1HJJA

Biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
188
structure length
188
Chain Sequence
MTTITGVVLAGGKARRMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVDVNTPEELARWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Molybdenum cofactor biosynthesis
molecule keywords MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS PROTEIN A
publication title Biochemical and Structural Analysis of the Molybdenum Cofactor Biosynthesis Protein Moba
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 188
sequence length 188
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1hjjA00
4FRDA 4Y7UA 1MP4A 4HO6A 4R7PA 1LL2A 2Y4MA 1FXJA 1H7EA 2O1HA 4EEOA 1FR9A 4ECMA 4KPXA 3V0PA 2FYDB 3V0MA 4KC4A 2XWLA 3SXGA 2RIYA 3I0GA 2V0KA 2OI5A 3HL3A 2RJ8A 5FV9A 1LL0A 2E3DA 1ZHJA 5CQNX 1NMMB 3SX8A 4FCEA 2D0JA 4NALA 2RIXA 1PZTA 4KNXA 2OI6A 2RJ1A 3BCVA 1R81A 2JCOA 5IDTA 3QVBA 3U0XA 3DUVA 2XWNA 4Y7TA 4FROA 3T7OA 2NXVA 3F1YA 2BO8A 1LZ0A 5L6SA 1YP2A 3R3IA 3JUJA 3D98A 2ICYA 2PA4A 3V0NA 3OC9A 3SXDA 2OEGA 2QH5A 2Y4KA 1E5KA 2AM4A 1G95A 3PKQA 2RJ6A 4C2SA 3JUKA 1ZJ1A 2AH9A 4KPZA 1VZUA 4EE5A 2JCLA 1O7OA 2BO7A 4KXOA 4YS8A 2AE7A 4KQLA 4FRQA 3ZLKA 3NGWA 5JQQA 1H5SB 4CVHA 3CU0A 1G8OA 2FYAA 5HS2A 1IIMA 2VFZA 5C38A 1QGSA 4Y64A 1ZCTA 4KC1A 3PNNA 2ICXA 1FGGA 1YP4A 3U2UA 4NAIA 2PGVA 3I0FA 4AC3A 5AJNA 1G0RA 5C48A 2V0LA 3POLA 4HO4A 2PX7A 1H7TA 3OH3A 1IINA 4FCUA 1G3LA 1ZJ2A 3DJ4A 4XWIA 1LL3A 1H3MA 5C4BA 1TW5A 1MP3A 2JCKA 5FTSA 1H7GA 1FGXA 2ZU7A 2VS5A 1H7FA 1H5SD 4G3PA 1JV3A 2VXMA 1VZXA 2YQCA 3SX3A 4B4BA 2VS3A 3SXEA 4DE7A 1JYLA 4HO3A 3ZGGA 1YROB 1ZI5A 1WVCA 3OH0A 5AJPA 5L6VA 3JTJA 3KIAA 1ZJOA 3ST8A 1ZDGA 2I5KA 2O1FA 2DPWA 1WT0A 4Y6NA 3OKRA 3CKQA 2QGIA 4GBPA 1ZJPA 2V0HA 1R7VA 3IOJA 1NKHB 2AM5A 2FFUA 4G3QA 4HO5A 1GWWA 4NANA 1H5RB 5C4EA 5EIYA 3ZGFA 2YC3A 1OMZA 5FUHA 1GA8A 5DDVA 2YQJA 1O7QA 5C4FA 1VPAA 2X65A 5CMHA 4Y9XA 1HM0A 5CQOA 1INIA 3CGXA 4NAKA 4EVWA 3SX5A 3OGZA 3CKJA 4KNRA 2WE9A 1ON6A 4FQWA 3I0DA 5CMFX 1HV9A 2GGOA 5CQPA 4FRMA 1TVYA 1JV1A 4HO9A 1K4VA 2WAWA 4HO2A 1QWJA 1EZIA 1H5SC 1R80A 1VH3A 1VH1A 4Y6UA 4FRBA 1G93A 1GQ9A 3OH1A 2WVMA 1H4DA 4FRPA 3T7NA 4E1KA 4L41C 2PGYA 1MP5A 2QKXA 3ZLLA 2XMEA 1V82A 4M2BA 3U2TA 2WVKA 2W0VA 3E26A 3Q7UA 2O1GA 4D0ZA 2Y6PA 3SXBA 2FYBA 3USQA 3U2WA 3Q80A 1HM9A 1WT3A 5C47A 2VD4A 1GX4A 1ZDFA 5J49A 2CU2A 5BXCA 3U2XA 4B2WA 5EJ1A 1R7TA 2V0IA 2YQSA 3LW6A 2V0JA 5C8RA 4KT7A 2X5SA 1ZJ0A 1NQIB 1GQCA 2Q4JA 3SX7A 1WSZA 1PZYB 3I0JA 3OH4A 2A8WA 1GX0A 4Y7VA 4BMAA 3IOHA 4MYBA 1WT1A 1NF5B 3U0YA 3EE5A 2FYCB 1NWGB 1ZI4A 1R82A 4LW6A 5CMIA 2I5EA 3V90A 1FR8A 1H5TB 3OH2A 4EEAA 1FWYA 1S4NA 1XHBA 5C4CA 5C36A 3USRA 1R7YA 3CKVA 2UX8A 4ASJA 4ASYA 4B4MA 3R2WA 4HOCA 1FG5N 1W77A 4HO8A 1JVDA 1QG8A 4CJBA 1HJJA 2I7BA 3V0QA 3I0CA 1FZWA 2WGZA 2BO4A 1Z90A 1VZTA 3V91A 5FTVA 2RJ5A 1LZIA 1G9RA 2P73A 5C4DA 1ZCUA 5IDSA 1R7XA 1H5SA 4ZDQA 4B3UA 5I1FA 5C1LA 4Y7FA 1ZCVA 4M4KA 2AECA 1HM8A 3RMVA 1H7QA 2RJ4A 4K6RA 2A8UA 3V0LA 2VSIA 1SS9A 2E8BA 1ON8A 2YESA 3OAMA 1G97A 3K8EA 5DDTA 5C49A 1FRWA 3V0OA 2RJ0A 1O23B 5C1HA 2YC5A 1H7LA 1W55A 1INJA 4B2XA 2Y4LA 2RIZA 2P6WA 4MNDA 3F1CA 4P02A 5CQLX 1VGWA 1VICA 1ZIZA 1W57A 1G2VA 5FYEA 4EEGA 2OEFA 3DK5A 1LZ7A 5C3BA 1ZCYA 3D8VA 