2RIXA

B-specific-1,3-galactosyltransferase)(gtb) + udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
284
structure length
276
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 276
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2rixA00
4B2XA 3OC9A 1ZIZA 4CJBA 4DDZA 1INIA 1XHBA 1ZHJA 4HO8A 1QGSA 1VGWA 3SPTA 1G97A 4AYJA 1YP4A 2BO6A 5C4BA 3CKJA 3EE5A 1ZJ0A 3T7OA 1G93A 4EEAA 4HO6A 4JISA 4Y7TA 2QGIA 1LZIA 4E1KA 1H7TA 5AJOA 2WGZA 2FFUA 3V8YA 3I0GA 5EJZA 1ZJ1A 4M4KA 2RIZA 5L6SA 4LW6A 2YQJA 5FU0A 1TW5A 2VSHA 3OH4A 1V83A 2YQHA 4G3SA 1VGTA 2ICYA 3ZLKA 4EEGA 2XWMA 5IDSA 1VGUA 4CVHA 1R82A 2Z86A 3O3PA 3V90A 3BRKX 1LZJA 3FWWA 2A8UA 4EEOA 1R80A 2AGDA 4EE3A 1ON6A 1VZXA 1O7QA 1VH1A 2AE7A 3OGZA 5CQLX 3ZGFA 4UEGA 1H7LA 4Y63A 5CQPA 1NMMB 3U0YA 1G23A 2V0KA 1G95A 1LVWA 2Z87A 2WVLA 4B5BA 1GQCA 2P6WA 1H5SA 3PKQA 1FOAA 4HO3A 4J18A 5L6VA 1VGZA 4EE4A 2FYCB 1G9RA 2XWLA 1H5TB 5FTVA 3I0FA 3QVBA 5C4DA 2X60A 3R2WA 4FCUA 2PGYA 1FGXA 4DECA 1G8OA 3Q4SA 4FRAA 4KC1A 1FR8A 2O1GA 3DJ4A 1H7QA 1GWVA 1GX4A 2QH5A 1HJJA 4Y7VA 2Q4JA 4ASYA 4FRBA 4B4GA 2VD4A 3TQDA 2BO7A 1V82A 4KC4A 1ZDGA 1SS9A 1YP2A 5C47A 5AJNA 4LW3A 5C1HA 2Y7AA 1R7UA 3ZLLA 3U2XA 3JTJA 3PKPA 4IRQA 1VM8A 2GGOA 1G1LA 2WAWA 2NXVA 2QKXA 1GWWA 1QGQA 1LL3A 5C1GA 1I52A 1R7TA 3V8ZA 2RJ5A 3D98A 2V0JA 1ON8A 3V0OA 1HM0A 5CMGX 2FFVA 1ZCTA 4B4BA 4D11A 5C8RA 4K6RA 1JYLA 4FROA 3F1YA 1WT1A 2FYDB 3V0NA 1LL0A 1O23B 1HJLA 1ZJ3A 1WT3A 3E26A 2V0HA 1VPAA 1H7EA 1LZ7A 2RJ4A 3SXEA 3U0XA 2AECA 1GQ9A 4Y7FA 1NKHB 3USRA 2OI7A 2P72A 4HO2A 4D0ZA 1H5SD 2YQCA 4FRDA 2WVMA 4KC2A 5CQOA 4B2WA 3DUVA 4NANA 2D0JA 2P73A 2O1HA 5FTSA 1NQIB 5C4EA 4KQLA 2ZU9A 4KPZA 1VH3A 1NWGB 2OI5A 2YESA 3I0LA 1R7XA 4KNRA 1EYRA 3ST8A 2DPWA 4MYBA 2RJ6A 1VZUA 1ZI3A 4ECMA 3CKOA 2A8WA 4MNDA 1E5KA 2I5EA 1G2VA 2RJ8A 2X65A 1TW1A 1W77A 4Y7GA 2WEEA 3JUKA 4CJCA 1IIMA 1ZI5A 4KRVA 1G0RA 1WVCA 1WT0A 3KIAA 2PGVA 1W57A 2AM4A 5CMIA 1JV3A 4C2SA 1XZ6A 1QG8A 4EVWA 2BO8A 1FO8A 2Y4JA 2YC3A 1OMZA 3Q7UA 3USQA 4FRQA 5C49A 2BO4A 3SXCA 3U2UA 3N9WA 5C38A 5C3AA 3U2TA 1QWJA 2AH9A 2FYAA 5FUHA 2I7BA 3CGXA 1LZ0A 2E3DA 3FOQA 1H4EA 2GGQA 1H7HA 4NALA 3CKVA 3PNNA 3RMVA 1HM8A 2OEGA 3I0JA 1JV1A 3I0IX 5EJ1A 2JCKA 4M2AA 1H5RA 4FREA 2RJ7A 2YC5A 2CU2A 2V0IA 2VXLA 2XMHA 1MP5A 2X5SA 4G3QA 2OI6A 2VS3A 3TZTA 2PX7A 5C4CA 4Y6NA 1TZFA 2XMEA 2ICXA 4Y64A 4FRMA 5C4FA 3OKRA 5DDTA 1R7YA 3SXAA 4ARWA 5AJPA 1HM9A 4P02A 2YCMA 2JCOA 1H5SC 4HO5A 2FY7A 5JQQA 4B3UA 2RJ9A 1O0RA 1YP3A 3BCVA 1S4OA 2RIXA 4G87A 4FRHA 2ZU8A 1PZTA 1H5SB 2W0WA 3V0LA 4GBPA 2PA4A 3I0HA 1ZJOA 4HO0A 3I0CA 4JD0A 3ZF8A 5J49A 2Y4KA 1ZJPA 1IINA 1MP3A 3ZGGA 3OH3A 5C3DA 4Y9XA 3I0KA 4ASJA 1H5RB 2WE9A 1S4NA 4AC3A 1FZWA 2RJ0A 2RITA 4DE7A 4FRLA 1INJA 1FGGA 1MC3A 3V0MA 3K8EA 2MZBA 4HO9A 2AM3A 4AYLA 4KXOA 1Z90A 4CJ8A 4Y62A 1G3LA 3NGWA 3CKQA 4M28A 1FR9A 4ZDQA 1FG5N 4HG6A 2VS5A 5C1LA 1H3MA 4YS8A 3SXGA 1LL2A 3I0DA 3CKNA 1FXJA 5CMJA 3D8VA 2AM5A 5BXCA 5FU8A 2XWNA 5C48A 3IOJA 3SX5A 1H5TA 4HO4A 4D11C 1WSZA 4BQHA 2RJ1A 3OH2A 5CQMX 3V0QA 3CU0A 2JCJA 3DK5A 5HS2A 3R3IA 3D5NA 4NAIA 5EIYA 4L41C 4EE5A 1JYKA 3U2VA 3RSBA 1KWSA 1OMXA 3LW6A 1S4PA 1GA8A 4D0TA 1H7FA 1ZI4A 1VZTA 5IFYA 1VICA 5FYEA 2UX8A 1H4DA 1FRWA 4HCQA 3OH0A 5I1FA 1O7OA 1H7GA 3Q80A 1ZCYA 1YROB 5CMHA 3SX8A 4HOCA 2OEFA 4FRPA 4Y7UA 4EEMA 1ZI1A 2RIYA 2Y4LA 4XWIA 2VXMA 1FWYA 1WT2A 2D7IA 2VFZA 1NF5B 2VSIA 2Y4MA 3U2WA 4G3PA 3I0EA 4FCEA 4FQWA 1EZIA 2YQSA 4KPXA 5C3BA 1TVYA 4R7PA 3T7NA 3POLA 3HL3A 2V0LA 1NHEB 2W0VA 3K8DA 3V0PA 2E8BA 1JVGA 1FO9A 2ZU7A 3GUEA 1GX0A 3SX3A 1JVDA 1R81A 2Y6PA 5IDTA 1R7VA 1FXOA 4Y6UA 4NAKA 4KNXA 2APCA 2WVKA 3SXDA 1ZDFA 2O1FA 3V91A 3SX7A 1ZCUA 5C36A 4D48A 4BMAA 2I5KA 4P00A 5DDVA 3IOIA 2VS4A 4M2BA 4AAWA 1H4CA 5CQNX 2FYBA 2AESA 2X5ZA 1ZCVA 3F1CA 1HV9A 4KT7A 4B42A 2D7RA 1V84A 3OAMA 3IOHA 1W55A 4IRPA 1MP4A 3E25A 3T7MA 1OQMB 3RMWA 1ZJ2A 5CMFX 3OH1A 3SXBA 1PZYB 5FV9A 3JUJA 2JCLA 4B4MA 1K4VA
