1GA8A

Crystal structure of galacosyltransferase lgtc in complex with donor and acceptor sugar analogs.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
278
Chain Sequence
MDIVFAADDNYAAYLCVAAKSVEAAHPDTEIRFHVLDAGISEANRAAVAANLRGGGGNIRFIDVNPEDFAGFPLNIRHISITTYARLKLGEYIADCDKVLYLDIDVLVRDSLTPLWDTDLGDNWLGASIDLFVERQEGYKQKIGMADGEYYFNAGVLLINLKKWRRHDIFKMSSEWVEQYKDVMQYQDQDILNGLFKGGVCYANSRFNFMPTNYAFMASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAWGAERFTELAGSLTTVPEEWRGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GALACTOSYL TRANSFERASE LGTC
publication title Crystal structure of the retaining galactosyltransferase LgtC from Neisseria meningitidis in complex with donor and acceptor sugar analogs.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 91
structure length 278
sequence length 282
ec nomenclature ec 2.4.1.44: Lipopolysaccharide 3-alpha-galactosyltransferase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1ga8A00
1H3MA 3SXEA 1ZI4A 4B2WA 2FFVA 3RMWA 5C48A 3T7NA 3U2WA 5IFYA 5CQMX 5C4EA 4B3UA 3SXDA 4Y7VA 2AM3A 2W0WA 1LZ7A 4FRQA 2RJ8A 5DDVA 2VXMA 1H5SB 3RMVA 3EE5A 4CVHA 2WEEA 4DDZA 1FGGA 2AM5A 1WSZA 2WVLA 2QGIA 2XWLA 4IRPA 2BO8A 3PNNA 3V0NA 3HL3A 3CKOA 1ZIZA 2RJ4A 2I7BA 4NANA 1LZJA 3ZGFA 1NWGB 2JCKA 2Y4JA 2Q4JA 3CKVA 1H7LA 5EJZA 4FCUA 3NGWA 3CKJA 2X5SA 4EEMA 1WT2A 3N9WA 2AH9A 4B4GA 2XWMA 4KC2A 5FUHA 5C47A 5CQOA 3OH4A 3Q80A 4FRHA 1S4OA 1WT0A 2BO4A 1YROB 1MP3A 4AYLA 2RJ1A 5IDTA 4HO9A 3V90A 2E3DA 3E25A 1NKHB 4B2XA 4EEOA 2O1GA 1H5SD 5IDSA 2O1HA 1HV9A 1R7XA 1JV1A 3SX8A 2XWNA 5AJNA 4EE3A 1ZJ1A 3BCVA 4E1KA 1WT1A 4JD0A 1H4EA 1R80A 5C36A 5C38A 4BMAA 2GGQA 4FRBA 1VZTA 4Y7TA 2OI5A 4KPXA 1VGZA 2V0LA 5CMFX 3Q4SA 3T7OA 3I0FA 1H5RB 1TW5A 1H7GA 1GA8A 3IOJA 2P72A 2WE9A 1VZUA 4HO8A 5L6VA 2W0VA 1G93A 2YQHA 2JCLA 2Y4LA 1H5TB 1V84A 5L6SA 3U0YA 3D5NA 2PGVA 2FYAA 3I0EA 1R82A 1JYKA 4HOCA 1FXOA 5C8RA 1MC3A 1H4DA 4Y62A 2RITA 2Y6PA 2D0JA 3JTJA 4MNDA 2ZU9A 1WT3A 1YP2A 3O3PA 4Y64A 2OI6A 2D7RA 3I0DA 3PKPA 3I0HA 2YC5A 1QWJA 4AC3A 4L41C 1O7OA 1YP4A 5C4FA 3T7MA 1EZIA 3ZLLA 3OC9A 4D11C 4G87A 3IOIA 3Q7UA 4KRVA 5C4CA 1TW1A 1FOAA 1G8OA 4HO5A 4M4KA 5BXCA 1R7TA 1G95A 1ZDGA 1OQMB 2GGOA 3SX5A 4Y9XA 1NMMB 3GUEA 2VS5A 5FYEA 1NF5B 3JUJA 5EIYA 1HM0A 1Z90A 3F1CA 4KQLA 3SX3A 5FU0A 4B4BA 2PX7A 1H5SC 1FO8A 4LW3A 4M2AA 1S4NA 1E5KA 2MZBA 2V0KA 1IINA 1FR8A 2A8WA 4EEAA 1FXJA 1ZJOA 4M28A 1H7FA 4Y6NA 2P6WA 3SXAA 1K4VA 2Y7AA 4GBPA 5C4DA 3TZTA 1G23A 4Y7UA 4BQHA 2WVMA 3V0QA 2YQCA 2X5ZA 2E8BA 1HM8A 3OH0A 4UEGA 2APCA 3FOQA 2VD4A 4KXOA 1QG8A 1ZJPA 2PGYA 1VZXA 3I0JA 4FRAA 1FG5N 2JCOA 1GX4A 1S4PA 5CMIA 1H7TA 2AE7A 2Z86A 1V83A 2UX8A 5C4BA 1G9RA 4FQWA 1PZTA 1ZCVA 1INIA 1R7VA 1O0RA 4MYBA 3KIAA 4NALA 2CU2A 2AECA 2X60A 3OH3A 1GWWA 5FTVA 2QKXA 2WAWA 2Y4KA 1FR9A 3V0OA 1MP5A 4FRPA 1VGUA 2A8UA 2OI7A 4K6RA 1ZJ0A 4EE5A 4FROA 4XWIA 2Z87A 4AYJA 1O7QA 4Y6UA 5C1LA 2RIZA 2RJ6A 4B4MA 3LW6A 5C1GA 3JUKA 4ASYA 4Y7FA 1V82A 3SPTA 2ZU8A 3U2UA 4G3SA 1O23B 4HO3A 1EYRA 2VS3A 2YQJA 2BO7A 2XMEA 1VGWA 4EEGA 4AAWA 4D0TA 2VSHA 3ZGGA 3V91A 4G3QA 2RIYA 4EVWA 3U2XA 2RJ9A 2FYDB 4KC4A 1LZIA 2D7IA 2FYCB 2AGDA 3K8EA 1R7YA 3USQA 4HO2A 5CQNX 1VICA 2XMHA 1VPAA 2VFZA 1MP4A 1ZCYA 3FWWA 2YC3A 4D11A 1QGQA 3I0LA 3V8YA 3OH2A 1H7EA 1G1LA 3V0LA 1LZ0A 5CMJA 1INJA 1R81A 4FRDA 3I0CA 2ICYA 3BRKX 4EE4A 1ZHJA 5J49A 5C3DA 1OMZA 3D98A 3POLA 4ASJA 1GQ9A 3TQDA 2RJ7A 3CKNA 4M2BA 2X65A 2BO6A 1GQCA 5C3BA 4Y7GA 4LW6A 1H5SA 1G2VA 1FRWA 3ZF8A 4HG6A 1FGXA 3IOHA 5HS2A 5C1HA 4DE7A 2JCJA 4FCEA 4D48A 4FRLA 1LL3A 1ON8A 1G97A 2ZU7A 2V0JA 2FFUA 2FYBA 1JVDA 4CJBA 3OGZA 3V0MA 3PKQA 