2AESA 3TZTA 4IRQA 1H4EA 2Y4JA 5AJOA 3T7MA 2VS4A 1LVWA 5FU8A 3O3PA 4D11A 2BO6A 1HJLA 3ZF8A 2WEEA 4P00A 4AAWA 1H7HA 3I0IX 2YQHA 4Y7GA 2RJ9A 1OQMB 5FU0A 4JISA 5IFYA 2JCJA 2RJ7A 3V8ZA 3K8DA 1O0RA 4EE3A 4BQHA 4AYLA 4Y62A 1H5RA 3N9WA 2ZU8A 2WVLA 4AYJA 3D5NA 2APCA 4FREA 1QGQA 2AGDA 4Y63A 1MC3A 4JD0A 4J18A 5C3DA 1G23A 2X60A 1OMXA 3I0HA 4D11C 1V84A 1I52A 4B42A 4CJ8A 3Q4SA 3IOIA 1EYRA 4DECA 3RMWA 2RITA 4HO0A 1FOAA 2OI7A 1H4CA 4KC2A 4FRLA 5EJZA 5C1GA 2Y7AA 3PKPA 2XWMA 2W0WA 1FO9A 3E25A 4HCQA 1XZ6A 1VM8A 2X5ZA 3FWWA 2D7RA 2Z87A 4ARWA 5CMJA 3TQDA 1S4OA 2XMHA 3SXAA 4FRHA 3I0LA 4G87A 3SPTA 2Z86A 4B5BA 2ZU9A 1JVGA 5CMGX 1ZI1A 1R7UA 2VXLA 5CQMX 1ZJ3A 3FOQA 1NHEB 2FY7A 2FFVA 3I0KA 3GUEA 1KWSA 4UEGA 4EEMA 1TZFA 2D7IA 4EE4A 2VSHA 4M28A 1S4PA 4B4GA 3I0EA 4FRAA 1FO8A 3U2VA 3BRKX 3CKOA 3CKNA 3SXCA 4D0TA 1TW1A 4HG6A 4D48A 1LZJA 4IRPA 3RSBA 2GGQA 3V8YA 4M2AA 2AM3A 1GWVA 1WT2A 4KRVA 1VGUA 4G3SA 1V83A 2YCMA 5C3AA 4DDZA 1H5TA 2P72A 2MZBA 1ZI3A 1VGTA 1JYKA 1YP3A 1G1LA 4CJCA 1FXOA 1VGZA 4LW3A
chains in the Genus database with same CATH superfamily
4FRDA 4Y7UA 1MP4A 4HO6A 4R7PA 1LL2A 2Y4MA 1FXJA 1H7EA 5D91A 2O1HA 4EEOA 1FR9A 4ECMA 4KPXA 4O6MA 3V0PA 2FYDB 3V0MA 4KC4A 2XWLA 3SXGA 2RIYA 3I0GA 2V0KA 2OI5A 3HL3A 2RJ8A 5FV9A 1LL0A 2E3DA 1ZHJA 5CQNX 1NMMB 3SX8A 4FCEA 2D0JA 4NALA 2RIXA 1PZTA 4KNXA 2OI6A 2RJ1A 3BCVA 1R81A 2JCOA 5IDTA 3QVBA 3U0XA 3DUVA 2XWNA 4Y7TA 4FROA 3T7OA 2NXVA 3F1YA 2BO8A 1LZ0A 5L6SA 1YP2A 3R3IA 3JUJA 3D98A 2ICYA 2PA4A 3V0NA 3OC9A 3SXDA 2OEGA 2QH5A 2Y4KA 2C0NA 4FIYA 1E5KA 2AM4A 1G95A 3PKQA 2RJ6A 4C2SA 3JUKA 1ZJ1A 2AH9A 4KPZA 1VZUA 4EE5A 2JCLA 1O7OA 2BO7A 4KXOA 4YS8A 2AE7A 4KQLA 4FRQA 3ZLKA 3NGWA 5JQQA 1H5SB 4CVHA 3CU0A 1G8OA 2FYAA 5HS2A 1IIMA 2VFZA 5C38A 1QGSA 4Y64A 1ZCTA 4KC1A 3PNNA 2ICXA 4Q7CA 1FGGA 1YP4A 3U2UA 4NAIA 2PGVA 3I0FA 4AC3A 5AJNA 1G0RA 5C48A 2V0LA 3POLA 4HO4A 2PX7A 1H7TA 3OH3A 1IINA 4FCUA 1G3LA 1ZJ2A 3DJ4A 4XWIA 1LL3A 1H3MA 5C4BA 1TW5A 1MP3A 2JCKA 5FTSA 1H7GA 1FGXA 2J0AA 2VS5A 2ZU7A 1H7FA 1H5SD 4G3PA 1JV3A 2VXMA 1VZXA 2YQCA 3SX3A 4B4BA 2VS3A 3SXEA 4DE7A 1JYLA 4HO3A 3ZGGA 1YROB 1ZI5A 1WVCA 3OH0A 5AJPA 5L6VA 3JTJA 3KIAA 1ZJOA 3ST8A 1ZDGA 2I5KA 2O1FA 2DPWA 1WT0A 4Y6NA 3OKRA 3CKQA 2QGIA 4GBPA 1ZJPA 2V0HA 1R7VA 3IOJA 1NKHB 2AM5A 2FFUA 4G3QA 4HO5A 2J0BA 1GWWA 4NANA 1H5RB 5C4EA 5EIYA 3ZGFA 2YC3A 1OMZA 5FUHA 1GA8A 5DDVA 2YQJA 4FIXA 1O7QA 5C4FA 1VPAA 2X65A 5CMHA 4Y9XA 1HM0A 5CQOA 1INIA 3CGXA 4NAKA 4EVWA 3SX5A 3OGZA 3CKJA 4KNRA 2WE9A 1ON6A 4FQWA 3I0DA 5CMFX 1HV9A 2GGOA 5CQPA 4FRMA 1TVYA 1JV1A 4HO9A 1K4VA 2WAWA 4HO2A 1QWJA 1EZIA 1H5SC 1R80A 1VH3A 1VH1A 4Y6UA 4FRBA 1G93A 1GQ9A 3OH1A 2WVMA 1H4DA 4FRPA 3T7NA 4E1KA 4L41C 2PGYA 1MP5A 2QKXA 3ZLLA 2XMEA 1V82A 4M2BA 3U2TA 2WVKA 2W0VA 3E26A 3Q7UA 2O1GA 4D0ZA 2Y6PA 3SXBA 2FYBA 3USQA 3U2WA 3Q80A 1HM9A 1WT3A 5C47A 2VD4A 1GX4A 1ZDFA 5J49A 2CU2A 5BXCA 3U2XA 4B2WA 5EJ1A 1R7TA 2V0IA 2YQSA 3LW6A 2V0JA 5C8RA 4KT7A 2X5SA 1ZJ0A 1NQIB 1GQCA 2Q4JA 3SX7A 1WSZA 1PZYB 3I0JA 3OH4A 2A8WA 1GX0A 4Y7VA 4BMAA 3IOHA 4MYBA 1WT1A 1NF5B 3U0YA 3EE5A 2FYCB 1NWGB 1ZI4A 1R82A 4LW6A 5CMIA 2I5EA 3V90A 1FR8A 1H5TB 3OH2A 4EEAA 1FWYA 1S4NA 1XHBA 5C4CA 5C36A 3USRA 1R7YA 3CKVA 2UX8A 4ASJA 4ASYA 4B4MA 3R2WA 4HOCA 