chains in the Genus database with same CATH superfamily
4FIYA 4B2XA 3OC9A 1ZIZA 4CJBA 4DDZA 1INIA 1XHBA 5D92A 1ZHJA 4HO8A 1QGSA 1VGWA 3SPTA 1G97A 4AYJA 1YP4A 2BO6A 5C4BA 3CKJA 3EE5A 1ZJ0A 3T7OA 1G93A 4EEAA 4HO6A 4JISA 4Y7TA 2QGIA 1LZIA 4E1KA 1H7TA 5AJOA 2WGZA 2FFUA 3V8YA 3I0GA 5EJZA 1ZJ1A 4M4KA 2RIZA 5L6SA 4LW6A 2YQJA 5FU0A 1TW5A 2VSHA 3OH4A 1V83A 2YQHA 4G3SA 1VGTA 2ICYA 3ZLKA 4EEGA 2XWMA 5IDSA 1VGUA 4CVHA 1R82A 2Z86A 3O3PA 3V90A 3BRKX 1LZJA 3FWWA 2A8UA 4EEOA 1R80A 2AGDA 4EE3A 1ON6A 1VZXA 1O7QA 1VH1A 2AE7A 3OGZA 5CQLX 3ZGFA 4UEGA 1H7LA 4Y63A 5CQPA 1NMMB 3U0YA 1G23A 2V0KA 1G95A 1LVWA 2Z87A 2WVLA 4B5BA 1GQCA 2P6WA 1H5SA 3PKQA 1FOAA 4HO3A 4J18A 5L6VA 1VGZA 4EE4A 2FYCB 1G9RA 2XWLA 1H5TB 5FTVA 3I0FA 3QVBA 5C4DA 2X60A 3R2WA 4FCUA 2PGYA 1FGXA 4DECA 1G8OA 3Q4SA 4FRAA 4KC1A 1FR8A 2O1GA 3DJ4A 1H7QA 1GWVA 1GX4A 4Q7CA 2QH5A 1HJJA 4Y7VA 2Q4JA 4ASYA 4FRBA 4B4GA 2VD4A 4O6NA 3TQDA 2BO7A 1V82A 4KC4A 1ZDGA 1SS9A 1YP2A 5C47A 5AJNA 4LW3A 5C1HA 2Y7AA 1R7UA 3ZLLA 3U2XA 3JTJA 3PKPA 4IRQA 1VM8A 2GGOA 1G1LA 2WAWA 2NXVA 2QKXA 1GWWA 1QGQA 1LL3A 5C1GA 1I52A 1R7TA 3V8ZA 2RJ5A 3D98A 2V0JA 1ON8A 3V0OA 1HM0A 5CMGX 2FFVA 1ZCTA 4B4BA 4D11A 5C8RA 4K6RA 1JYLA 4FROA 3F1YA 1WT1A 2FYDB 3V0NA 1LL0A 1O23B 1HJLA 1ZJ3A 1WT3A 3E26A 2V0HA 1VPAA 1H7EA 5D91A 1LZ7A 2RJ4A 3SXEA 3U0XA 2AECA 1GQ9A 4FIXA 4Y7FA 1NKHB 3USRA 2OI7A 2J0BA 2P72A 4HO2A 4D0ZA 1H5SD 2YQCA 4FRDA 2WVMA 4KC2A 5CQOA 4B2WA 3DUVA 4NANA 2D0JA 2P73A 2O1HA 5FTSA 1NQIB 5C4EA 4KQLA 2ZU9A 4KPZA 1VH3A 1NWGB 2OI5A 2YESA 3I0LA 1R7XA 4KNRA 1EYRA 4O6MA 3ST8A 2DPWA 4MYBA 2RJ6A 1VZUA 1ZI3A 4ECMA 3CKOA 2A8WA 4MNDA 1E5KA 2I5EA 1G2VA 2RJ8A 2X65A 1TW1A 1W77A 4Y7GA 2WEEA 3JUKA 4CJCA 1IIMA 1ZI5A 4KRVA 1G0RA 1WVCA 1WT0A 3KIAA 2PGVA 1W57A 2AM4A 5CMIA 1JV3A 4C2SA 1XZ6A 1QG8A 4EVWA 2BO8A 1FO8A 2Y4JA 2YC3A 1OMZA 3Q7UA 3USQA 4FRQA 5C49A 2BO4A 3SXCA 3U2UA 3N9WA 5C38A 5C3AA 3U2TA 1QWJA 2AH9A 2FYAA 5FUHA 2I7BA 3CGXA 1LZ0A 2E3DA 3FOQA 1H4EA 2GGQA 1H7HA 4NALA 3CKVA 3PNNA 3RMVA 1HM8A 2OEGA 3I0JA 2J0AA 1JV1A 3I0IX 5EJ1A 2JCKA 4M2AA 1H5RA 4FREA 2RJ7A 2YC5A 2CU2A 2V0IA 2VXLA 2XMHA 1MP5A 2C0NA 2X5SA 4G3QA 2OI6A 2VS3A 3TZTA 2PX7A 5C4CA 4Y6NA 1TZFA 2XMEA 2ICXA 4Y64A 4FRMA 5C4FA 3OKRA 5DDTA 1R7YA 3SXAA 4ARWA 5AJPA 1HM9A 4P02A 2YCMA 2JCOA 1H5SC 4HO5A 2FY7A 5JQQA 4B3UA 2RJ9A 1O0RA 1YP3A 3BCVA 1S4OA 2RIXA 4G87A 4FRHA 2ZU8A 1PZTA 1H5SB 2W0WA 3V0LA 4GBPA 2PA4A 3I0HA 1ZJOA 4HO0A 3I0CA 4JD0A 3ZF8A 5J49A 2Y4KA 1ZJPA 1IINA 1MP3A 3ZGGA 3OH3A 5C3DA 4Y9XA 3I0KA 4ASJA 1H5RB 2WE9A 1S4NA 4AC3A 1FZWA 2RJ0A 2RITA 4DE7A 4FRLA 1INJA 1FGGA 1MC3A 3V0MA 3K8EA 2MZBA 4HO9A 2AM3A 4AYLA 4KXOA 1Z90A 4CJ8A 4Y62A 1G3LA 3NGWA 3CKQA 4M28A 1FR9A 4ZDQA 1FG5N 4HG6A 2VS5A 5C1LA 1H3MA 4YS8A 3SXGA 1LL2A 3I0DA 3CKNA 1FXJA 5CMJA 3D8VA 2AM5A 5BXCA 5FU8A 2XWNA 5C48A 3IOJA 3SX5A 1H5TA 4HO4A 4D11C 1WSZA 4BQHA 2RJ1A 3OH2A 5CQMX 3V0QA 3CU0A 2JCJA 3DK5A 5HS2A 3R3IA 3D5NA 4NAIA 5EIYA 4L41C 4EE5A 1JYKA 3U2VA 3RSBA 1KWSA 1OMXA 3LW6A 1S4PA 1GA8A 4D0TA 1H7FA 1ZI4A 1VZTA 5IFYA 1VICA 5FYEA 2UX8A 1H4DA 1FRWA 4HCQA 3OH0A 5I1FA 1O7OA 1H7GA 3Q80A 1ZCYA 1YROB 5CMHA 3SX8A 4HOCA 2OEFA 4FRPA 4Y7UA 4EEMA 1ZI1A 2RIYA 