5C3AA 3CKQA 4JISA 4C2SA 1ON6A 2OEGA 5C49A 2NXVA 5I1FA 3V8ZA 1ZCTA 3USRA 4FREA 1ZCUA 3I0GA 1SS9A 1ZI1A 1ZJ3A 1HJLA 2Y4MA 2I5EA 4ARWA 4B42A 2P73A 3R3IA 1ZDFA 1OMXA 3R2WA 1H7HA 1TVYA 4HO6A 1GX0A 1G3LA 1HJJA 1GWVA 5EJ1A 1H5RA 1VM8A 1YP3A 1ZI5A 4NAKA 1W55A 2ICXA 3I0IX 1FO9A 2VS4A 3SXCA 4NAIA 2AESA 1H7QA 2YQSA 3K8DA 1H4CA 4Y63A 1NQIB 3U2VA 1LVWA 1R7UA 4KT7A 1H5TA 1FZWA 5DDTA 2RIXA 4HCQA 3DJ4A 4KC1A 5CMHA 4P02A 4YS8A 5JQQA 3OH1A 4KNXA 4FRMA 3SXBA 1XHBA 4CJ8A 3RSBA 1G0RA 4B5BA 1LL2A 3QVBA 1VH3A 1PZYB 1QGSA 2RJ5A 3ZLKA 1IIMA 1JYLA 3SX7A 1KWSA 3U0XA 1W57A 1ZJ2A 2YCMA 2O1FA 3CGXA 2RJ0A 4DECA 4D0ZA 1ZI3A 2V0IA 4ZDQA 5CQPA 1NHEB 2QH5A 5AJPA 4P00A 2V0HA 5AJOA 1LL0A 2AM4A 4CJCA 2WVKA 3OAMA 5FTSA 2OEFA 4J18A 4ECMA 2VSIA 2WGZA 2DPWA 5CMGX 3CU0A 1I52A 3F1YA 3ST8A 1WVCA 3SXGA 1W77A 5FU8A 5CQLX 4HO4A 1XZ6A 2YESA 2PA4A 2I5KA 3OKRA 4G3PA 1HM9A 1FWYA 1VH1A 4KNRA 3E26A 4IRQA 1VGTA 1JV3A 3I0KA 3DUVA 1TZFA 5FV9A 3V0PA 3DK5A 1JVGA 2FY7A 4HO0A 2VXLA 3U2TA 4KPZA 4R7PA 3D8VA
chains in the Genus database with same CATH superfamily
1H3MA 3SXEA 1ZI4A 4B2WA 2FFVA 3RMWA 5C48A 3T7NA 3U2WA 5IFYA 5CQMX 5C4EA 4B3UA 3SXDA 4Y7VA 2AM3A 2W0WA 1LZ7A 4FRQA 2RJ8A 5DDVA 2VXMA 1H5SB 3RMVA 3EE5A 4FIXA 4CVHA 2WEEA 4DDZA 1FGGA 5D91A 2AM5A 1WSZA 2WVLA 2QGIA 2XWLA 4IRPA 2BO8A 3PNNA 3V0NA 3HL3A 3CKOA 1ZIZA 2RJ4A 2I7BA 4NANA 1LZJA 3ZGFA 1NWGB 2JCKA 2Y4JA 2Q4JA 3CKVA 1H7LA 5EJZA 4FCUA 3NGWA 3CKJA 2X5SA 4EEMA 1WT2A 3N9WA 2AH9A 4B4GA 2XWMA 4KC2A 5FUHA 5C47A 5CQOA 3OH4A 3Q80A 4FRHA 1S4OA 1WT0A 2BO4A 1YROB 1MP3A 4AYLA 2RJ1A 5IDTA 4HO9A 3V90A 2E3DA 3E25A 1NKHB 4B2XA 4EEOA 2O1GA 1H5SD 5IDSA 2O1HA 1HV9A 1R7XA 1JV1A 3SX8A 2XWNA 5AJNA 4EE3A 1ZJ1A 3BCVA 4E1KA 1WT1A 4JD0A 1H4EA 1R80A 5C36A 5C38A 4BMAA 2GGQA 4FRBA 1VZTA 4Y7TA 2OI5A 4KPXA 1VGZA 2V0LA 5CMFX 3Q4SA 3T7OA 3I0FA 1H5RB 1TW5A 1H7GA 1GA8A 3IOJA 2P72A 2WE9A 1VZUA 4HO8A 5L6VA 2W0VA 1G93A 2YQHA 2JCLA 2Y4LA 1H5TB 1V84A 5L6SA 3U0YA 3D5NA 2PGVA 2FYAA 3I0EA 1R82A 2VK9A 1JYKA 4HOCA 1FXOA 5C8RA 1MC3A 1H4DA 4Y62A 2RITA 2Y6PA 2D0JA 3JTJA 4MNDA 2ZU9A 1WT3A 1YP2A 3O3PA 4Y64A 2OI6A 2D7RA 3I0DA 3PKPA 3I0HA 2YC5A 1QWJA 4AC3A 4L41C 1O7OA 1YP4A 5C4FA 3T7MA 1EZIA 3ZLLA 3OC9A 4D11C 4G87A 3IOIA 3Q7UA 4KRVA 5C4CA 1TW1A 1FOAA 1G8OA 2J0AA 4HO5A 4M4KA 5BXCA 1R7TA 1G95A 1ZDGA 1OQMB 2GGOA 3SX5A 4Y9XA 1NMMB 3GUEA 4Q7CA 2VS5A 5FYEA 1NF5B 3JUJA 5EIYA 1HM0A 1Z90A 3F1CA 4KQLA 3SX3A 5FU0A 4B4BA 2PX7A 1H5SC 1FO8A 4LW3A 4M2AA 1S4NA 1E5KA 2MZBA 2V0KA 1IINA 1FR8A 2A8WA 4EEAA 1FXJA 1ZJOA 4M28A 1H7FA 4Y6NA 2P6WA 3SXAA 1K4VA 2Y7AA 4GBPA 5C4DA 3TZTA 1G23A 4Y7UA 4BQHA 2WVMA 4MIXA 3V0QA 2YQCA 2X5ZA 2E8BA 5D92A 1HM8A 3OH0A 4UEGA 2APCA 3FOQA 2VD4A 4KXOA 1QG8A 1ZJPA 2PGYA 1VZXA 3I0JA 4FRAA 1FG5N 2JCOA 1GX4A 1S4PA 5CMIA 1H7TA 2AE7A 2Z86A 1V83A 2UX8A 5C4BA 1G9RA 4FQWA 1PZTA 1ZCVA 1INIA 1R7VA 1O0RA 4MYBA 3KIAA 4NALA 2CU2A 2AECA 2X60A 3OH3A 1GWWA 5FTVA 2QKXA 2WAWA 2Y4KA 1FR9A 3V0OA 1MP5A 4FRPA 1VGUA 2A8UA 2OI7A 4K6RA 1ZJ0A 4EE5A 4FROA 4XWIA 2Z87A 4AYJA 1O7QA 4Y6UA 5C1LA 2RIZA 2RJ6A 4B4MA 3LW6A 5C1GA 3JUKA 4ASYA 4Y7FA 2C0NA 4O6MA 1V82A 3SPTA 2ZU8A 3U2UA 2J0BA 4G3SA 1O23B 4HO3A 1EYRA 2VS3A 2YQJA 2BO7A 2XMEA 1VGWA 4EEGA 4AAWA 4D0TA 2VSHA 3ZGGA 3V91A 4G3QA 2RIYA 4EVWA 3U2XA 2RJ9A 2FYDB 4KC4A 1LZIA 2D7IA 2FYCB 2AGDA 3K8EA 1R7YA 3USQA 4HO2A 5CQNX 1VICA 2XMHA 1VPAA 2VFZA 1MP4A 1ZCYA 3FWWA 2YC3A 4D11A 1QGQA 3I0LA 3V8YA 3OH2A 1H7EA 1G1LA 3V0LA 1LZ0A 5CMJA 1INJA 1R81A 4FRDA 3I0CA 2ICYA 3BRKX 4EE4A 1ZHJA 5J49A 5C3DA 1OMZA 3D98A 3POLA 4ASJA 1GQ9A 3TQDA 2RJ7A 3CKNA 4M2BA 2X65A 2BO6A 1GQCA 5C3BA 4Y7GA 4LW6A 1H5SA 1G2VA 1FRWA 3ZF8A 4HG6A 