1FG5N 1W77A 4HO8A 1JVDA 1QG8A 4CJBA 1HJJA 2I7BA 3V0QA 3I0CA 1FZWA 2WGZA 2BO4A 1Z90A 1VZTA 3V91A 5FTVA 2RJ5A 1LZIA 1G9RA 2P73A 5C4DA 1ZCUA 5IDSA 1R7XA 1H5SA 4ZDQA 4B3UA 5I1FA 5C1LA 4Y7FA 1ZCVA 4M4KA 2AECA 1HM8A 3RMVA 1H7QA 2VK9A 2RJ4A 4K6RA 2A8UA 3V0LA 2VSIA 1SS9A 2E8BA 1ON8A 2YESA 3OAMA 1G97A 3K8EA 5DDTA 5C49A 1FRWA 3V0OA 2RJ0A 1O23B 5C1HA 2YC5A 1H7LA 1W55A 1INJA 4B2XA 2Y4LA 2RIZA 2P6WA 4MNDA 3F1CA 4P02A 5CQLX 1VGWA 1VICA 1ZIZA 1W57A 1G2VA 5D92A 5FYEA 4EEGA 2OEFA 3DK5A 1LZ7A 5C3BA 1ZCYA 3D8VA 2AESA 3TZTA 4IRQA 1H4EA 2Y4JA 5AJOA 3T7MA 2VS4A 1LVWA 5FU8A 3O3PA 4D11A 2BO6A 1HJLA 3ZF8A 2WEEA 4P00A 4AAWA 1H7HA 3I0IX 2YQHA 4Y7GA 2RJ9A 1OQMB 5FU0A 4JISA 5IFYA 2JCJA 2RJ7A 3V8ZA 3K8DA 1O0RA 4EE3A 4BQHA 4AYLA 4Y62A 1H5RA 3N9WA 2ZU8A 4MIXA 2WVLA 4AYJA 3D5NA 2APCA 4FREA 1QGQA 2AGDA 4Y63A 1MC3A 4JD0A 4J18A 5C3DA 1G23A 2X60A 1OMXA 3I0HA 4D11C 1V84A 1I52A 4B42A 4CJ8A 3Q4SA 4O6NA 3IOIA 1EYRA 4DECA 3RMWA 2RITA 4HO0A 1FOAA 2OI7A 1H4CA 4KC2A 4FRLA 5EJZA 5C1GA 2Y7AA 3PKPA 2XWMA 2W0WA 1FO9A 3E25A 4HCQA 1XZ6A 1VM8A 2X5ZA 3FWWA 2D7RA 2Z87A 4ARWA 5CMJA 3TQDA 1S4OA 2XMHA 3SXAA 4FRHA 3I0LA 4G87A 3SPTA 2Z86A 4B5BA 2ZU9A 1JVGA 5CMGX 1ZI1A 1R7UA 2VXLA 5CQMX 1ZJ3A 3FOQA 1NHEB 2FY7A 2FFVA 3I0KA 3GUEA 1KWSA 4UEGA 4EEMA 1TZFA 2D7IA 4EE4A 2VSHA 4M28A 1S4PA 4B4GA 3I0EA 4FRAA 1FO8A 3U2VA 3BRKX 3CKOA 3CKNA 3SXCA 4D0TA 1TW1A 4HG6A 4D48A 1LZJA 4IRPA 3RSBA 2GGQA 3V8YA 4M2AA 2AM3A 1GWVA 1WT2A 4KRVA 1VGUA 4G3SA 1V83A 2YCMA 5C3AA 4DDZA 1H5TA 2P72A 2MZBA 1ZI3A 1VGTA 1JYKA 1YP3A 1G1LA 4CJCA 1FXOA 1VGZA 4LW3A
chains in the Genus database with same CATH topology
4FRDA 4Y7UA 1MP4A 4HO6A 4R7PA 1LL2A 2Y4MA 1FXJA 1H7EA 5D91A 2O1HA 4EEOA 1FR9A 4ECMA 4KPXA 4O6MA 3V0PA 2FYDB 3V0MA 4KC4A 2XWLA 3SXGA 2RIYA 3I0GA 2V0KA 2OI5A 3HL3A 2RJ8A 5FV9A 1LL0A 2E3DA 1ZHJA 5CQNX 1NMMB 3SX8A 4FCEA 2D0JA 4NALA 2RIXA 1PZTA 4KNXA 2OI6A 2RJ1A 3BCVA 1R81A 2JCOA 5IDTA 3QVBA 3U0XA 3DUVA 2XWNA 4Y7TA 4FROA 3T7OA 2NXVA 3F1YA 2BO8A 1LZ0A 5L6SA 1YP2A 3R3IA 3JUJA 3D98A 2ICYA 2PA4A 3V0NA 3OC9A 3SXDA 2OEGA 2QH5A 2Y4KA 2C0NA 4FIYA 1E5KA 2AM4A 1G95A 3PKQA 2RJ6A 4C2SA 3JUKA 1ZJ1A 2AH9A 4KPZA 1VZUA 4EE5A 2JCLA 1O7OA 2BO7A 4KXOA 4YS8A 2AE7A 4KQLA 4FRQA 3ZLKA 3NGWA 5JQQA 1H5SB 4CVHA 3CU0A 1G8OA 2FYAA 5HS2A 1IIMA 2VFZA 5C38A 1QGSA 4Y64A 1ZCTA 4KC1A 3PNNA 2ICXA 4Q7CA 1FGGA 1YP4A 3U2UA 4NAIA 2PGVA 3I0FA 4AC3A 5AJNA 1G0RA 5C48A 2V0LA 3POLA 4HO4A 2PX7A 1H7TA 3OH3A 1IINA 4FCUA 1G3LA 1ZJ2A 3DJ4A 4XWIA 1LL3A 1H3MA 5C4BA 1TW5A 1MP3A 2JCKA 5FTSA 1H7GA 1FGXA 2J0AA 2VS5A 2ZU7A 1H7FA 1H5SD 4G3PA 1JV3A 2VXMA 1VZXA 2YQCA 3SX3A 4B4BA 2VS3A 3SXEA 4DE7A 1JYLA 4HO3A 3ZGGA 1YROB 1ZI5A 1WVCA 3OH0A 5AJPA 5L6VA 3JTJA 3KIAA 1ZJOA 3ST8A 1ZDGA 2I5KA 2O1FA 2DPWA 1WT0A 4Y6NA 3OKRA 3CKQA 2QGIA 4GBPA 1ZJPA 2V0HA 1R7VA 3IOJA 1NKHB 2AM5A 2FFUA 4G3QA 4HO5A 2J0BA 1GWWA 4NANA 1H5RB 5C4EA 5EIYA 3ZGFA 2YC3A 1OMZA 5FUHA 1GA8A 5DDVA 2YQJA 4FIXA 1O7QA 5C4FA 1VPAA 2X65A 5CMHA 4Y9XA 1HM0A 5CQOA 1INIA 3CGXA 4NAKA 4EVWA 3SX5A 3OGZA 3CKJA 4KNRA 2WE9A 1ON6A 4FQWA 3I0DA 5CMFX 1HV9A 2GGOA 5CQPA 4FRMA 1TVYA 1JV1A 4HO9A 1K4VA 2WAWA 4HO2A 1QWJA 1EZIA 1H5SC 1R80A 1VH3A 1VH1A 4Y6UA 4FRBA 1G93A 1GQ9A 3OH1A 2WVMA 1H4DA 4FRPA 3T7NA 4E1KA 4L41C 2PGYA 