2Y4LA 4XWIA 2VXMA 1FWYA 1WT2A 2D7IA 2VFZA 1NF5B 2VSIA 2Y4MA 3U2WA 4G3PA 3I0EA 4FCEA 4FQWA 1EZIA 2YQSA 4KPXA 5C3BA 1TVYA 4R7PA 3T7NA 3POLA 4MIXA 3HL3A 2V0LA 1NHEB 2W0VA 3K8DA 3V0PA 2E8BA 1JVGA 1FO9A 2ZU7A 3GUEA 1GX0A 3SX3A 1JVDA 1R81A 2VK9A 2Y6PA 5IDTA 1R7VA 1FXOA 4Y6UA 4NAKA 4KNXA 2APCA 2WVKA 3SXDA 1ZDFA 2O1FA 3V91A 3SX7A 1ZCUA 5C36A 4D48A 4BMAA 2I5KA 4P00A 5DDVA 3IOIA 2VS4A 4M2BA 4AAWA 1H4CA 5CQNX 2FYBA 2AESA 2X5ZA 1ZCVA 3F1CA 1HV9A 4KT7A 4B42A 2D7RA 1V84A 3OAMA 3IOHA 1W55A 4IRPA 1MP4A 3E25A 3T7MA 1OQMB 3RMWA 1ZJ2A 5CMFX 3OH1A 3SXBA 1PZYB 5FV9A 3JUJA 2JCLA 4B4MA 1K4VA
chains in the Genus database with same CATH topology
4FIYA 4B2XA 3OC9A 1ZIZA 4CJBA 4DDZA 1INIA 1XHBA 5D92A 1ZHJA 4HO8A 1QGSA 1VGWA 3SPTA 1G97A 4AYJA 1YP4A 2BO6A 5C4BA 3CKJA 3EE5A 1ZJ0A 3T7OA 1G93A 4EEAA 4HO6A 4JISA 4Y7TA 2QGIA 1LZIA 4E1KA 1H7TA 5AJOA 2WGZA 2FFUA 3V8YA 3I0GA 5EJZA 1ZJ1A 4M4KA 2RIZA 5L6SA 4LW6A 2YQJA 5FU0A 1TW5A 2VSHA 3OH4A 1V83A 2YQHA 4G3SA 1VGTA 2ICYA 3ZLKA 4EEGA 2XWMA 5IDSA 1VGUA 4CVHA 1R82A 2Z86A 3O3PA 3V90A 3BRKX 1LZJA 3FWWA 2A8UA 4EEOA 1R80A 2AGDA 4EE3A 1ON6A 1VZXA 1O7QA 1VH1A 2AE7A 3OGZA 5CQLX 3ZGFA 4UEGA 1H7LA 4Y63A 5CQPA 1NMMB 3U0YA 1G23A 2V0KA 1G95A 1LVWA 2Z87A 2WVLA 4B5BA 1GQCA 2P6WA 1H5SA 3PKQA 1FOAA 4HO3A 4J18A 5L6VA 1VGZA 4EE4A 2FYCB 1G9RA 2XWLA 1H5TB 5FTVA 3I0FA 3QVBA 5C4DA 2X60A 3R2WA 4FCUA 2PGYA 1FGXA 4DECA 1G8OA 3Q4SA 4FRAA 4KC1A 1FR8A 2O1GA 3DJ4A 1H7QA 1GWVA 1GX4A 4Q7CA 2QH5A 1HJJA 4Y7VA 2Q4JA 4ASYA 4FRBA 4B4GA 2VD4A 4O6NA 3TQDA 2BO7A 1V82A 4KC4A 1ZDGA 1SS9A 1YP2A 5C47A 5AJNA 4LW3A 5C1HA 2Y7AA 1R7UA 3ZLLA 3U2XA 3JTJA 3PKPA 4IRQA 1VM8A 2GGOA 1G1LA 2WAWA 2NXVA 2QKXA 1GWWA 1QGQA 1LL3A 5C1GA 1I52A 1R7TA 3V8ZA 2RJ5A 3D98A 2V0JA 1ON8A 3V0OA 1HM0A 5CMGX 2FFVA 1ZCTA 4B4BA 4D11A 5C8RA 4K6RA 1JYLA 4FROA 3F1YA 1WT1A 2FYDB 3V0NA 1LL0A 1O23B 1HJLA 1ZJ3A 1WT3A 3E26A 2V0HA 1VPAA 1H7EA 5D91A 1LZ7A 2RJ4A 3SXEA 3U0XA 2AECA 1GQ9A 4FIXA 4Y7FA 1NKHB 3USRA 2OI7A 2J0BA 2P72A 4HO2A 4D0ZA 1H5SD 2YQCA 4FRDA 2WVMA 4KC2A 5CQOA 4B2WA 3DUVA 4NANA 2D0JA 2P73A 2O1HA 5FTSA 1NQIB 5C4EA 4KQLA 2ZU9A 4KPZA 1VH3A 1NWGB 2OI5A 2YESA 3I0LA 1R7XA 4KNRA 1EYRA 4O6MA 3ST8A 2DPWA 4MYBA 2RJ6A 1VZUA 1ZI3A 4ECMA 3CKOA 2A8WA 4MNDA 1E5KA 2I5EA 1G2VA 2RJ8A 2X65A 1TW1A 1W77A 4Y7GA 2WEEA 3JUKA 4CJCA 1IIMA 1ZI5A 4KRVA 1G0RA 1WVCA 1WT0A 3KIAA 2PGVA 1W57A 2AM4A 5CMIA 1JV3A 4C2SA 1XZ6A 1QG8A 4EVWA 2BO8A 1FO8A 2Y4JA 2YC3A 1OMZA 3Q7UA 3USQA 4FRQA 5C49A 2BO4A 3SXCA 3U2UA 3N9WA 5C38A 5C3AA 3U2TA 1QWJA 2AH9A 2FYAA 5FUHA 2I7BA 3CGXA 1LZ0A 2E3DA 3FOQA 1H4EA 2GGQA 1H7HA 4NALA 3CKVA 3PNNA 3RMVA 1HM8A 2OEGA 3I0JA 2J0AA 1JV1A 3I0IX 5EJ1A 2JCKA 4M2AA 1H5RA 4FREA 2RJ7A 2YC5A 2CU2A 2V0IA 2VXLA 2XMHA 1MP5A 2C0NA 2X5SA 4G3QA 2OI6A 2VS3A 3TZTA 2PX7A 5C4CA 4Y6NA 1TZFA 2XMEA 2ICXA 4Y64A 4FRMA 5C4FA 3OKRA 5DDTA 1R7YA 3SXAA 4ARWA 5AJPA 1HM9A 4P02A 2YCMA 2JCOA 1H5SC 4HO5A 2FY7A 5JQQA 4B3UA 2RJ9A 1O0RA 1YP3A 3BCVA 1S4OA 2RIXA 4G87A 4FRHA 2ZU8A 1PZTA 1H5SB 2W0WA 3V0LA 4GBPA 2PA4A 3I0HA 1ZJOA 4HO0A 3I0CA 4JD0A 3ZF8A 5J49A 2Y4KA 1ZJPA 1IINA 1MP3A 3ZGGA 3OH3A 5C3DA 4Y9XA 3I0KA 4ASJA 1H5RB 2WE9A 1S4NA 4AC3A 1FZWA 2RJ0A 2RITA 4DE7A 4FRLA 1INJA 1FGGA 1MC3A 3V0MA 3K8EA 2MZBA 4HO9A 2AM3A 4AYLA 4KXOA 1Z90A 4CJ8A 4Y62A 1G3LA 3NGWA 3CKQA 4M28A 1FR9A 4ZDQA 1FG5N 4HG6A 2VS5A 5C1LA 1H3MA 4YS8A 3SXGA 1LL2A 3I0DA 3CKNA 1FXJA 5CMJA 3D8VA 2AM5A 5BXCA 5FU8A 2XWNA 5C48A 3IOJA 3SX5A 1H5TA 4HO4A 4D11C 1WSZA 4BQHA 2RJ1A 3OH2A 5CQMX 3V0QA 3CU0A 2JCJA 3DK5A 5HS2A 3R3IA 3D5NA 4NAIA 5EIYA 