1FGXA 3IOHA 5HS2A 5C1HA 4DE7A 2JCJA 4FCEA 4D48A 4FRLA 1LL3A 1ON8A 1G97A 4O6NA 2ZU7A 2V0JA 2FFUA 2FYBA 1JVDA 4CJBA 3OGZA 3V0MA 3PKQA 5C3AA 3CKQA 4JISA 4C2SA 1ON6A 2OEGA 5C49A 2NXVA 5I1FA 3V8ZA 1ZCTA 3USRA 4FREA 1ZCUA 3I0GA 1SS9A 1ZI1A 1ZJ3A 1HJLA 2Y4MA 2I5EA 4ARWA 4B42A 2P73A 3R3IA 1ZDFA 1OMXA 3R2WA 1H7HA 1TVYA 4HO6A 1GX0A 1G3LA 1HJJA 1GWVA 5EJ1A 1H5RA 1VM8A 1YP3A 1ZI5A 4NAKA 1W55A 2ICXA 3I0IX 1FO9A 2VS4A 3SXCA 4NAIA 2AESA 1H7QA 2YQSA 3K8DA 1H4CA 4Y63A 1NQIB 3U2VA 1LVWA 1R7UA 4KT7A 1H5TA 1FZWA 5DDTA 2RIXA 4HCQA 3DJ4A 4KC1A 5CMHA 4P02A 4YS8A 5JQQA 3OH1A 4KNXA 4FRMA 3SXBA 1XHBA 4CJ8A 3RSBA 1G0RA 4B5BA 1LL2A 3QVBA 1VH3A 1PZYB 1QGSA 2RJ5A 3ZLKA 1IIMA 1JYLA 3SX7A 1KWSA 3U0XA 1W57A 1ZJ2A 2YCMA 2O1FA 3CGXA 2RJ0A 4DECA 4D0ZA 1ZI3A 2V0IA 4ZDQA 5CQPA 1NHEB 2QH5A 5AJPA 4P00A 2V0HA 5AJOA 1LL0A 2AM4A 4CJCA 2WVKA 3OAMA 5FTSA 2OEFA 4J18A 4ECMA 2VSIA 2WGZA 2DPWA 5CMGX 3CU0A 1I52A 3F1YA 3ST8A 1WVCA 3SXGA 1W77A 5FU8A 5CQLX 4HO4A 1XZ6A 2YESA 2PA4A 2I5KA 3OKRA 4G3PA 1HM9A 4FIYA 1FWYA 1VH1A 4KNRA 3E26A 4IRQA 1VGTA 1JV3A 3I0KA 3DUVA 1TZFA 5FV9A 3V0PA 3DK5A 1JVGA 2FY7A 4HO0A 2VXLA 3U2TA 4KPZA 4R7PA 3D8VA
chains in the Genus database with same CATH topology
1H3MA 3SXEA 1ZI4A 4B2WA 2FFVA 3RMWA 5C48A 3T7NA 3U2WA 5IFYA 5CQMX 5C4EA 4B3UA 3SXDA 4Y7VA 2AM3A 2W0WA 1LZ7A 4FRQA 2RJ8A 5DDVA 2VXMA 1H5SB 3RMVA 3EE5A 4FIXA 4CVHA 2WEEA 4DDZA 1FGGA 5D91A 2AM5A 1WSZA 2WVLA 2QGIA 2XWLA 4IRPA 2BO8A 3PNNA 3V0NA 3HL3A 3CKOA 1ZIZA 2RJ4A 2I7BA 4NANA 1LZJA 3ZGFA 1NWGB 2JCKA 2Y4JA 2Q4JA 3CKVA 1H7LA 5EJZA 4FCUA 3NGWA 3CKJA 2X5SA 4EEMA 1WT2A 3N9WA 2AH9A 4B4GA 2XWMA 4KC2A 5FUHA 5C47A 5CQOA 3OH4A 3Q80A 4FRHA 1S4OA 1WT0A 2BO4A 1YROB 1MP3A 4AYLA 2RJ1A 5IDTA 4HO9A 3V90A 2E3DA 3E25A 1NKHB 4B2XA 4EEOA 2O1GA 1H5SD 5IDSA 2O1HA 1HV9A 1R7XA 1JV1A 3SX8A 2XWNA 5AJNA 4EE3A 1ZJ1A 3BCVA 4E1KA 1WT1A 4JD0A 1H4EA 1R80A 5C36A 5C38A 4BMAA 2GGQA 4FRBA 1VZTA 4Y7TA 2OI5A 4KPXA 1VGZA 2V0LA 5CMFX 3Q4SA 3T7OA 3I0FA 1H5RB 1TW5A 1H7GA 1GA8A 3IOJA 2P72A 2WE9A 1VZUA 4HO8A 5L6VA 2W0VA 1G93A 2YQHA 2JCLA 2Y4LA 1H5TB 1V84A 5L6SA 3U0YA 3D5NA 2PGVA 2FYAA 3I0EA 1R82A 2VK9A 1JYKA 4HOCA 1FXOA 5C8RA 1MC3A 1H4DA 4Y62A 2RITA 2Y6PA 2D0JA 3JTJA 4MNDA 2ZU9A 1WT3A 1YP2A 3O3PA 4Y64A 2OI6A 2D7RA 3I0DA 3PKPA 3I0HA 2YC5A 1QWJA 4AC3A 4L41C 1O7OA 1YP4A 5C4FA 3T7MA 1EZIA 3ZLLA 3OC9A 4D11C 4G87A 3IOIA 3Q7UA 4KRVA 5C4CA 1TW1A 1FOAA 1G8OA 2J0AA 4HO5A 4M4KA 5BXCA 1R7TA 1G95A 1ZDGA 1OQMB 2GGOA 3SX5A 4Y9XA 1NMMB 3GUEA 4Q7CA 2VS5A 5FYEA 1NF5B 3JUJA 5EIYA 1HM0A 1Z90A 3F1CA 4KQLA 3SX3A 5FU0A 4B4BA 2PX7A 1H5SC 1FO8A 4LW3A 4M2AA 1S4NA 1E5KA 2MZBA 2V0KA 1IINA 1FR8A 2A8WA 4EEAA 1FXJA 1ZJOA 4M28A 1H7FA 4Y6NA 2P6WA 3SXAA 1K4VA 2Y7AA 4GBPA 5C4DA 3TZTA 1G23A 4Y7UA 4BQHA 2WVMA 4MIXA 3V0QA 2YQCA 2X5ZA 2E8BA 5D92A 1HM8A 3OH0A 4UEGA 2APCA 3FOQA 2VD4A 4KXOA 1QG8A 1ZJPA 2PGYA 1VZXA 3I0JA 4FRAA 1FG5N 2JCOA 1GX4A 1S4PA 5CMIA 1H7TA 2AE7A 2Z86A 1V83A 2UX8A 5C4BA 1G9RA 4FQWA 1PZTA 1ZCVA 1INIA 1R7VA 1O0RA 4MYBA 3KIAA 4NALA 2CU2A 2AECA 2X60A 3OH3A 1GWWA 5FTVA 2QKXA 2WAWA 2Y4KA 1FR9A 3V0OA 1MP5A 4FRPA 1VGUA 2A8UA 2OI7A 4K6RA 1ZJ0A 4EE5A 4FROA 4XWIA 2Z87A 4AYJA 1O7QA 4Y6UA 5C1LA 2RIZA 2RJ6A 4B4MA 3LW6A 5C1GA 3JUKA 4ASYA 4Y7FA 2C0NA 4O6MA 1V82A 3SPTA 2ZU8A 3U2UA 2J0BA 4G3SA 1O23B 4HO3A 1EYRA 2VS3A 2YQJA 2BO7A 2XMEA 1VGWA 4EEGA 4AAWA 4D0TA 2VSHA 3ZGGA 3V91A 4G3QA 2RIYA 4EVWA 3U2XA 2RJ9A 2FYDB 4KC4A 1LZIA 2D7IA 2FYCB 2AGDA 3K8EA 1R7YA 3USQA 4HO2A 5CQNX 1VICA 2XMHA 1VPAA 2VFZA 1MP4A 1ZCYA 3FWWA 2YC3A 4D11A 1QGQA 3I0LA 3V8YA 3OH2A 1H7EA 1G1LA 3V0LA 1LZ0A 5CMJA 1INJA 1R81A 4FRDA 3I0CA 2ICYA 3BRKX 4EE4A 