1MP5A 2QKXA 3ZLLA 2XMEA 1V82A 4M2BA 3U2TA 2WVKA 2W0VA 3E26A 3Q7UA 2O1GA 4D0ZA 2Y6PA 3SXBA 2FYBA 3USQA 3U2WA 3Q80A 1HM9A 1WT3A 5C47A 2VD4A 1GX4A 1ZDFA 5J49A 2CU2A 5BXCA 3U2XA 4B2WA 5EJ1A 1R7TA 2V0IA 2YQSA 3LW6A 2V0JA 5C8RA 4KT7A 2X5SA 1ZJ0A 1NQIB 1GQCA 2Q4JA 3SX7A 1WSZA 1PZYB 3I0JA 3OH4A 2A8WA 1GX0A 4Y7VA 4BMAA 3IOHA 4MYBA 1WT1A 1NF5B 3U0YA 3EE5A 2FYCB 1NWGB 1ZI4A 1R82A 4LW6A 5CMIA 2I5EA 3V90A 1FR8A 1H5TB 3OH2A 4EEAA 1FWYA 1S4NA 1XHBA 5C4CA 5C36A 3USRA 1R7YA 3CKVA 2UX8A 4ASJA 4ASYA 4B4MA 3R2WA 4HOCA 1FG5N 1W77A 4HO8A 1JVDA 1QG8A 4CJBA 1HJJA 2I7BA 3V0QA 3I0CA 1FZWA 2WGZA 2BO4A 1Z90A 1VZTA 3V91A 5FTVA 2RJ5A 1LZIA 1G9RA 2P73A 5C4DA 1ZCUA 5IDSA 1R7XA 1H5SA 4ZDQA 4B3UA 5I1FA 5C1LA 4Y7FA 1ZCVA 4M4KA 2AECA 1HM8A 3RMVA 1H7QA 2VK9A 2RJ4A 4K6RA 2A8UA 3V0LA 2VSIA 1SS9A 2E8BA 1ON8A 2YESA 3OAMA 1G97A 3K8EA 5DDTA 5C49A 1FRWA 3V0OA 2RJ0A 1O23B 5C1HA 2YC5A 1H7LA 1W55A 1INJA 4B2XA 2Y4LA 2RIZA 2P6WA 4MNDA 3F1CA 4P02A 5CQLX 1VGWA 1VICA 1ZIZA 1W57A 1G2VA 5D92A 5FYEA 4EEGA 2OEFA 3DK5A 1LZ7A 5C3BA 1ZCYA 3D8VA 2AESA 3TZTA 4IRQA 1H4EA 2Y4JA 5AJOA 3T7MA 2VS4A 1LVWA 5FU8A 3O3PA 4D11A 2BO6A 1HJLA 3ZF8A 2WEEA 4P00A 4AAWA 1H7HA 3I0IX 2YQHA 4Y7GA 2RJ9A 1OQMB 5FU0A 4JISA 5IFYA 2JCJA 2RJ7A 3V8ZA 3K8DA 1O0RA 4EE3A 4BQHA 4AYLA 4Y62A 1H5RA 3N9WA 2ZU8A 4MIXA 2WVLA 4AYJA 3D5NA 2APCA 4FREA 1QGQA 2AGDA 4Y63A 1MC3A 4JD0A 4J18A 5C3DA 1G23A 2X60A 1OMXA 3I0HA 4D11C 1V84A 1I52A 4B42A 4CJ8A 3Q4SA 4O6NA 3IOIA 1EYRA 4DECA 3RMWA 2RITA 4HO0A 1FOAA 2OI7A 1H4CA 4KC2A 4FRLA 5EJZA 5C1GA 2Y7AA 3PKPA 2XWMA 2W0WA 1FO9A 3E25A 4HCQA 1XZ6A 1VM8A 2X5ZA 3FWWA 2D7RA 2Z87A 4ARWA 5CMJA 3TQDA 1S4OA 2XMHA 3SXAA 4FRHA 3I0LA 4G87A 3SPTA 2Z86A 4B5BA 2ZU9A 1JVGA 5CMGX 1ZI1A 1R7UA 2VXLA 5CQMX 1ZJ3A 3FOQA 1NHEB 2FY7A 2FFVA 3I0KA 3GUEA 1KWSA 4UEGA 4EEMA 1TZFA 2D7IA 4EE4A 2VSHA 4M28A 1S4PA 4B4GA 3I0EA 4FRAA 1FO8A 3U2VA 3BRKX 3CKOA 3CKNA 3SXCA 4D0TA 1TW1A 4HG6A 4D48A 1LZJA 4IRPA 3RSBA 2GGQA 3V8YA 4M2AA 2AM3A 1GWVA 1WT2A 4KRVA 1VGUA 4G3SA 1V83A 2YCMA 5C3AA 4DDZA 1H5TA 2P72A 2MZBA 1ZI3A 1VGTA 1JYKA 1YP3A 1G1LA 4CJCA 1FXOA 1VGZA 4LW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRD A;  4Y7U A;  1MP4 A;  4HO6 A;  4R7P A;  1LL2 A;  2Y4M A;  1FXJ A;  1H7E A;  2O1H A;  4EEO A;  1FR9 A;  4ECM A;  4KPX A;  3V0P A;  2FYD B;  3V0M A;  4KC4 A;  2XWL A;  3SXG A;  2RIY A;  3I0G A;  2V0K A;  2OI5 A;  3HL3 A;  2RJ8 A;  5FV9 A;  1LL0 A;  2E3D A;  1ZHJ A;  5CQN X;  1NMM B;  3SX8 A;  4FCE A;  2D0J A;  4NAL A;  2RIX A;  1PZT A;  4KNX A;  2OI6 A;  2RJ1 A;  3BCV A;  1R81 A;  2JCO A;  5IDT A;  3QVB A;  3U0X A;  3DUV A;  2XWN A;  4Y7T A;  4FRO A;  3T7O A;  2NXV A;  3F1Y A;  2BO8 A;  1LZ0 A;  5L6S A;  1YP2 A;  3R3I A;  3JUJ A;  3D98 A;  2ICY A;  2PA4 A;  3V0N A;  3OC9 A;  3SXD A;  2OEG A;  2QH5 A;  2Y4K A;  1E5K A;  2AM4 A;  1G95 A;  3PKQ A;  2RJ6 A;  4C2S A;  3JUK A;  1ZJ1 A;  2AH9 A;  4KPZ A;  1VZU A;  4EE5 A;  2JCL A;  1O7O A;  2BO7 A;  4KXO A;  4YS8 A;  2AE7 A;  4KQL A;  4FRQ A;  3ZLK A;  3NGW A;  5JQQ A;  1H5S B;  4CVH A;  3CU0 A;  1G8O A;  2FYA A;  5HS2 A;  1IIM A;  2VFZ A;  5C38 A;  1QGS A;  4Y64 A;  1ZCT A;  4KC1 A;  3PNN A;  2ICX A;  1FGG A;  1YP4 A;  3U2U A;  4NAI A;  2PGV A;  3I0F A;  