4L41C 4EE5A 1JYKA 3U2VA 3RSBA 1KWSA 1OMXA 3LW6A 1S4PA 1GA8A 4D0TA 1H7FA 1ZI4A 1VZTA 5IFYA 1VICA 5FYEA 2UX8A 1H4DA 1FRWA 4HCQA 3OH0A 5I1FA 1O7OA 1H7GA 3Q80A 1ZCYA 1YROB 5CMHA 3SX8A 4HOCA 2OEFA 4FRPA 4Y7UA 4EEMA 1ZI1A 2RIYA 2Y4LA 4XWIA 2VXMA 1FWYA 1WT2A 2D7IA 2VFZA 1NF5B 2VSIA 2Y4MA 3U2WA 4G3PA 3I0EA 4FCEA 4FQWA 1EZIA 2YQSA 4KPXA 5C3BA 1TVYA 4R7PA 3T7NA 3POLA 4MIXA 3HL3A 2V0LA 1NHEB 2W0VA 3K8DA 3V0PA 2E8BA 1JVGA 1FO9A 2ZU7A 3GUEA 1GX0A 3SX3A 1JVDA 1R81A 2VK9A 2Y6PA 5IDTA 1R7VA 1FXOA 4Y6UA 4NAKA 4KNXA 2APCA 2WVKA 3SXDA 1ZDFA 2O1FA 3V91A 3SX7A 1ZCUA 5C36A 4D48A 4BMAA 2I5KA 4P00A 5DDVA 3IOIA 2VS4A 4M2BA 4AAWA 1H4CA 5CQNX 2FYBA 2AESA 2X5ZA 1ZCVA 3F1CA 1HV9A 4KT7A 4B42A 2D7RA 1V84A 3OAMA 3IOHA 1W55A 4IRPA 1MP4A 3E25A 3T7MA 1OQMB 3RMWA 1ZJ2A 5CMFX 3OH1A 3SXBA 1PZYB 5FV9A 3JUJA 2JCLA 4B4MA 1K4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B2X A;  3OC9 A;  1ZIZ A;  4CJB A;  4DDZ A;  1INI A;  1XHB A;  1ZHJ A;  4HO8 A;  1QGS A;  1VGW A;  3SPT A;  1G97 A;  4AYJ A;  1YP4 A;  2BO6 A;  5C4B A;  3CKJ A;  3EE5 A;  1ZJ0 A;  3T7O A;  1G93 A;  4EEA A;  4HO6 A;  4JIS A;  4Y7T A;  2QGI A;  1LZI A;  4E1K A;  1H7T A;  5AJO A;  2WGZ A;  2FFU A;  3V8Y A;  3I0G A;  5EJZ A;  1ZJ1 A;  4M4K A;  2RIZ A;  5L6S A;  4LW6 A;  2YQJ A;  5FU0 A;  1TW5 A;  2VSH A;  3OH4 A;  1V83 A;  2YQH A;  4G3S A;  1VGT A;  2ICY A;  3ZLK A;  4EEG A;  2XWM A;  5IDS A;  1VGU A;  4CVH A;  1R82 A;  2Z86 A;  3O3P A;  3V90 A;  3BRK X;  1LZJ A;  3FWW A;  2A8U A;  4EEO A;  1R80 A;  2AGD A;  4EE3 A;  1ON6 A;  1VZX A;  1O7Q A;  1VH1 A;  2AE7 A;  3OGZ A;  5CQL X;  3ZGF A;  4UEG A;  1H7L A;  4Y63 A;  5CQP A;  1NMM B;  3U0Y A;  1G23 A;  2V0K A;  1G95 A;  1LVW A;  2Z87 A;  2WVL A;  4B5B A;  1GQC A;  2P6W A;  1H5S A;  3PKQ A;  1FOA A;  4HO3 A;  4J18 A;  5L6V A;  1VGZ A;  4EE4 A;  2FYC B;  1G9R A;  2XWL A;  1H5T B;  5FTV A;  3I0F A;  3QVB A;  5C4D A;  2X60 A;  3R2W A;  4FCU A;  2PGY A;  1FGX A;  4DEC A;  1G8O A;  3Q4S A;  4FRA A;  4KC1 A;  1FR8 A;  2O1G A;  3DJ4 A;  1H7Q A;  1GWV A;  1GX4 A;  2QH5 A;  1HJJ A;  4Y7V A;  2Q4J A;  4ASY A;  4FRB A;  4B4G A;  2VD4 A;  3TQD A;  2BO7 A;  1V82 A;  4KC4 A;  1ZDG A;  1SS9 A;  1YP2 A;  5C47 A;  5AJN A;  4LW3 A;  5C1H A;  2Y7A A;  1R7U A;  3ZLL A;  3U2X A;  3JTJ A;  3PKP A;  4IRQ A;  1VM8 A;  2GGO A;  1G1L A;  2WAW A;  2NXV A;  2QKX A;  1GWW A;  1QGQ A;  1LL3 A;  5C1G A;  1I52 A;  1R7T A;  3V8Z A;  2RJ5 A;  3D98 A;  2V0J A;  1ON8 A;  3V0O A;  1HM0 A;  5CMG X;  2FFV A;  1ZCT A;  4B4B A;  4D11 A;  5C8R A;  4K6R A;  1JYL A;  4FRO A;  3F1Y A;  1WT1 A;  2FYD B;  3V0N A;  1LL0 A;  1O23 B;  1HJL A;  1ZJ3 A;  1WT3 A;  3E26 A;  2V0H A;  1VPA A;  1H7E A;  1LZ7 A;  2RJ4 A;  3SXE A;  3U0X A;  2AEC A;  1GQ9 A;  4Y7F A;  1NKH B;  3USR A;  2OI7 A;  2P72 A;  4HO2 A;  4D0Z A;  1H5S D;  2YQC A;  4FRD A;  2WVM A;  4KC2 A;  5CQO A;  4B2W A;  3DUV A;  4NAN A;  2D0J A;  2P73 A;  2O1H A;  5FTS A;  1NQI B;  5C4E A;  4KQL A;  2ZU9 A;  4KPZ A;  1VH3 A;  1NWG B;  2OI5 A;  2YES A;  3I0L A;  1R7X A;  4KNR A;  1EYR A;  3ST8 A;  2DPW A;  4MYB A;  2RJ6 A;  1VZU A;  1ZI3 A;  4ECM A;  3CKO A;  2A8W A;  4MND A;  1E5K A;  2I5E A;  1G2V A;  2RJ8 A;  2X65 A;  1TW1 A;  1W77 A;  4Y7G A;  2WEE A;  3JUK A;  4CJC A;  1IIM A;  1ZI5 A;  4KRV A;  1G0R A;  1WVC A;  1WT0 A;  3KIA A;  2PGV A;  1W57 A;  2AM4 A;  5CMI A;  1JV3 A;  4C2S A;  1XZ6 A;  1QG8 A;  4EVW A;  2BO8 A;  1FO8 A;  2Y4J A;  2YC3 A;  1OMZ A;  3Q7U A;  3USQ A;  4FRQ A;  5C49 A;  2BO4 