A;  4HO8 A;  5CMI A;  2OI6 A;  3V90 A;  3SXG A;  5CQO A;  1GX0 A;  1INI A;  4J18 A;  1QG8 A;  1G3L A;  1H5R A;  1GX4 A;  1G97 A;  1W77 A;  5C49 A;  3U2W A;  3O3P A;  4D0Z A;  1VGW A;  1INJ A;  3CGX A;  1ZI4 A;  4AAW A;  1NMM B;  2AM4 A;  2Y6P A;  1I52 A;  5D92 A;  3V0O A;  4M2B A;  3R2W A;  2VD4 A;  3RMW A;  1G93 A;  3I0L A;  2QH5 A;  2V0K A;  3SX5 A;  3V91 A;  1XZ6 A;  4B2X A;  1GA8 A;  3SX7 A;  1O23 B;  4FRL A;  2I7B A;  3BRK X;  4D48 A;  1FXO A;  4O6M A;  3F1C A;  4XWI A;  4B3U A;  2DPW A;  5BXC A;  1ZJ2 A;  4KNR A;  1XHB A;  3T7O A;  1G1L A;  4BMA A;  3CKJ A;  4FRB A;  4ECM A;  3ZGG A;  2XWM A;  4CVH A;  2J0B A;  1VZX A;  3Q80 A;  2YC5 A;  3U2U A;  2WVK A;  4P02 A;  2RJ0 A;  2RIY A;  3DJ4 A;  1W57 A;  2BO8 A;  5CQN X;  5CQL X;  4CJ8 A;  1QWJ A;  1JYL A;  4FIX A;  4KRV A;  4E1K A;  2X60 A;  3I0C A;  4CJB A;  5AJN A;  2OI5 A;  3SXD A;  4DDZ A;  1G95 A;  5L6S A;  1NF5 B;  4L41 C;  3U0X A;  4DE7 A;  2YQH A;  1ZJP A;  1E5K A;  1H7H A;  3I0G A;  4O6N A;  3CKO A;  1ON8 A;  2RIX A;  3ST8 A;  1LL2 A;  2RJ9 A;  5CQP A;  1ZHJ A;  5C3A A;  3IOH A;  3USQ A;  5C38 A;  1HM9 A;  4B4M A;  4FCE A;  4EEG A;  1OMZ A;  4Y62 A;  4Y9X A;  5C1G A;  4KC1 A;  3OC9 A;  2APC A;  2AM5 A;  1R80 A;  1HM0 A;  3K8D A;  1OMX A;  2XWN A;  4FRE A;  4HOC A;  2YQJ A;  5IFY A;  2J0A A;  3I0F A;  1FXJ A;  2AH9 A;  1G2V A;  2FFU A;  3V8Z A;  1TW5 A;  1MP5 A;  4MYB A;  1TZF A;  1WVC A;  4K6R A;  2QGI A;  4B5B A;  1ON6 A;  4HO5 A;  3OGZ A;  1VZU A;  4FRQ A;  2Z87 A;  4EEA A;  4NAK A;  3ZF8 A;  3U2V A;  2Y4J A;  5CQM X;  3E25 A;  2RJ8 A;  1H5S B;  5C8R A;  3QVB A;  1R7T A;  2C0N A;  2OEG A;  2ZU9 A;  3V0M A;  3OH1 A;  2JCJ A;  4HCQ A;  2X5Z A;  3CKN A;  5C47 A;  5JQQ A;  3OH0 A;  3SX3 A;  2D7I A;  1H5S D;  1NWG B;  1MP4 A;  2I5E A;  2BO7 A;  1GQ9 A;  5CMJ A;  2E8B A;  2YQS A;  4KT7 A;  2X65 A;  3SXE A;  1O7Q A;  1FG5 N;  1H5T B;  4Y6U A;  3Q4S A;  4FRH A;  3JTJ A;  2VK9 A;  2W0W A;  5J49 A;  3CKQ A;  4LW3 A;  4G87 A;  2PGV A;  2FYB A;  1S4P A;  5CMH