1ZHJA 5J49A 5C3DA 1OMZA 3D98A 3POLA 4ASJA 1GQ9A 3TQDA 2RJ7A 3CKNA 4M2BA 2X65A 2BO6A 1GQCA 5C3BA 4Y7GA 4LW6A 1H5SA 1G2VA 1FRWA 3ZF8A 4HG6A 1FGXA 3IOHA 5HS2A 5C1HA 4DE7A 2JCJA 4FCEA 4D48A 4FRLA 1LL3A 1ON8A 1G97A 4O6NA 2ZU7A 2V0JA 2FFUA 2FYBA 1JVDA 4CJBA 3OGZA 3V0MA 3PKQA 5C3AA 3CKQA 4JISA 4C2SA 1ON6A 2OEGA 5C49A 2NXVA 5I1FA 3V8ZA 1ZCTA 3USRA 4FREA 1ZCUA 3I0GA 1SS9A 1ZI1A 1ZJ3A 1HJLA 2Y4MA 2I5EA 4ARWA 4B42A 2P73A 3R3IA 1ZDFA 1OMXA 3R2WA 1H7HA 1TVYA 4HO6A 1GX0A 1G3LA 1HJJA 1GWVA 5EJ1A 1H5RA 1VM8A 1YP3A 1ZI5A 4NAKA 1W55A 2ICXA 3I0IX 1FO9A 2VS4A 3SXCA 4NAIA 2AESA 1H7QA 2YQSA 3K8DA 1H4CA 4Y63A 1NQIB 3U2VA 1LVWA 1R7UA 4KT7A 1H5TA 1FZWA 5DDTA 2RIXA 4HCQA 3DJ4A 4KC1A 5CMHA 4P02A 4YS8A 5JQQA 3OH1A 4KNXA 4FRMA 3SXBA 1XHBA 4CJ8A 3RSBA 1G0RA 4B5BA 1LL2A 3QVBA 1VH3A 1PZYB 1QGSA 2RJ5A 3ZLKA 1IIMA 1JYLA 3SX7A 1KWSA 3U0XA 1W57A 1ZJ2A 2YCMA 2O1FA 3CGXA 2RJ0A 4DECA 4D0ZA 1ZI3A 2V0IA 4ZDQA 5CQPA 1NHEB 2QH5A 5AJPA 4P00A 2V0HA 5AJOA 1LL0A 2AM4A 4CJCA 2WVKA 3OAMA 5FTSA 2OEFA 4J18A 4ECMA 2VSIA 2WGZA 2DPWA 5CMGX 3CU0A 1I52A 3F1YA 3ST8A 1WVCA 3SXGA 1W77A 5FU8A 5CQLX 4HO4A 1XZ6A 2YESA 2PA4A 2I5KA 3OKRA 4G3PA 1HM9A 4FIYA 1FWYA 1VH1A 4KNRA 3E26A 4IRQA 1VGTA 1JV3A 3I0KA 3DUVA 1TZFA 5FV9A 3V0PA 3DK5A 1JVGA 2FY7A 4HO0A 2VXLA 3U2TA 4KPZA 4R7PA 3D8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3M A;  3SXE A;  1ZI4 A;  4B2W A;  2FFV A;  3RMW A;  5C48 A;  3T7N A;  3U2W A;  5IFY A;  5CQM X;  5C4E A;  4B3U A;  3SXD A;  4Y7V A;  2AM3 A;  2W0W A;  1LZ7 A;  4FRQ A;  2RJ8 A;  5DDV A;  2VXM A;  1H5S B;  3RMV A;  3EE5 A;  4CVH A;  2WEE A;  4DDZ A;  1FGG A;  2AM5 A;  1WSZ A;  2WVL A;  2QGI A;  2XWL A;  4IRP A;  2BO8 A;  3PNN A;  3V0N A;  3HL3 A;  3CKO A;  1ZIZ A;  2RJ4 A;  2I7B A;  4NAN A;  1LZJ A;  3ZGF A;  1NWG B;  2JCK A;  2Y4J A;  2Q4J A;  3CKV A;  1H7L A;  5EJZ A;  4FCU A;  3NGW A;  3CKJ A;  2X5S A;  4EEM A;  1WT2 A;  3N9W A;  2AH9 A;  4B4G A;  2XWM A;  4KC2 A;  5FUH A;  5C47 A;  5CQO A;  3OH4 A;  3Q80 A;  4FRH A;  1S4O A;  1WT0 A;  2BO4 A;  1YRO B;  1MP3 A;  4AYL A;  2RJ1 A;  5IDT A;  4HO9 A;  3V90 A;  2E3D A;  3E25 A;  1NKH B;  4B2X A;  4EEO A;  2O1G A;  1H5S D;  5IDS A;  2O1H A;  1HV9 A;  1R7X A;  1JV1 A;  3SX8 A;  2XWN A;  5AJN A;  4EE3 A;  1ZJ1 A;  3BCV A;  4E1K A;  1WT1 A;  4JD0 A;  1H4E A;  1R80 A;  5C36 A;  5C38 A;  4BMA A;  2GGQ A;  4FRB A;  1VZT A;  4Y7T A;  2OI5 A;  4KPX A;  1VGZ A;  2V0L A;  5CMF X;  3Q4S A;  3T7O A;  3I0F A;  1H5R B;  1TW5 A;  1H7G A;  1GA8 A;  3IOJ A;  2P72 A;  2WE9 A;  1VZU A;  4HO8 A;  5L6V A;  2W0V A;  1G93 A;  2YQH A;  2JCL A;  2Y4L A;  1H5T B;  1V84 A;  5L6S A;  3U0Y A;  3D5N A;  2PGV A;  2FYA A;  3I0E A;  1R82 A;  1JYK A;  4HOC A;  1FXO A;  5C8R A;  1MC3 A;  1H4D A;  4Y62 A;  2RIT A;  2Y6P A;  2D0J A;  3JTJ A;  4MND A;  2ZU9 A;  1WT3 A;  1YP2 A;  3O3P A;  4Y64 A;  2OI6 A;  2D7R A;  3I0D A;  3PKP A;  3I0H A;  2YC5 A;  1QWJ A;  4AC3 A;  4L41 C;  1O7O A;  1YP4 A;  5C4F A;  3T7M A;  1EZI A;  3ZLL A;  3OC9 A;  4D11 C;  4G87 A;  3IOI A;  3Q7U A;  4KRV A;  5C4C A;  1TW1 A;  1FOA A;  1G8O A;  4HO5 A;  4M4K A;  5BXC A;  1R7T A;  1G95 A;  1ZDG A;  1OQM B;  2GGO A;  3SX5 A;  4Y9X A;  1NMM B;  3GUE A;  2VS5 A;  5FYE A;  1NF5 B;  3JUJ A;  5EIY A;  1HM0 A;  1Z90 A;  3F1C A;  4KQL A;  3SX3 A;  5FU0 A;  4B4B A;  2PX7 A;  1H5S C;  1FO8 A;  4LW3 A;  4M2A A;  1S4N A;  1E5K A;  2MZB A;  2V0K A;  1IIN A;  1FR8 A;  2A8W A;  4EEA A;  1FXJ A;  1ZJO A;  4M28 A;  1H7F A;  4Y6N A;  2P6W A;  3SXA A;  1K4V A;  2Y7A A;  4GBP A;  5C4D A;  3TZT A;  1G23 A;  4Y7U A;  4BQH A;  2WVM A;  3V0Q A;  