4AC3 A;  5AJN A;  1G0R A;  5C48 A;  2V0L A;  3POL A;  4HO4 A;  2PX7 A;  1H7T A;  3OH3 A;  1IIN A;  4FCU A;  1G3L A;  1ZJ2 A;  3DJ4 A;  4XWI A;  1LL3 A;  1H3M A;  5C4B A;  1TW5 A;  1MP3 A;  2JCK A;  5FTS A;  1H7G A;  1FGX A;  2ZU7 A;  2VS5 A;  1H7F A;  1H5S D;  4G3P A;  1JV3 A;  2VXM A;  1VZX A;  2YQC A;  3SX3 A;  4B4B A;  2VS3 A;  3SXE A;  4DE7 A;  1JYL A;  4HO3 A;  3ZGG A;  1YRO B;  1ZI5 A;  1WVC A;  3OH0 A;  5AJP A;  5L6V A;  3JTJ A;  3KIA A;  1ZJO A;  3ST8 A;  1ZDG A;  2I5K A;  2O1F A;  2DPW A;  1WT0 A;  4Y6N A;  3OKR A;  3CKQ A;  2QGI A;  4GBP A;  1ZJP A;  2V0H A;  1R7V A;  3IOJ A;  1NKH B;  2AM5 A;  2FFU A;  4G3Q A;  4HO5 A;  1GWW A;  4NAN A;  1H5R B;  5C4E A;  5EIY A;  3ZGF A;  2YC3 A;  1OMZ A;  5FUH A;  1GA8 A;  5DDV A;  2YQJ A;  1O7Q A;  5C4F A;  1VPA A;  2X65 A;  5CMH A;  4Y9X A;  1HM0 A;  5CQO A;  1INI A;  3CGX A;  4NAK A;  4EVW A;  3SX5 A;  3OGZ A;  3CKJ A;  4KNR A;  2WE9 A;  1ON6 A;  4FQW A;  3I0D A;  5CMF X;  1HV9 A;  2GGO A;  5CQP A;  4FRM A;  1TVY A;  1JV1 A;  4HO9 A;  1K4V A;  2WAW A;  4HO2 A;  1QWJ A;  1EZI A;  1H5S C;  1R80 A;  1VH3 A;  1VH1 A;  4Y6U A;  4FRB A;  1G93 A;  1GQ9 A;  3OH1 A;  2WVM A;  1H4D A;  4FRP A;  3T7N A;  4E1K A;  4L41 C;  2PGY A;  1MP5 A;  2QKX A;  3ZLL A;  2XME A;  1V82 A;  4M2B A;  3U2T A;  2WVK A;  2W0V A;  3E26 A;  3Q7U A;  2O1G A;  4D0Z A;  2Y6P A;  3SXB A;  2FYB A;  3USQ A;  3U2W A;  3Q80 A;  1HM9 A;  1WT3 A;  5C47 A;  2VD4 A;  1GX4 A;  1ZDF A;  5J49 A;  2CU2 A;  5BXC A;  3U2X A;  4B2W A;  5EJ1 A;  1R7T A;  2V0I A;  2YQS A;  3LW6 A;  2V0J A;  5C8R A;  4KT7 A;  2X5S A;  1ZJ0 A;  1NQI B;  1GQC A;  2Q4J A;  3SX7 A;  1WSZ A;  1PZY B;  3I0J A;  3OH4 A;  2A8W A;  1GX0 A;  4Y7V A;  4BMA A;  3IOH A;  4MYB A;  1WT1 A;  1NF5 B;  3U0Y A;  3EE5 A;  2FYC B;  1NWG B;  1ZI4 A;  1R82 A;  4LW6 A;  5CMI A;  2I5E A;  3V90 A;  1FR8 A;  1H5T B;  3OH2 A;  4EEA A;  1FWY A;  1S4N A;  1XHB A;  5C4C A;  5C36 A;  3USR A;  1R7Y A;  3CKV A;  2UX8 A;  4ASJ A;  4ASY A;  4B4M A;  3R2W A;  4HOC A;  1FG5 N;  1W77 A;  4HO8 A;  1JVD A;  1QG8 A;  4CJB A;  1HJJ A;  2I7B A;  3V0Q A;  3I0C A;  1FZW A;  2WGZ A;  2BO4 A;  1Z90 A;  1VZT A;  3V91 A;  5FTV A;  2RJ5 A;  1LZI A;  1G9R A;  2P73 A;  5C4D A;  1ZCU A;  5IDS A;  1R7X A;  1H5S A;  4ZDQ A;  4B3U A;  5I1F A;  5C1L A;  4Y7F A;  1ZCV A;  4M4K A;  2AEC A;  1HM8 A;  3RMV A;  1H7Q A;  2RJ4 A;  4K6R A;  2A8U A;  3V0L A;  2VSI A;  1SS9 A;  2E8B A;  1ON8 A;  2YES A;  3OAM A;  1G97 A;  3K8E A;  5DDT A;  5C49 A;  1FRW A;  3V0O A;  2RJ0 A;  1O23 B;  5C1H A;  2YC5 A;  1H7L A;  1W55 A;  1INJ A;  4B2X A;  2Y4L A;  2RIZ A;  2P6W A;  4MND A;  3F1C A;  4P02 A;  5CQL X;  1VGW A;  1VIC A;  1ZIZ A;  1W57 A;  1G2V A;  5FYE A;  4EEG A;  2OEF A;  3DK5 A;  1LZ7 A;  5C3B A;  1ZCY A;  3D8V A;  2AES A;  3TZT A;  4IRQ A;  1H4E A;  2Y4J A;  5AJO A;  3T7M A;  2VS4 A;  1LVW A;  5FU8 A;  3O3P A;  4D11 A;  2BO6 A;  1HJL A;  3ZF8 A;  2WEE A;  4P00 A;  4AAW A;  1H7H A;  3I0I X;  2YQH A;  4Y7G A;  2RJ9 A;  1OQM B;  5FU0 A;  4JIS A;  5IFY A;  2JCJ A;  2RJ7 A;  3V8Z A;  3K8D A;  1O0R A;  4EE3 A;  4BQH A;  4AYL A;  4Y62 A;  1H5R A;  3N9W A;  2ZU8 A;  2WVL A;  4AYJ A;  3D5N A;  2APC A;  