A;  3SXC A;  3U2U A;  3N9W A;  5C38 A;  5C3A A;  3U2T A;  1QWJ A;  2AH9 A;  2FYA A;  5FUH A;  2I7B A;  3CGX A;  1LZ0 A;  2E3D A;  3FOQ A;  1H4E A;  2GGQ A;  1H7H A;  4NAL A;  3CKV A;  3PNN A;  3RMV A;  1HM8 A;  2OEG A;  3I0J A;  1JV1 A;  3I0I X;  5EJ1 A;  2JCK A;  4M2A A;  1H5R A;  4FRE A;  2RJ7 A;  2YC5 A;  2CU2 A;  2V0I A;  2VXL A;  2XMH A;  1MP5 A;  2X5S A;  4G3Q A;  2OI6 A;  2VS3 A;  3TZT A;  2PX7 A;  5C4C A;  4Y6N A;  1TZF A;  2XME A;  2ICX A;  4Y64 A;  4FRM A;  5C4F A;  3OKR A;  5DDT A;  1R7Y A;  3SXA A;  4ARW A;  5AJP A;  1HM9 A;  4P02 A;  2YCM A;  2JCO A;  1H5S C;  4HO5 A;  2FY7 A;  5JQQ A;  4B3U A;  2RJ9 A;  1O0R A;  1YP3 A;  3BCV A;  1S4O A;  2RIX A;  4G87 A;  4FRH A;  2ZU8 A;  1PZT A;  1H5S B;  2W0W A;  3V0L A;  4GBP A;  2PA4 A;  3I0H A;  1ZJO A;  4HO0 A;  3I0C A;  4JD0 A;  3ZF8 A;  5J49 A;  2Y4K A;  1ZJP A;  1IIN A;  1MP3 A;  3ZGG A;  3OH3 A;  5C3D A;  4Y9X A;  3I0K A;  4ASJ A;  1H5R B;  2WE9 A;  1S4N A;  4AC3 A;  1FZW A;  2RJ0 A;  2RIT A;  4DE7 A;  4FRL A;  1INJ A;  1FGG A;  1MC3 A;  3V0M A;  3K8E A;  2MZB A;  4HO9 A;  2AM3 A;  4AYL A;  4KXO A;  1Z90 A;  4CJ8 A;  4Y62 A;  1G3L A;  3NGW A;  3CKQ A;  4M28 A;  1FR9 A;  4ZDQ A;  1FG5 N;  4HG6 A;  2VS5 A;  5C1L A;  1H3M A;  4YS8 A;  3SXG A;  1LL2 A;  3I0D A;  3CKN A;  1FXJ A;  5CMJ A;  3D8V A;  2AM5 A;  5BXC A;  5FU8 A;  2XWN A;  5C48 A;  3IOJ A;  3SX5 A;  1H5T A;  4HO4 A;  4D11 C;  1WSZ A;  4BQH A;  2RJ1 A;  3OH2 A;  5CQM X;  3V0Q A;  3CU0 A;  2JCJ A;  3DK5 A;  5HS2 A;  3R3I A;  3D5N A;  4NAI A;  5EIY A;  4L41 C;  4EE5 A;  1JYK A;  3U2V A;  3RSB A;  1KWS A;  1OMX A;  3LW6 A;  1S4P A;  1GA8 A;  4D0T A;  1H7F A;  1ZI4 A;  1VZT A;  5IFY A;  1VIC A;  5FYE A;  2UX8 A;  1H4D A;  1FRW A;  4HCQ A;  3OH0 A;  5I1F A;  1O7O A;  1H7G A;  3Q80 A;  1ZCY A;  1YRO B;  5CMH A;  3SX8 A;  4HOC A;  2OEF A;  4FRP A;  4Y7U A;  4EEM A;  1ZI1 A;  2RIY A;  2Y4L A;  4XWI A;  2VXM A;  1FWY A;  1WT2 A;  2D7I A;  2VFZ A;  1NF5 B;  2VSI A;  2Y4M A;  3U2W A;  4G3P A;  3I0E A;  4FCE A;  4FQW A;  1EZI A;  2YQS A;  4KPX A;  5C3B A;  1TVY A;  4R7P A;  3T7N A;  3POL A;  3HL3 A;  2V0L A;  1NHE B;  2W0V A;  3K8D A;  3V0P A;  2E8B A;  1JVG A;  1FO9 A;  2ZU7 A;  3GUE A;  1GX0 A;  3SX3 A;  1JVD A;  1R81 A;  2Y6P A;  5IDT A;  1R7V A;  1FXO A;  4Y6U A;  4NAK A;  4KNX A;  2APC A;  2WVK A;  3SXD A;  1ZDF A;  2O1F A;  3V91 A;  3SX7 A;  1ZCU A;  5C36 A;  4D48 A;  4BMA A;  2I5K A;  4P00 A;  5DDV A;  3IOI A;  2VS4 A;  4M2B A;  4AAW A;  1H4C A;  5CQN X;  2FYB A;  2AES A;  2X5Z A;  1ZCV A;  3F1C A;  1HV9 A;  4KT7 A;  4B42 A;  2D7R A;  1V84 A;  3OAM A;  3IOH A;  1W55 A;  4IRP A;  1MP4 A;  3E25 A;  3T7M A;  1OQM B;  3RMW A;  1ZJ2 A;  5CMF X;  3OH1 A;  3SXB A;  1PZY B;  5FV9 A;  3JUJ A;  2JCL A;  4B4M A;  1K4V A; 
#chains in the Genus database with same CATH topology
 4FIY A;  4B2X A;  3OC9 A;  1ZIZ A;  4CJB A;  4DDZ A;  1INI A;  1XHB A;  5D92 A;  1ZHJ A;  4HO8 A;  1QGS A;  1VGW A;  3SPT A;  1G97 A;  4AYJ A;  1YP4 A;  2BO6 A;  5C4B A;  3CKJ A;  3EE5 A;  1ZJ0 A;  3T7O A;  1G93 A;  4EEA A;  4HO6 A;  4JIS A;  4Y7T A;  2QGI A;  1LZI A;  4E1K A;  1H7T A;  5AJO A;  2WGZ A;  2FFU A;  3V8Y A;  3I0G A;  5EJZ A;  1ZJ1 A;  4M4K A;  2RIZ A;  5L6S A;  4LW6 A;  2YQJ A;  5FU0 A;  1TW5 A;  2VSH A;  3OH4 A;  1V83 A;  2YQH A;  4G3S A;  1VGT A;  2ICY A;  3ZLK A;  4EEG A;  2XWM A;  5IDS A;  1VGU A;  4CVH A;  1R82 A;  2Z86 A;  3O3P A;  3V90 A;  3BRK X;  1LZJ A;  3FWW A;  2A8U A;  4EEO A;  1R80 