2YQC A;  2X5Z A;  2E8B A;  1HM8 A;  3OH0 A;  4UEG A;  2APC A;  3FOQ A;  2VD4 A;  4KXO A;  1QG8 A;  1ZJP A;  2PGY A;  1VZX A;  3I0J A;  4FRA A;  1FG5 N;  2JCO A;  1GX4 A;  1S4P A;  5CMI A;  1H7T A;  2AE7 A;  2Z86 A;  1V83 A;  2UX8 A;  5C4B A;  1G9R A;  4FQW A;  1PZT A;  1ZCV A;  1INI A;  1R7V A;  1O0R A;  4MYB A;  3KIA A;  4NAL A;  2CU2 A;  2AEC A;  2X60 A;  3OH3 A;  1GWW A;  5FTV A;  2QKX A;  2WAW A;  2Y4K A;  1FR9 A;  3V0O A;  1MP5 A;  4FRP A;  1VGU A;  2A8U A;  2OI7 A;  4K6R A;  1ZJ0 A;  4EE5 A;  4FRO A;  4XWI A;  2Z87 A;  4AYJ A;  1O7Q A;  4Y6U A;  5C1L A;  2RIZ A;  2RJ6 A;  4B4M A;  3LW6 A;  5C1G A;  3JUK A;  4ASY A;  4Y7F A;  1V82 A;  3SPT A;  2ZU8 A;  3U2U A;  4G3S A;  1O23 B;  4HO3 A;  1EYR A;  2VS3 A;  2YQJ A;  2BO7 A;  2XME A;  1VGW A;  4EEG A;  4AAW A;  4D0T A;  2VSH A;  3ZGG A;  3V91 A;  4G3Q A;  2RIY A;  4EVW A;  3U2X A;  2RJ9 A;  2FYD B;  4KC4 A;  1LZI A;  2D7I A;  2FYC B;  2AGD A;  3K8E A;  1R7Y A;  3USQ A;  4HO2 A;  5CQN X;  1VIC A;  2XMH A;  1VPA A;  2VFZ A;  1MP4 A;  1ZCY A;  3FWW A;  2YC3 A;  4D11 A;  1QGQ A;  3I0L A;  3V8Y A;  3OH2 A;  1H7E A;  1G1L A;  3V0L A;  1LZ0 A;  5CMJ A;  1INJ A;  1R81 A;  4FRD A;  3I0C A;  2ICY A;  3BRK X;  4EE4 A;  1ZHJ A;  5J49 A;  5C3D A;  1OMZ A;  3D98 A;  3POL A;  4ASJ A;  1GQ9 A;  3TQD A;  2RJ7 A;  3CKN A;  4M2B A;  2X65 A;  2BO6 A;  1GQC A;  5C3B A;  4Y7G A;  4LW6 A;  1H5S A;  1G2V A;  1FRW A;  3ZF8 A;  4HG6 A;  1FGX A;  3IOH A;  5HS2 A;  5C1H A;  4DE7 A;  2JCJ A;  4FCE A;  4D48 A;  4FRL A;  1LL3 A;  1ON8 A;  1G97 A;  2ZU7 A;  2V0J A;  2FFU A;  2FYB A;  1JVD A;  4CJB A;  3OGZ A;  3V0M A;  3PKQ A;  5C3A A;  3CKQ A;  4JIS A;  4C2S A;  1ON6 A;  2OEG A;  5C49 A;  2NXV A;  5I1F A;  3V8Z A;  1ZCT A;  3USR A;  4FRE A;  1ZCU A;  3I0G A;  1SS9 A;  1ZI1 A;  1ZJ3 A;  1HJL A;  2Y4M A;  2I5E A;  4ARW A;  4B42 A;  2P73 A;  3R3I A;  1ZDF A;  1OMX A;  3R2W A;  1H7H A;  1TVY A;  4HO6 A;  1GX0 A;  1G3L A;  1HJJ A;  1GWV A;  5EJ1 A;  1H5R A;  1VM8 A;  1YP3 A;  1ZI5 A;  4NAK A;  1W55 A;  2ICX A;  3I0I X;  1FO9 A;  2VS4 A;  3SXC A;  4NAI A;  2AES A;  1H7Q A;  2YQS A;  3K8D A;  1H4C A;  4Y63 A;  1NQI B;  3U2V A;  1LVW A;  1R7U A;  4KT7 A;  1H5T A;  1FZW A;  5DDT A;  2RIX A;  4HCQ A;  3DJ4 A;  4KC1 A;  5CMH A;  4P02 A;  4YS8 A;  5JQQ A;  3OH1 A;  4KNX A;  4FRM A;  3SXB A;  1XHB A;  4CJ8 A;  3RSB A;  1G0R A;  4B5B A;  1LL2 A;  3QVB A;  1VH3 A;  1PZY B;  1QGS A;  2RJ5 A;  3ZLK A;  1IIM A;  1JYL A;  3SX7 A;  1KWS A;  3U0X A;  1W57 A;  1ZJ2 A;  2YCM A;  2O1F A;  3CGX A;  2RJ0 A;  4DEC A;  4D0Z A;  1ZI3 A;  2V0I A;  4ZDQ A;  5CQP A;  1NHE B;  2QH5 A;  5AJP A;  4P00 A;  2V0H A;  5AJO A;  1LL0 A;  2AM4 A;  4CJC A;  2WVK A;  3OAM A;  5FTS A;  2OEF A;  4J18 A;  4ECM A;  2VSI A;  2WGZ A;  2DPW A;  5CMG X;  3CU0 A;  1I52 A;  3F1Y A;  3ST8 A;  1WVC A;  3SXG A;  1W77 A;  5FU8 A;  5CQL X;  4HO4 A;  1XZ6 A;  2YES A;  2PA4 A;  2I5K A;  3OKR A;  4G3P A;  1HM9 A;  1FWY A;  1VH1 A;  4KNR A;  3E26 A;  4IRQ A;  1VGT A;  1JV3 A;  3I0K A;  3DUV A;  1TZF A;  5FV9 A;  3V0P A;  3DK5 A;  1JVG A;  2FY7 A;  4HO0 A;  2VXL A;  3U2T A;  4KPZ A;  4R7P A;  3D8V A; 
#chains in the Genus database with same CATH topology