4FRE A;  1QGQ A;  2AGD A;  4Y63 A;  1MC3 A;  4JD0 A;  4J18 A;  5C3D A;  1G23 A;  2X60 A;  1OMX A;  3I0H A;  4D11 C;  1V84 A;  1I52 A;  4B42 A;  4CJ8 A;  3Q4S A;  3IOI A;  1EYR A;  4DEC A;  3RMW A;  2RIT A;  4HO0 A;  1FOA A;  2OI7 A;  1H4C A;  4KC2 A;  4FRL A;  5EJZ A;  5C1G A;  2Y7A A;  3PKP A;  2XWM A;  2W0W A;  1FO9 A;  3E25 A;  4HCQ A;  1XZ6 A;  1VM8 A;  2X5Z A;  3FWW A;  2D7R A;  2Z87 A;  4ARW A;  5CMJ A;  3TQD A;  1S4O A;  2XMH A;  3SXA A;  4FRH A;  3I0L A;  4G87 A;  3SPT A;  2Z86 A;  4B5B A;  2ZU9 A;  1JVG A;  5CMG X;  1ZI1 A;  1R7U A;  2VXL A;  5CQM X;  1ZJ3 A;  3FOQ A;  1NHE B;  2FY7 A;  2FFV A;  3I0K A;  3GUE A;  1KWS A;  4UEG A;  4EEM A;  1TZF A;  2D7I A;  4EE4 A;  2VSH A;  4M28 A;  1S4P A;  4B4G A;  3I0E A;  4FRA A;  1FO8 A;  3U2V A;  3BRK X;  3CKO A;  3CKN A;  3SXC A;  4D0T A;  1TW1 A;  4HG6 A;  4D48 A;  1LZJ A;  4IRP A;  3RSB A;  2GGQ A;  3V8Y A;  4M2A A;  2AM3 A;  1GWV A;  1WT2 A;  4KRV A;  1VGU A;  4G3S A;  1V83 A;  2YCM A;  5C3A A;  4DDZ A;  1H5T A;  2P72 A;  2MZB A;  1ZI3 A;  1VGT A;  1JYK A;  1YP3 A;  1G1L A;  4CJC A;  1FXO A;  1VGZ A;  4LW3 A; 
#chains in the Genus database with same CATH topology
 4FRD A;  4Y7U A;  1MP4 A;  4HO6 A;  4R7P A;  1LL2 A;  2Y4M A;  1FXJ A;  1H7E A;  5D91 A;  2O1H A;  4EEO A;  1FR9 A;  4ECM A;  4KPX A;  4O6M A;  3V0P A;  2FYD B;  3V0M A;  4KC4 A;  2XWL A;  3SXG A;  2RIY A;  3I0G A;  2V0K A;  2OI5 A;  3HL3 A;  2RJ8 A;  5FV9 A;  1LL0 A;  2E3D A;  1ZHJ A;  5CQN X;  1NMM B;  3SX8 A;  4FCE A;  2D0J A;  4NAL A;  2RIX A;  1PZT A;  4KNX A;  2OI6 A;  2RJ1 A;  3BCV A;  1R81 A;  2JCO A;  5IDT A;  3QVB A;  3U0X A;  3DUV A;  2XWN A;  4Y7T A;  4FRO A;  3T7O A;  2NXV A;  3F1Y A;  2BO8 A;  1LZ0 A;  5L6S A;  1YP2 A;  3R3I A;  3JUJ A;  3D98 A;  2ICY A;  2PA4 A;  3V0N A;  3OC9 A;  3SXD A;  2OEG A;  2QH5 A;  2Y4K A;  2C0N A;  4FIY A;  1E5K A;  2AM4 A;  1G95 A;  3PKQ A;  2RJ6 A;  4C2S A;  3JUK A;  1ZJ1 A;  2AH9 A;  4KPZ A;  1VZU A;  4EE5 A;  2JCL A;  1O7O A;  2BO7 A;  4KXO A;  4YS8 A;  2AE7 A;  4KQL A;  4FRQ A;  3ZLK A;  3NGW A;  5JQQ A;  1H5S B;  4CVH A;  3CU0 A;  1G8O A;  2FYA A;  5HS2 A;  1IIM A;  2VFZ A;  5C38 A;  1QGS A;  4Y64 A;  1ZCT A;  4KC1 A;  3PNN A;  2ICX A;  4Q7C A;  1FGG A;  1YP4 A;  3U2U A;  4NAI A;  2PGV A;  3I0F A;  4AC3 A;  5AJN A;  1G0R A;  5C48 A;  2V0L A;  3POL A;  4HO4 A;  2PX7 A;  1H7T A;  3OH3 A;  1IIN A;  4FCU A;  1G3L A;  1ZJ2 A;  3DJ4 A;  4XWI A;  1LL3 A;  1H3M A;  5C4B A;  1TW5 A;  1MP3 A;  2JCK A;  5FTS A;  1H7G A;  1FGX A;  2J0A A;  2VS5 A;  2ZU7 A;  1H7F A;  1H5S D;  4G3P A;  1JV3 A;  2VXM A;  1VZX A;  2YQC A;  3SX3 A;  4B4B A;  2VS3 A;  3SXE A;  4DE7 A;  1JYL A;  4HO3 A;  3ZGG A;  1YRO B;  1ZI5 A;  1WVC A;  3OH0 A;  5AJP A;  5L6V A;  3JTJ A;  3KIA A;  1ZJO A;  3ST8 A;  1ZDG A;  2I5K A;  2O1F A;  2DPW A;  1WT0 A;  4Y6N A;  3OKR A;  3CKQ A;  2QGI A;  4GBP A;  1ZJP A;  2V0H A;  1R7V A;  3IOJ A;  1NKH B;  2AM5 A;  2FFU A;  4G3Q A;  4HO5 A;  2J0B A;  1GWW A;  4NAN A;  1H5R B;  5C4E A;  5EIY A;  3ZGF A;  2YC3 A;  1OMZ A;  5FUH A;  1GA8 A;  5DDV A;  2YQJ A;  4FIX A;  1O7Q A;  5C4F A;  1VPA A;  2X65 A;  5CMH A;  4Y9X A;  1HM0 A;  5CQO A;  1INI A;  3CGX