A;  2AGD A;  4EE3 A;  1ON6 A;  1VZX A;  1O7Q A;  1VH1 A;  2AE7 A;  3OGZ A;  5CQL X;  3ZGF A;  4UEG A;  1H7L A;  4Y63 A;  5CQP A;  1NMM B;  3U0Y A;  1G23 A;  2V0K A;  1G95 A;  1LVW A;  2Z87 A;  2WVL A;  4B5B A;  1GQC A;  2P6W A;  1H5S A;  3PKQ A;  1FOA A;  4HO3 A;  4J18 A;  5L6V A;  1VGZ A;  4EE4 A;  2FYC B;  1G9R A;  2XWL A;  1H5T B;  5FTV A;  3I0F A;  3QVB A;  5C4D A;  2X60 A;  3R2W A;  4FCU A;  2PGY A;  1FGX A;  4DEC A;  1G8O A;  3Q4S A;  4FRA A;  4KC1 A;  1FR8 A;  2O1G A;  3DJ4 A;  1H7Q A;  1GWV A;  1GX4 A;  4Q7C A;  2QH5 A;  1HJJ A;  4Y7V A;  2Q4J A;  4ASY A;  4FRB A;  4B4G A;  2VD4 A;  4O6N A;  3TQD A;  2BO7 A;  1V82 A;  4KC4 A;  1ZDG A;  1SS9 A;  1YP2 A;  5C47 A;  5AJN A;  4LW3 A;  5C1H A;  2Y7A A;  1R7U A;  3ZLL A;  3U2X A;  3JTJ A;  3PKP A;  4IRQ A;  1VM8 A;  2GGO A;  1G1L A;  2WAW A;  2NXV A;  2QKX A;  1GWW A;  1QGQ A;  1LL3 A;  5C1G A;  1I52 A;  1R7T A;  3V8Z A;  2RJ5 A;  3D98 A;  2V0J A;  1ON8 A;  3V0O A;  1HM0 A;  5CMG X;  2FFV A;  1ZCT A;  4B4B A;  4D11 A;  5C8R A;  4K6R A;  1JYL A;  4FRO A;  3F1Y A;  1WT1 A;  2FYD B;  3V0N A;  1LL0 A;  1O23 B;  1HJL A;  1ZJ3 A;  1WT3 A;  3E26 A;  2V0H A;  1VPA A;  1H7E A;  5D91 A;  1LZ7 A;  2RJ4 A;  3SXE A;  3U0X A;  2AEC A;  1GQ9 A;  4FIX A;  4Y7F A;  1NKH B;  3USR A;  2OI7 A;  2J0B A;  2P72 A;  4HO2 A;  4D0Z A;  1H5S D;  2YQC A;  4FRD A;  2WVM A;  4KC2 A;  5CQO A;  4B2W A;  3DUV A;  4NAN A;  2D0J A;  2P73 A;  2O1H A;  5FTS A;  1NQI B;  5C4E A;  4KQL A;  2ZU9 A;  4KPZ A;  1VH3 A;  1NWG B;  2OI5 A;  2YES A;  3I0L A;  1R7X A;  4KNR A;  1EYR A;  4O6M A;  3ST8 A;  2DPW A;  4MYB A;  2RJ6 A;  1VZU A;  1ZI3 A;  4ECM A;  3CKO A;  2A8W A;  4MND A;  1E5K A;  2I5E A;  1G2V A;  2RJ8 A;  2X65 A;  1TW1 A;  1W77 A;  4Y7G A;  2WEE A;  3JUK A;  4CJC A;  1IIM A;  1ZI5 A;  4KRV A;  1G0R A;  1WVC A;  1WT0 A;  3KIA A;  2PGV A;  1W57 A;  2AM4 A;  5CMI A;  1JV3 A;  4C2S A;  1XZ6 A;  1QG8 A;  4EVW A;  2BO8 A;  1FO8 A;  2Y4J A;  2YC3 A;  1OMZ A;  3Q7U A;  3USQ A;  4FRQ A;  5C49 A;  2BO4 A;  3SXC A;  3U2U A;  3N9W A;  5C38 A;  5C3A A;  3U2T A;  1QWJ A;  2AH9 A;  2FYA A;  5FUH A;  2I7B A;  3CGX A;  1LZ0 A;  2E3D A;  3FOQ A;  1H4E A;  2GGQ A;  1H7H A;  4NAL A;  3CKV A;  3PNN A;  3RMV A;  1HM8 A;  2OEG A;  3I0J A;  2J0A A;  1JV1 A;  3I0I X;  5EJ1 A;  2JCK A;  4M2A A;  1H5R A;  4FRE A;  2RJ7 A;  2YC5 A;  2CU2 A;  2V0I A;  2VXL A;  2XMH A;  1MP5 A;  2C0N A;  2X5S A;  4G3Q A;  2OI6 A;  2VS3 A;  3TZT A;  2PX7 A;  5C4C A;  4Y6N A;  1TZF A;  2XME A;  2ICX A;  4Y64 A;  4FRM A;  5C4F A;  3OKR A;  5DDT A;  1R7Y A;  3SXA A;  4ARW A;  5AJP A;  1HM9 A;  4P02 A;  2YCM A;  2JCO A;  1H5S C;  4HO5 A;  2FY7 A;  5JQQ A;  4B3U A;  2RJ9 A;  1O0R A;  1YP3 A;  3BCV A;  1S4O A;  2RIX A;  4G87 A;  4FRH A;  2ZU8 A;  1PZT A;  1H5S B;  2W0W A;  3V0L A;  4GBP A;  2PA4 A;  3I0H A;  1ZJO A;  4HO0 A;  3I0C A;  4JD0 A;  3ZF8 A;  5J49 A;  2Y4K A;  1ZJP A;  1IIN A;  1MP3 A;  3ZGG A;  3OH3 A;  5C3D A;  4Y9X A;  3I0K A;  4ASJ A;  1H5R B;  2WE9 A;  1S4N A;  4AC3 A;  1FZW A;  2RJ0 A;  2RIT A;  4DE7 A;  4FRL A;  1INJ A;  1FGG A;  1MC3 A;  3V0M A;  3K8E A;  2MZB A;  4HO9 A;  2AM3 A;  4AYL A;  4KXO A;  1Z90 A;  4CJ8 A;  4Y62 A;  1G3L A;  3NGW A;  3CKQ A;  4M28 A;  1FR9 A;  4ZDQ A;  1FG5 N;  4HG6 A;  2VS5 A;  5C1L A;  1H3M A;  4YS8 A;  3SXG A;  1LL2 A;  3I0D A;  3CKN A;  1FXJ A;  5CMJ A;  3D8V A;  2AM5 A;  5BXC A;  5FU8 A;  2XWN A;  5C48 A;  3IOJ A;  3SX5 A;  1H5T A;  4HO4 A;  4D11 C;  1WSZ A;  4BQH