 1H3M A;  3SXE A;  1ZI4 A;  4B2W A;  2FFV A;  3RMW A;  5C48 A;  3T7N A;  3U2W A;  5IFY A;  5CQM X;  5C4E A;  4B3U A;  3SXD A;  4Y7V A;  2AM3 A;  2W0W A;  1LZ7 A;  4FRQ A;  2RJ8 A;  5DDV A;  2VXM A;  1H5S B;  3RMV A;  3EE5 A;  4FIX A;  4CVH A;  2WEE A;  4DDZ A;  1FGG A;  5D91 A;  2AM5 A;  1WSZ A;  2WVL A;  2QGI A;  2XWL A;  4IRP A;  2BO8 A;  3PNN A;  3V0N A;  3HL3 A;  3CKO A;  1ZIZ A;  2RJ4 A;  2I7B A;  4NAN A;  1LZJ A;  3ZGF A;  1NWG B;  2JCK A;  2Y4J A;  2Q4J A;  3CKV A;  1H7L A;  5EJZ A;  4FCU A;  3NGW A;  3CKJ A;  2X5S A;  4EEM A;  1WT2 A;  3N9W A;  2AH9 A;  4B4G A;  2XWM A;  4KC2 A;  5FUH A;  5C47 A;  5CQO A;  3OH4 A;  3Q80 A;  4FRH A;  1S4O A;  1WT0 A;  2BO4 A;  1YRO B;  1MP3 A;  4AYL A;  2RJ1 A;  5IDT A;  4HO9 A;  3V90 A;  2E3D A;  3E25 A;  1NKH B;  4B2X A;  4EEO A;  2O1G A;  1H5S D;  5IDS A;  2O1H A;  1HV9 A;  1R7X A;  1JV1 A;  3SX8 A;  2XWN A;  5AJN A;  4EE3 A;  1ZJ1 A;  3BCV A;  4E1K A;  1WT1 A;  4JD0 A;  1H4E A;  1R80 A;  5C36 A;  5C38 A;  4BMA A;  2GGQ A;  4FRB A;  1VZT A;  4Y7T A;  2OI5 A;  4KPX A;  1VGZ A;  2V0L A;  5CMF X;  3Q4S A;  3T7O A;  3I0F A;  1H5R B;  1TW5 A;  1H7G A;  1GA8 A;  3IOJ A;  2P72 A;  2WE9 A;  1VZU A;  4HO8 A;  5L6V A;  2W0V A;  1G93 A;  2YQH A;  2JCL A;  2Y4L A;  1H5T B;  1V84 A;  5L6S A;  3U0Y A;  3D5N A;  2PGV A;  2FYA A;  3I0E A;  1R82 A;  2VK9 A;  1JYK A;  4HOC A;  1FXO A;  5C8R A;  1MC3 A;  1H4D A;  4Y62 A;  2RIT A;  2Y6P A;  2D0J A;  3JTJ A;  4MND A;  2ZU9 A;  1WT3 A;  1YP2 A;  3O3P A;  4Y64 A;  2OI6 A;  2D7R A;  3I0D A;  3PKP A;  3I0H A;  2YC5 A;  1QWJ A;  4AC3 A;  4L41 C;  1O7O A;  1YP4 A;  5C4F A;  3T7M A;  1EZI A;  3ZLL A;  3OC9 A;  4D11 C;  4G87 A;  3IOI A;  3Q7U A;  4KRV A;  5C4C A;  1TW1 A;  1FOA A;  1G8O A;  2J0A A;  4HO5 A;  4M4K A;  5BXC A;  1R7T A;  1G95 A;  1ZDG A;  1OQM B;  2GGO A;  3SX5 A;  4Y9X A;  1NMM B;  3GUE A;  4Q7C A;  2VS5 A;  5FYE A;  1NF5 B;  3JUJ A;  5EIY A;  1HM0 A;  1Z90 A;  3F1C A;  4KQL A;  3SX3 A;  5FU0 A;  4B4B A;  2PX7 A;  1H5S C;  1FO8 A;  4LW3 A;  4M2A A;  1S4N A;  1E5K A;  2MZB A;  2V0K A;  1IIN A;  1FR8 A;  2A8W A;  4EEA A;  1FXJ A;  1ZJO A;  4M28 A;  1H7F A;  4Y6N A;  2P6W A;  3SXA A;  1K4V A;  2Y7A A;  4GBP A;  5C4D A;  3TZT A;  1G23 A;  4Y7U A;  4BQH A;  2WVM A;  4MIX A;  3V0Q A;  2YQC A;  2X5Z A;  2E8B A;  5D92 A;  1HM8 A;  3OH0 A;  4UEG A;  2APC A;  3FOQ A;  2VD4 A;  4KXO A;  1QG8 A;  1ZJP A;  2PGY A;  1VZX A;  3I0J A;  4FRA A;  1FG5 N;  2JCO A;  1GX4 A;  1S4P A;  5CMI A;  1H7T A;  2AE7 A;  2Z86 A;  1V83 A;  2UX8 A;  5C4B A;  1G9R A;  4FQW A;  1PZT A;  1ZCV A;  1INI A;  1R7V A;  1O0R A;  4MYB A;  3KIA A;  4NAL A;  2CU2 A;  2AEC A;  2X60 A;  3OH3 A;  1GWW A;  5FTV A;  2QKX A;  2WAW A;  2Y4K A;  1FR9 A;  3V0O A;  1MP5 A;  4FRP A;  1VGU A;  2A8U A;  2OI7 A;  4K6R A;  1ZJ0 A;  4EE5 A;  4FRO A;  4XWI A;  2Z87 A;  4AYJ A;  1O7Q A;  4Y6U A;  5C1L A;  2RIZ A;  2RJ6 A;  4B4M A;  3LW6 A;  5C1G A;  3JUK A;  4ASY A;  4Y7F A;  2C0N A;  4O6M A;  1V82 A;  3SPT A;  2ZU8 A;  3U2U A;  2J0B A;  4G3S A;  1O23 B;  4HO3 A;  1EYR A;  2VS3 A;  2YQJ A;  2BO7 A;  2XME A;  1VGW A;  4EEG A;  4AAW A;  4D0T A;  2VSH A;  3ZGG A;  3V91 A;  4G3Q A;  2RIY A;  4EVW A;  3U2X A;  2RJ9 A;  2FYD B;  4KC4 A;  1LZI A;  2D7I A;  2FYC B;  2AGD A;  3K8E A;  1R7Y A;  3USQ A;  4HO2 A;  5CQN X;  1VIC A;  2XMH A;  1VPA A;  2VFZ A;  1MP4 A;  1ZCY A;  3FWW A;  2YC3 A;  4D11 A;  1QGQ A;  3I0L A;  3V8Y A;  3OH2 A;  1H7E A;  1G1L A;  3V0L A;  1LZ0 A;  5CMJ A;  1INJ A;  1R81 A;  4FRD A;  3I0C A;  2ICY A;  3BRK X;  4EE4 A;  1ZHJ A;  5J49 A;  5C3D A;  1OMZ A;  3D98 A;  3POL A;  4ASJ A;  1GQ9 A;  3TQD A;  2RJ7 A;  3CKN A;  4M2B A;  2X65 A;  2BO6 A;  1GQC A;  5C3B A;  4Y7G A;  4LW6 A;  1H5S A;  1G2V A;  1FRW A;  3ZF8 A;  4HG6 A;  1FGX A;  3IOH A;  5HS2 A;  5C1H A;  4DE7 A;  2JCJ A;  4FCE A;  4D48 A;  4FRL A;  1LL3 A;  1ON8 A;  1G97 A;  4O6N A;  2ZU7 A;  2V0J A;  2FFU A;  2FYB A;  1JVD A;  4CJB