A;  4NAK A;  4EVW A;  3SX5 A;  3OGZ A;  3CKJ A;  4KNR A;  2WE9 A;  1ON6 A;  4FQW A;  3I0D A;  5CMF X;  1HV9 A;  2GGO A;  5CQP A;  4FRM A;  1TVY A;  1JV1 A;  4HO9 A;  1K4V A;  2WAW A;  4HO2 A;  1QWJ A;  1EZI A;  1H5S C;  1R80 A;  1VH3 A;  1VH1 A;  4Y6U A;  4FRB A;  1G93 A;  1GQ9 A;  3OH1 A;  2WVM A;  1H4D A;  4FRP A;  3T7N A;  4E1K A;  4L41 C;  2PGY A;  1MP5 A;  2QKX A;  3ZLL A;  2XME A;  1V82 A;  4M2B A;  3U2T A;  2WVK A;  2W0V A;  3E26 A;  3Q7U A;  2O1G A;  4D0Z A;  2Y6P A;  3SXB A;  2FYB A;  3USQ A;  3U2W A;  3Q80 A;  1HM9 A;  1WT3 A;  5C47 A;  2VD4 A;  1GX4 A;  1ZDF A;  5J49 A;  2CU2 A;  5BXC A;  3U2X A;  4B2W A;  5EJ1 A;  1R7T A;  2V0I A;  2YQS A;  3LW6 A;  2V0J A;  5C8R A;  4KT7 A;  2X5S A;  1ZJ0 A;  1NQI B;  1GQC A;  2Q4J A;  3SX7 A;  1WSZ A;  1PZY B;  3I0J A;  3OH4 A;  2A8W A;  1GX0 A;  4Y7V A;  4BMA A;  3IOH A;  4MYB A;  1WT1 A;  1NF5 B;  3U0Y A;  3EE5 A;  2FYC B;  1NWG B;  1ZI4 A;  1R82 A;  4LW6 A;  5CMI A;  2I5E A;  3V90 A;  1FR8 A;  1H5T B;  3OH2 A;  4EEA A;  1FWY A;  1S4N A;  1XHB A;  5C4C A;  5C36 A;  3USR A;  1R7Y A;  3CKV A;  2UX8 A;  4ASJ A;  4ASY A;  4B4M A;  3R2W A;  4HOC A;  1FG5 N;  1W77 A;  4HO8 A;  1JVD A;  1QG8 A;  4CJB A;  1HJJ A;  2I7B A;  3V0Q A;  3I0C A;  1FZW A;  2WGZ A;  2BO4 A;  1Z90 A;  1VZT A;  3V91 A;  5FTV A;  2RJ5 A;  1LZI A;  1G9R A;  2P73 A;  5C4D A;  1ZCU A;  5IDS A;  1R7X A;  1H5S A;  4ZDQ A;  4B3U A;  5I1F A;  5C1L A;  4Y7F A;  1ZCV A;  4M4K A;  2AEC A;  1HM8 A;  3RMV A;  1H7Q A;  2VK9 A;  2RJ4 A;  4K6R A;  2A8U A;  3V0L A;  2VSI A;  1SS9 A;  2E8B A;  1ON8 A;  2YES A;  3OAM A;  1G97 A;  3K8E A;  5DDT A;  5C49 A;  1FRW A;  3V0O A;  2RJ0 A;  1O23 B;  5C1H A;  2YC5 A;  1H7L A;  1W55 A;  1INJ A;  4B2X A;  2Y4L A;  2RIZ A;  2P6W A;  4MND A;  3F1C A;  4P02 A;  5CQL X;  1VGW A;  1VIC A;  1ZIZ A;  1W57 A;  1G2V A;  5D92 A;  5FYE A;  4EEG A;  2OEF A;  3DK5 A;  1LZ7 A;  5C3B A;  1ZCY A;  3D8V A;  2AES A;  3TZT A;  4IRQ A;  1H4E A;  2Y4J A;  5AJO A;  3T7M A;  2VS4 A;  1LVW A;  5FU8 A;  3O3P A;  4D11 A;  2BO6 A;  1HJL A;  3ZF8 A;  2WEE A;  4P00 A;  4AAW A;  1H7H A;  3I0I X;  2YQH A;  4Y7G A;  2RJ9 A;  1OQM B;  5FU0 A;  4JIS A;  5IFY A;  2JCJ A;  2RJ7 A;  3V8Z A;  3K8D A;  1O0R A;  4EE3 A;  4BQH A;  4AYL A;  4Y62 A;  1H5R A;  3N9W A;  2ZU8 A;  4MIX A;  2WVL A;  4AYJ A;  3D5N A;  2APC A;  4FRE A;  1QGQ A;  2AGD A;  4Y63 A;  1MC3 A;  4JD0 A;  4J18 A;  5C3D A;  1G23 A;  2X60 A;  1OMX A;  3I0H A;  4D11 C;  1V84 A;  1I52 A;  4B42 A;  4CJ8 A;  3Q4S A;  4O6N A;  3IOI A;  1EYR A;  4DEC A;  3RMW A;  2RIT A;  4HO0 A;  1FOA A;  2OI7 A;  1H4C A;  4KC2 A;  4FRL A;  5EJZ A;  5C1G A;  2Y7A A;  3PKP A;  2XWM A;  2W0W A;  1FO9 A;  3E25 A;  4HCQ A;  1XZ6 A;  1VM8 A;  2X5Z A;  3FWW A;  2D7R A;  2Z87 A;  4ARW A;  5CMJ A;  3TQD A;  1S4O A;  2XMH A;  3SXA A;  4FRH A;  3I0L A;  4G87 A;  3SPT A;  2Z86 A;  4B5B A;  2ZU9 A;  1JVG A;  5CMG X;  1ZI1 A;  1R7U A;  2VXL A;  5CQM X;  1ZJ3 A;  3FOQ A;  1NHE B;  2FY7 A;  2FFV A;  3I0K A;  3GUE A;  1KWS A;  4UEG A;  4EEM A;  1TZF A;  2D7I A;  4EE4 A;  2VSH A;  4M28 A;  1S4P A;  4B4G A;  3I0E A;  4FRA A;  1FO8 A;  3U2V A;  3BRK X;  3CKO A;  3CKN A;  3SXC A;  4D0T A;  1TW1 A;  4HG6 A;  4D48 A;  1LZJ A;  4IRP A;  3RSB A;  2GGQ A;  3V8Y A;  4M2A A;  2AM3 A;  1GWV A;  1WT2 A;  4KRV A;  1VGU A;  4G3S A;  1V83 A;  2YCM A;  5C3A A;  4DDZ A;  1H5T A;  2P72 A;  2MZB A;  1ZI3 A;  1VGT A;  1JYK A;  1YP3 A;  1G1L A;  4CJC A;  1FXO A;  1VGZ A;  4LW3 A; 