A;  2RJ1 A;  3OH2 A;  5CQM X;  3V0Q A;  3CU0 A;  2JCJ A;  3DK5 A;  5HS2 A;  3R3I A;  3D5N A;  4NAI A;  5EIY A;  4L41 C;  4EE5 A;  1JYK A;  3U2V A;  3RSB A;  1KWS A;  1OMX A;  3LW6 A;  1S4P A;  1GA8 A;  4D0T A;  1H7F A;  1ZI4 A;  1VZT A;  5IFY A;  1VIC A;  5FYE A;  2UX8 A;  1H4D A;  1FRW A;  4HCQ A;  3OH0 A;  5I1F A;  1O7O A;  1H7G A;  3Q80 A;  1ZCY A;  1YRO B;  5CMH A;  3SX8 A;  4HOC A;  2OEF A;  4FRP A;  4Y7U A;  4EEM A;  1ZI1 A;  2RIY A;  2Y4L A;  4XWI A;  2VXM A;  1FWY A;  1WT2 A;  2D7I A;  2VFZ A;  1NF5 B;  2VSI A;  2Y4M A;  3U2W A;  4G3P A;  3I0E A;  4FCE A;  4FQW A;  1EZI A;  2YQS A;  4KPX A;  5C3B A;  1TVY A;  4R7P A;  3T7N A;  3POL A;  4MIX A;  3HL3 A;  2V0L A;  1NHE B;  2W0V A;  3K8D A;  3V0P A;  2E8B A;  1JVG A;  1FO9 A;  2ZU7 A;  3GUE A;  1GX0 A;  3SX3 A;  1JVD A;  1R81 A;  2VK9 A;  2Y6P A;  5IDT A;  1R7V A;  1FXO A;  4Y6U A;  4NAK A;  4KNX A;  2APC A;  2WVK A;  3SXD A;  1ZDF A;  2O1F A;  3V91 A;  3SX7 A;  1ZCU A;  5C36 A;  4D48 A;  4BMA A;  2I5K A;  4P00 A;  5DDV A;  3IOI A;  2VS4 A;  4M2B A;  4AAW A;  1H4C A;  5CQN X;  2FYB A;  2AES A;  2X5Z A;  1ZCV A;  3F1C A;  1HV9 A;  4KT7 A;  4B42 A;  2D7R A;  1V84 A;  3OAM A;  3IOH A;  1W55 A;  4IRP A;  1MP4 A;  3E25 A;  3T7M A;  1OQM B;  3RMW A;  1ZJ2 A;  5CMF X;  3OH1 A;  3SXB A;  1PZY B;  5FV9 A;  3JUJ A;  2JCL A;  4B4M A;  1K4V A; 
#chains in the Genus database with same CATH homology
 4FIY A;  4B2X A;  3OC9 A;  1ZIZ A;  4CJB A;  4DDZ A;  1INI A;  1XHB A;  5D92 A;  1ZHJ A;  4HO8 A;  1QGS A;  1VGW A;  3SPT A;  1G97 A;  4AYJ A;  1YP4 A;  2BO6 A;  5C4B A;  3CKJ A;  3EE5 A;  1ZJ0 A;  3T7O A;  1G93 A;  4EEA A;  4HO6 A;  4JIS A;  4Y7T A;  2QGI A;  1LZI A;  4E1K A;  1H7T A;  5AJO A;  2WGZ A;  2FFU A;  3V8Y A;  3I0G A;  5EJZ A;  1ZJ1 A;  4M4K A;  2RIZ A;  5L6S A;  4LW6 A;  2YQJ A;  5FU0 A;  1TW5 A;  2VSH A;  3OH4 A;  1V83 A;  2YQH A;  4G3S A;  1VGT A;  2ICY A;  3ZLK A;  4EEG A;  2XWM A;  5IDS A;  1VGU A;  4CVH A;  1R82 A;  2Z86 A;  3O3P A;  3V90 A;  3BRK X;  1LZJ A;  3FWW A;  2A8U A;  4EEO A;  1R80 A;  2AGD A;  4EE3 A;  1ON6 A;  1VZX A;  1O7Q A;  1VH1 A;  2AE7 A;  3OGZ A;  5CQL X;  3ZGF A;  4UEG A;  1H7L A;  4Y63 A;  5CQP A;  1NMM B;  3U0Y A;  1G23 A;  2V0K A;  1G95 A;  1LVW A;  2Z87 A;  2WVL A;  4B5B A;  1GQC A;  2P6W A;  1H5S A;  3PKQ A;  1FOA A;  4HO3 A;  4J18 A;  5L6V A;  1VGZ A;  4EE4 A;  2FYC B;  1G9R A;  2XWL A;  1H5T B;  5FTV A;  3I0F A;  3QVB A;  5C4D A;  2X60 A;  3R2W A;  4FCU A;  2PGY A;  1FGX A;  4DEC A;  1G8O A;  3Q4S A;  4FRA A;  4KC1 A;  1FR8 A;  2O1G A;  3DJ4 A;  1H7Q A;  1GWV A;  1GX4 A;  4Q7C A;  2QH5 A;  1HJJ A;  4Y7V A;  2Q4J A;  4ASY A;  4FRB A;  4B4G A;  2VD4 A;  4O6N A;  3TQD A;  2BO7 A;  1V82 A;  4KC4 A;  1ZDG A;  1SS9 A;  1YP2 A;  5C47 A;  5AJN A;  4LW3 A;  5C1H A;  2Y7A A;  1R7U A;  3ZLL A;  3U2X A;  3JTJ A;  3PKP A;  4IRQ A;  1VM8 A;  2GGO A;  1G1L A;  2WAW A;  2NXV A;  2QKX A;  1GWW A;  1QGQ A;  1LL3 A;  5C1G A;  1I52 A;  1R7T A;  3V8Z A;  2RJ5 A;  3D98 A;  2V0J A;  1ON8 A;  3V0O A;  1HM0 A;  5CMG X;  2FFV A;  1ZCT A;  4B4B A;  4D11 A;  5C8R A;  4K6R A;  1JYL A;  4FRO A;  3F1Y A;  1WT1 A;  2FYD B;  3V0N A;  1LL0 A;  1O23 B;  1HJL A;  1ZJ3 A;  1WT3 A;  3E26 A;  2V0H A;  1VPA A;  1H7E A;  5D91 A;  1LZ7 A;  2RJ4 A;  3SXE A;  3U0X A;  2AEC A;  1GQ9 A;  4FIX A;  4Y7F A;  1NKH B;  3USR A;  2OI7 A;  2J0B A;  2P72 A;  4HO2 A;  4D0Z A;  1H5S D;  2YQC A;  4FRD A;  2WVM A;  4KC2 A;  5CQO A;  4B2W A;  3DUV A;  4NAN