A;  3OGZ A;  3V0M A;  3PKQ A;  5C3A A;  3CKQ A;  4JIS A;  4C2S A;  1ON6 A;  2OEG A;  5C49 A;  2NXV A;  5I1F A;  3V8Z A;  1ZCT A;  3USR A;  4FRE A;  1ZCU A;  3I0G A;  1SS9 A;  1ZI1 A;  1ZJ3 A;  1HJL A;  2Y4M A;  2I5E A;  4ARW A;  4B42 A;  2P73 A;  3R3I A;  1ZDF A;  1OMX A;  3R2W A;  1H7H A;  1TVY A;  4HO6 A;  1GX0 A;  1G3L A;  1HJJ A;  1GWV A;  5EJ1 A;  1H5R A;  1VM8 A;  1YP3 A;  1ZI5 A;  4NAK A;  1W55 A;  2ICX A;  3I0I X;  1FO9 A;  2VS4 A;  3SXC A;  4NAI A;  2AES A;  1H7Q A;  2YQS A;  3K8D A;  1H4C A;  4Y63 A;  1NQI B;  3U2V A;  1LVW A;  1R7U A;  4KT7 A;  1H5T A;  1FZW A;  5DDT A;  2RIX A;  4HCQ A;  3DJ4 A;  4KC1 A;  5CMH A;  4P02 A;  4YS8 A;  5JQQ A;  3OH1 A;  4KNX A;  4FRM A;  3SXB A;  1XHB A;  4CJ8 A;  3RSB A;  1G0R A;  4B5B A;  1LL2 A;  3QVB A;  1VH3 A;  1PZY B;  1QGS A;  2RJ5 A;  3ZLK A;  1IIM A;  1JYL A;  3SX7 A;  1KWS A;  3U0X A;  1W57 A;  1ZJ2 A;  2YCM A;  2O1F A;  3CGX A;  2RJ0 A;  4DEC A;  4D0Z A;  1ZI3 A;  2V0I A;  4ZDQ A;  5CQP A;  1NHE B;  2QH5 A;  5AJP A;  4P00 A;  2V0H A;  5AJO A;  1LL0 A;  2AM4 A;  4CJC A;  2WVK A;  3OAM A;  5FTS A;  2OEF A;  4J18 A;  4ECM A;  2VSI A;  2WGZ A;  2DPW A;  5CMG X;  3CU0 A;  1I52 A;  3F1Y A;  3ST8 A;  1WVC A;  3SXG A;  1W77 A;  5FU8 A;  5CQL X;  4HO4 A;  1XZ6 A;  2YES A;  2PA4 A;  2I5K A;  3OKR A;  4G3P A;  1HM9 A;  4FIY A;  1FWY A;  1VH1 A;  4KNR A;  3E26 A;  4IRQ A;  1VGT A;  1JV3 A;  3I0K A;  3DUV A;  1TZF A;  5FV9 A;  3V0P A;  3DK5 A;  1JVG A;  2FY7 A;  4HO0 A;  2VXL A;  3U2T A;  4KPZ A;  4R7P A;  3D8V A; 
#chains in the Genus database with same CATH homology
 1H3M A;  3SXE A;  1ZI4 A;  4B2W A;  2FFV A;  3RMW A;  5C48 A;  3T7N A;  3U2W A;  5IFY A;  5CQM X;  5C4E A;  4B3U A;  3SXD A;  4Y7V A;  2AM3 A;  2W0W A;  1LZ7 A;  4FRQ A;  2RJ8 A;  5DDV A;  2VXM A;  1H5S B;  3RMV A;  3EE5 A;  4FIX A;  4CVH A;  2WEE A;  4DDZ A;  1FGG A;  5D91 A;  2AM5 A;  1WSZ A;  2WVL A;  2QGI A;  2XWL A;  4IRP A;  2BO8 A;  3PNN A;  3V0N A;  3HL3 A;  3CKO A;  1ZIZ A;  2RJ4 A;  2I7B A;  4NAN A;  1LZJ A;  3ZGF A;  1NWG B;  2JCK A;  2Y4J A;  2Q4J A;  3CKV A;  1H7L A;  5EJZ A;  4FCU A;  3NGW A;  3CKJ A;  2X5S A;  4EEM A;  1WT2 A;  3N9W A;  2AH9 A;  4B4G A;  2XWM A;  4KC2 A;  5FUH A;  5C47 A;  5CQO A;  3OH4 A;  3Q80 A;  4FRH A;  1S4O A;  1WT0 A;  2BO4 A;  1YRO B;  1MP3 A;  4AYL A;  2RJ1 A;  5IDT A;  4HO9 A;  3V90 A;  2E3D A;  3E25 A;  1NKH B;  4B2X A;  4EEO A;  2O1G A;  1H5S D;  5IDS A;  2O1H A;  1HV9 A;  1R7X A;  1JV1 A;  3SX8 A;  2XWN A;  5AJN A;  4EE3 A;  1ZJ1 A;  3BCV A;  4E1K A;  1WT1 A;  4JD0 A;  1H4E A;  1R80 A;  5C36 A;  5C38 A;  4BMA A;  2GGQ A;  4FRB A;  1VZT A;  4Y7T A;  2OI5 A;  4KPX A;  1VGZ A;  2V0L A;  5CMF X;  3Q4S A;  3T7O A;  3I0F A;  1H5R B;  1TW5 A;  1H7G A;  1GA8 A;  3IOJ A;  2P72 A;  2WE9 A;  1VZU A;  4HO8 A;  5L6V A;  2W0V A;  1G93 A;  2YQH A;  2JCL A;  2Y4L A;  1H5T B;  1V84 A;  5L6S A;  3U0Y A;  3D5N A;  2PGV A;  2FYA A;  3I0E A;  1R82 A;  2VK9 A;  1JYK A;  4HOC A;  1FXO A;  5C8R A;  1MC3 A;  1H4D A;  4Y62 A;  2RIT A;  2Y6P A;  2D0J A;  3JTJ A;  4MND A;  2ZU9 A;  1WT3 A;  1YP2 A;  3O3P A;  4Y64 A;  2OI6 A;  2D7R A;  3I0D A;  3PKP A;  3I0H A;  2YC5 A;  1QWJ A;  4AC3 A;  4L41 C;  1O7O A;  1YP4 A;  5C4F A;  3T7M A;  1EZI A;  3ZLL A;  3OC9 A;  4D11 C;  4G87 A;  3IOI A;  3Q7U A;  4KRV A;  5C4C A;  1TW1 A;  1FOA A;  1G8O A;  2J0A A;  4HO5 A;  4M4K A;  5BXC A;  1R7T A;  1G95 A;  1ZDG A;  1OQM B;  2GGO A;  3SX5 A;  4Y9X A;  1NMM B;  3GUE A;  4Q7C A;  2VS5 A;  5FYE A;  1NF5 B;  3JUJ A;  5EIY A;  1HM0 A;  1Z90 A;  3F1C A;  4KQL A;  