A;  1H5R B;  1FO8 A;  2AEC A;  4KC2 A;  1VPA A;  4HO2 A;  1KWS A;  1FWY A;  1TVY A;  2OI7 A;  3V0N A;  2YQC A;  3IOI A;  5AJO A;  4B42 A;  2FFV A;  2A8W A;  2WVL A;  1W55 A;  3RSB A;  2V0L A;  4Y7T A;  1GWW A;  1EYR A;  1ZI5 A;  1O7O A;  4B2W A;  3V0Q A;  2VS5 A;  1JV3 A;  2VXM A;  3I0H A;  3F1Y A;  5FTS A;  5C1L A;  1JVG A;  3JUK A;  4ASY A;  3EE5 A;  3TQD A;  3NGW A;  5EIY A;  1VH3 A;  1H5S C;  1H7L A;  5C4F A;  1MC3 A;  1VZT A;  4FIY A;  2X5S A;  2Y4K A;  4ARW A;  3ZLL A;  3DK5 A;  1PZY B;  2I5K A;  2O1H A;  5IDS A;  2JCO A;  3T7M A;  4EE4 A;  4Y64 A;  1G0R A;  4C2S A;  4EEM A;  3N9W A;  4G3P A;  1FGX A;  1V82 A;  1NHE B;  1OQM B;  2W0V A;  1K4V A;  2V0J A;  5FTV A;  5FYE A;  1ZJO A;  1S4O A;  4P00 A;  3I0D A;  1FR8 A;  3U0Y A;  2V0H A;  4G3S A;  4Y7F A;  3OH4 A;  4ASJ A;  2D7R A;  4KNX A;  1G8O A;  1R7U A;  5I1F A;  1R82 A;  4Y7V A;  2RIT A;  4KC4 A;  1JYK A;  1ZI3 A;  1PZT A;  1QGQ A;  4HO6 A;  3SX8 A;  1VIC A;  2JCL A;  2Y4L A;  2AES A;  1WSZ A;  4Y7U A;  1FO9 A;  2VSI A;  5C4E A;  2RJ1 A;  4FQW A;  2Z86 A;  5FU0 A;  4KPX A;  3FOQ A;  1NQI B;  3CKV A;  3IOJ A;  5C4D A;  1ZCU A;  2CU2 A;  3E26 A;  2PGY A;  2JCK A;  1H7T A;  3V0L A;  1VH1 A;  5HS2 A;  4FRA A;  1YP2 A;  1LZ0 A;  3T7N A;  5FUH A;  5C3D A;  2AM3 A;  3GUE A;  5C4C A;  1SS9 A;  1V83 A;  2RJ4 A;  3OH3 A;  2VXL A;  2XWL A;  1Z90 A;  1WT0 A;  2WVM A;  3D98 A;  3U2X A;  2VS4 A;  4BQH A;  2D0J A;  1LZJ A;  3PKP A;  2VS3 A;  1R81 A;  1H3M A;  2OEF A;  2WEE A;  4NAI A;  1FGG A;  2WE9 A;  4NAL A;  1H4C A;  1VM8 A;  3SPT A;  5C36 A;  3D8V A;  1IIM A;  1JVD A;  2WGZ A;  5EJ1 A;  5IDT A;  4FCU A;  4D0T A;  2V0I A;  4G3Q A;  2ICX A;  3V8Y A;  1FOA A;  2E3D A;  4R7P A;  5D91 A;  2AGD A;  1ZCV A;  2ICY A;  4HG6 A;  2GGO A;  4D11 C;  1R7X A;  4B4G A;  2YES A;  5CMF X;  3TZT A;  1LL3 A;  1WT3 A;  2WAW A;  1FZW A;  1H4D A;  2FYC B;  2O1G A;  1YP3 A;  3K8E A;  4HO4 A;  2RJ5 A;  3U2T A;  4HO0 A;  4UEG A;  2XMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...