A;  2D0J A;  2P73 A;  2O1H A;  5FTS A;  1NQI B;  5C4E A;  4KQL A;  2ZU9 A;  4KPZ A;  1VH3 A;  1NWG B;  2OI5 A;  2YES A;  3I0L A;  1R7X A;  4KNR A;  1EYR A;  4O6M A;  3ST8 A;  2DPW A;  4MYB A;  2RJ6 A;  1VZU A;  1ZI3 A;  4ECM A;  3CKO A;  2A8W A;  4MND A;  1E5K A;  2I5E A;  1G2V A;  2RJ8 A;  2X65 A;  1TW1 A;  1W77 A;  4Y7G A;  2WEE A;  3JUK A;  4CJC A;  1IIM A;  1ZI5 A;  4KRV A;  1G0R A;  1WVC A;  1WT0 A;  3KIA A;  2PGV A;  1W57 A;  2AM4 A;  5CMI A;  1JV3 A;  4C2S A;  1XZ6 A;  1QG8 A;  4EVW A;  2BO8 A;  1FO8 A;  2Y4J A;  2YC3 A;  1OMZ A;  3Q7U A;  3USQ A;  4FRQ A;  5C49 A;  2BO4 A;  3SXC A;  3U2U A;  3N9W A;  5C38 A;  5C3A A;  3U2T A;  1QWJ A;  2AH9 A;  2FYA A;  5FUH A;  2I7B A;  3CGX A;  1LZ0 A;  2E3D A;  3FOQ A;  1H4E A;  2GGQ A;  1H7H A;  4NAL A;  3CKV A;  3PNN A;  3RMV A;  1HM8 A;  2OEG A;  3I0J A;  2J0A A;  1JV1 A;  3I0I X;  5EJ1 A;  2JCK A;  4M2A A;  1H5R A;  4FRE A;  2RJ7 A;  2YC5 A;  2CU2 A;  2V0I A;  2VXL A;  2XMH A;  1MP5 A;  2C0N A;  2X5S A;  4G3Q A;  2OI6 A;  2VS3 A;  3TZT A;  2PX7 A;  5C4C A;  4Y6N A;  1TZF A;  2XME A;  2ICX A;  4Y64 A;  4FRM A;  5C4F A;  3OKR A;  5DDT A;  1R7Y A;  3SXA A;  4ARW A;  5AJP A;  1HM9 A;  4P02 A;  2YCM A;  2JCO A;  1H5S C;  4HO5 A;  2FY7 A;  5JQQ A;  4B3U A;  2RJ9 A;  1O0R A;  1YP3 A;  3BCV A;  1S4O A;  2RIX A;  4G87 A;  4FRH A;  2ZU8 A;  1PZT A;  1H5S B;  2W0W A;  3V0L A;  4GBP A;  2PA4 A;  3I0H A;  1ZJO A;  4HO0 A;  3I0C A;  4JD0 A;  3ZF8 A;  5J49 A;  2Y4K A;  1ZJP A;  1IIN A;  1MP3 A;  3ZGG A;  3OH3 A;  5C3D A;  4Y9X A;  3I0K A;  4ASJ A;  1H5R B;  2WE9 A;  1S4N A;  4AC3 A;  1FZW A;  2RJ0 A;  2RIT A;  4DE7 A;  4FRL A;  1INJ A;  1FGG A;  1MC3 A;  3V0M A;  3K8E A;  2MZB A;  4HO9 A;  2AM3 A;  4AYL A;  4KXO A;  1Z90 A;  4CJ8 A;  4Y62 A;  1G3L A;  3NGW A;  3CKQ A;  4M28 A;  1FR9 A;  4ZDQ A;  1FG5 N;  4HG6 A;  2VS5 A;  5C1L A;  1H3M A;  4YS8 A;  3SXG A;  1LL2 A;  3I0D A;  3CKN A;  1FXJ A;  5CMJ A;  3D8V A;  2AM5 A;  5BXC A;  5FU8 A;  2XWN A;  5C48 A;  3IOJ A;  3SX5 A;  1H5T A;  4HO4 A;  4D11 C;  1WSZ A;  4BQH A;  2RJ1 A;  3OH2 A;  5CQM X;  3V0Q A;  3CU0 A;  2JCJ A;  3DK5 A;  5HS2 A;  3R3I A;  3D5N A;  4NAI A;  5EIY A;  4L41 C;  4EE5 A;  1JYK A;  3U2V A;  3RSB A;  1KWS A;  1OMX A;  3LW6 A;  1S4P A;  1GA8 A;  4D0T A;  1H7F A;  1ZI4 A;  1VZT A;  5IFY A;  1VIC A;  5FYE A;  2UX8 A;  1H4D A;  1FRW A;  4HCQ A;  3OH0 A;  5I1F A;  1O7O A;  1H7G A;  3Q80 A;  1ZCY A;  1YRO B;  5CMH A;  3SX8 A;  4HOC A;  2OEF A;  4FRP A;  4Y7U A;  4EEM A;  1ZI1 A;  2RIY A;  2Y4L A;  4XWI A;  2VXM A;  1FWY A;  1WT2 A;  2D7I A;  2VFZ A;  1NF5 B;  2VSI A;  2Y4M A;  3U2W A;  4G3P A;  3I0E A;  4FCE A;  4FQW A;  1EZI A;  2YQS A;  4KPX A;  5C3B A;  1TVY A;  4R7P A;  3T7N A;  3POL A;  4MIX A;  3HL3 A;  2V0L A;  1NHE B;  2W0V A;  3K8D A;  3V0P A;  2E8B A;  1JVG A;  1FO9 A;  2ZU7 A;  3GUE A;  1GX0 A;  3SX3 A;  1JVD A;  1R81 A;  2VK9 A;  2Y6P A;  5IDT A;  1R7V A;  1FXO A;  4Y6U A;  4NAK A;  4KNX A;  2APC A;  2WVK A;  3SXD A;  1ZDF A;  2O1F A;  3V91 A;  3SX7 A;  1ZCU A;  5C36 A;  4D48 A;  4BMA A;  2I5K A;  4P00 A;  5DDV A;  3IOI A;  2VS4 A;  4M2B A;  4AAW A;  1H4C A;  5CQN X;  2FYB A;  2AES A;  2X5Z A;  1ZCV A;  3F1C A;  1HV9 A;  4KT7 A;  4B42 A;  2D7R A;  1V84 A;  3OAM A;  3IOH A;  1W55 A;  4IRP A;  1MP4 A;  3E25 A;  3T7M A;  1OQM B;  3RMW A;  1ZJ2 A;  5CMF X;  3OH1 A;  3SXB A;  1PZY B;  5FV9 A;  3JUJ A;  2JCL A;  4B4M A;  1K4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...