3SX3 A;  5FU0 A;  4B4B A;  2PX7 A;  1H5S C;  1FO8 A;  4LW3 A;  4M2A A;  1S4N A;  1E5K A;  2MZB A;  2V0K A;  1IIN A;  1FR8 A;  2A8W A;  4EEA A;  1FXJ A;  1ZJO A;  4M28 A;  1H7F A;  4Y6N A;  2P6W A;  3SXA A;  1K4V A;  2Y7A A;  4GBP A;  5C4D A;  3TZT A;  1G23 A;  4Y7U A;  4BQH A;  2WVM A;  4MIX A;  3V0Q A;  2YQC A;  2X5Z A;  2E8B A;  5D92 A;  1HM8 A;  3OH0 A;  4UEG A;  2APC A;  3FOQ A;  2VD4 A;  4KXO A;  1QG8 A;  1ZJP A;  2PGY A;  1VZX A;  3I0J A;  4FRA A;  1FG5 N;  2JCO A;  1GX4 A;  1S4P A;  5CMI A;  1H7T A;  2AE7 A;  2Z86 A;  1V83 A;  2UX8 A;  5C4B A;  1G9R A;  4FQW A;  1PZT A;  1ZCV A;  1INI A;  1R7V A;  1O0R A;  4MYB A;  3KIA A;  4NAL A;  2CU2 A;  2AEC A;  2X60 A;  3OH3 A;  1GWW A;  5FTV A;  2QKX A;  2WAW A;  2Y4K A;  1FR9 A;  3V0O A;  1MP5 A;  4FRP A;  1VGU A;  2A8U A;  2OI7 A;  4K6R A;  1ZJ0 A;  4EE5 A;  4FRO A;  4XWI A;  2Z87 A;  4AYJ A;  1O7Q A;  4Y6U A;  5C1L A;  2RIZ A;  2RJ6 A;  4B4M A;  3LW6 A;  5C1G A;  3JUK A;  4ASY A;  4Y7F A;  2C0N A;  4O6M A;  1V82 A;  3SPT A;  2ZU8 A;  3U2U A;  2J0B A;  4G3S A;  1O23 B;  4HO3 A;  1EYR A;  2VS3 A;  2YQJ A;  2BO7 A;  2XME A;  1VGW A;  4EEG A;  4AAW A;  4D0T A;  2VSH A;  3ZGG A;  3V91 A;  4G3Q A;  2RIY A;  4EVW A;  3U2X A;  2RJ9 A;  2FYD B;  4KC4 A;  1LZI A;  2D7I A;  2FYC B;  2AGD A;  3K8E A;  1R7Y A;  3USQ A;  4HO2 A;  5CQN X;  1VIC A;  2XMH A;  1VPA A;  2VFZ A;  1MP4 A;  1ZCY A;  3FWW A;  2YC3 A;  4D11 A;  1QGQ A;  3I0L A;  3V8Y A;  3OH2 A;  1H7E A;  1G1L A;  3V0L A;  1LZ0 A;  5CMJ A;  1INJ A;  1R81 A;  4FRD A;  3I0C A;  2ICY A;  3BRK X;  4EE4 A;  1ZHJ A;  5J49 A;  5C3D A;  1OMZ A;  3D98 A;  3POL A;  4ASJ A;  1GQ9 A;  3TQD A;  2RJ7 A;  3CKN A;  4M2B A;  2X65 A;  2BO6 A;  1GQC A;  5C3B A;  4Y7G A;  4LW6 A;  1H5S A;  1G2V A;  1FRW A;  3ZF8 A;  4HG6 A;  1FGX A;  3IOH A;  5HS2 A;  5C1H A;  4DE7 A;  2JCJ A;  4FCE A;  4D48 A;  4FRL A;  1LL3 A;  1ON8 A;  1G97 A;  4O6N A;  2ZU7 A;  2V0J A;  2FFU A;  2FYB A;  1JVD A;  4CJB A;  3OGZ A;  3V0M A;  3PKQ A;  5C3A A;  3CKQ A;  4JIS A;  4C2S A;  1ON6 A;  2OEG A;  5C49 A;  2NXV A;  5I1F A;  3V8Z A;  1ZCT A;  3USR A;  4FRE A;  1ZCU A;  3I0G A;  1SS9 A;  1ZI1 A;  1ZJ3 A;  1HJL A;  2Y4M A;  2I5E A;  4ARW A;  4B42 A;  2P73 A;  3R3I A;  1ZDF A;  1OMX A;  3R2W A;  1H7H A;  1TVY A;  4HO6 A;  1GX0 A;  1G3L A;  1HJJ A;  1GWV A;  5EJ1 A;  1H5R A;  1VM8 A;  1YP3 A;  1ZI5 A;  4NAK A;  1W55 A;  2ICX A;  3I0I X;  1FO9 A;  2VS4 A;  3SXC A;  4NAI A;  2AES A;  1H7Q A;  2YQS A;  3K8D A;  1H4C A;  4Y63 A;  1NQI B;  3U2V A;  1LVW A;  1R7U A;  4KT7 A;  1H5T A;  1FZW A;  5DDT A;  2RIX A;  4HCQ A;  3DJ4 A;  4KC1 A;  5CMH A;  4P02 A;  4YS8 A;  5JQQ A;  3OH1 A;  4KNX A;  4FRM A;  3SXB A;  1XHB A;  4CJ8 A;  3RSB A;  1G0R A;  4B5B A;  1LL2 A;  3QVB A;  1VH3 A;  1PZY B;  1QGS A;  2RJ5 A;  3ZLK A;  1IIM A;  1JYL A;  3SX7 A;  1KWS A;  3U0X A;  1W57 A;  1ZJ2 A;  2YCM A;  2O1F A;  3CGX A;  2RJ0 A;  4DEC A;  4D0Z A;  1ZI3 A;  2V0I A;  4ZDQ A;  5CQP A;  1NHE B;  2QH5 A;  5AJP A;  4P00 A;  2V0H A;  5AJO A;  1LL0 A;  2AM4 A;  4CJC A;  2WVK A;  3OAM A;  5FTS A;  2OEF A;  4J18 A;  4ECM A;  2VSI A;  2WGZ A;  2DPW A;  5CMG X;  3CU0 A;  1I52 A;  3F1Y A;  3ST8 A;  1WVC A;  3SXG A;  1W77 A;  5FU8 A;  5CQL X;  4HO4 A;  1XZ6 A;  2YES A;  2PA4 A;  2I5K A;  3OKR A;  4G3P A;  1HM9 A;  4FIY A;  1FWY A;  1VH1 A;  4KNR A;  3E26 A;  4IRQ A;  1VGT A;  1JV3 A;  3I0K A;  3DUV A;  1TZF A;  5FV9 A;  3V0P A;  3DK5 A;  1JVG A;  2FY7 A;  4HO0 A;  2VXL A;  3U2T A;  4KPZ A;  4R7P A;  3D8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...