#chains in the Genus database with same CATH homology
 4FRD A;  4Y7U A;  1MP4 A;  4HO6 A;  4R7P A;  1LL2 A;  2Y4M A;  1FXJ A;  1H7E A;  5D91 A;  2O1H A;  4EEO A;  1FR9 A;  4ECM A;  4KPX A;  4O6M A;  3V0P A;  2FYD B;  3V0M A;  4KC4 A;  2XWL A;  3SXG A;  2RIY A;  3I0G A;  2V0K A;  2OI5 A;  3HL3 A;  2RJ8 A;  5FV9 A;  1LL0 A;  2E3D A;  1ZHJ A;  5CQN X;  1NMM B;  3SX8 A;  4FCE A;  2D0J A;  4NAL A;  2RIX A;  1PZT A;  4KNX A;  2OI6 A;  2RJ1 A;  3BCV A;  1R81 A;  2JCO A;  5IDT A;  3QVB A;  3U0X A;  3DUV A;  2XWN A;  4Y7T A;  4FRO A;  3T7O A;  2NXV A;  3F1Y A;  2BO8 A;  1LZ0 A;  5L6S A;  1YP2 A;  3R3I A;  3JUJ A;  3D98 A;  2ICY A;  2PA4 A;  3V0N A;  3OC9 A;  3SXD A;  2OEG A;  2QH5 A;  2Y4K A;  2C0N A;  4FIY A;  1E5K A;  2AM4 A;  1G95 A;  3PKQ A;  2RJ6 A;  4C2S A;  3JUK A;  1ZJ1 A;  2AH9 A;  4KPZ A;  1VZU A;  4EE5 A;  2JCL A;  1O7O A;  2BO7 A;  4KXO A;  4YS8 A;  2AE7 A;  4KQL A;  4FRQ A;  3ZLK A;  3NGW A;  5JQQ A;  1H5S B;  4CVH A;  3CU0 A;  1G8O A;  2FYA A;  5HS2 A;  1IIM A;  2VFZ A;  5C38 A;  1QGS A;  4Y64 A;  1ZCT A;  4KC1 A;  3PNN A;  2ICX A;  4Q7C A;  1FGG A;  1YP4 A;  3U2U A;  4NAI A;  2PGV A;  3I0F A;  4AC3 A;  5AJN A;  1G0R A;  5C48 A;  2V0L A;  3POL A;  4HO4 A;  2PX7 A;  1H7T A;  3OH3 A;  1IIN A;  4FCU A;  1G3L A;  1ZJ2 A;  3DJ4 A;  4XWI A;  1LL3 A;  1H3M A;  5C4B A;  1TW5 A;  1MP3 A;  2JCK A;  5FTS A;  1H7G A;  1FGX A;  2J0A A;  2VS5 A;  2ZU7 A;  1H7F A;  1H5S D;  4G3P A;  1JV3 A;  2VXM A;  1VZX A;  2YQC A;  3SX3 A;  4B4B A;  2VS3 A;  3SXE A;  4DE7 A;  1JYL A;  4HO3 A;  3ZGG A;  1YRO B;  1ZI5 A;  1WVC A;  3OH0 A;  5AJP A;  5L6V A;  3JTJ A;  3KIA A;  1ZJO A;  3ST8 A;  1ZDG A;  2I5K A;  2O1F A;  2DPW A;  1WT0 A;  4Y6N A;  3OKR A;  3CKQ A;  2QGI A;  4GBP A;  1ZJP A;  2V0H A;  1R7V A;  3IOJ A;  1NKH B;  2AM5 A;  2FFU A;  4G3Q A;  4HO5 A;  2J0B A;  1GWW A;  4NAN A;  1H5R B;  5C4E A;  5EIY A;  3ZGF A;  2YC3 A;  1OMZ A;  5FUH A;  1GA8 A;  5DDV A;  2YQJ A;  4FIX A;  1O7Q A;  5C4F A;  1VPA A;  2X65 A;  5CMH A;  4Y9X A;  1HM0 A;  5CQO A;  1INI A;  3CGX A;  4NAK A;  4EVW A;  3SX5 A;  3OGZ A;  3CKJ A;  4KNR A;  2WE9 A;  1ON6 A;  4FQW A;  3I0D A;  5CMF X;  1HV9 A;  2GGO A;  5CQP A;  4FRM A;  1TVY A;  1JV1 A;  4HO9 A;  1K4V A;  2WAW A;  4HO2 A;  1QWJ A;  1EZI A;  1H5S C;  1R80 A;  1VH3 A;  1VH1 A;  4Y6U A;  4FRB A;  1G93 A;  1GQ9 A;  3OH1 A;  2WVM A;  1H4D A;  4FRP A;  3T7N A;  4E1K A;  4L41 C;  2PGY A;  1MP5 A;  2QKX A;  3ZLL A;  2XME A;  1V82 A;  4M2B A;  3U2T A;  2WVK A;  2W0V A;  3E26 A;  3Q7U A;  2O1G A;  4D0Z A;  2Y6P A;  3SXB A;  2FYB A;  3USQ A;  3U2W A;  3Q80 A;  1HM9 A;  1WT3 A;  5C47 A;  2VD4 A;  1GX4 A;  1ZDF A;  5J49 A;  2CU2 A;  5BXC A;  3U2X A;  4B2W A;  5EJ1 A;  1R7T A;  2V0I A;  2YQS A;  3LW6 A;  2V0J A;  5C8R A;  4KT7 A;  2X5S A;  1ZJ0 A;  1NQI B;  1GQC A;  2Q4J A;  3SX7 A;  1WSZ A;  1PZY B;  3I0J A;  3OH4 A;  2A8W A;  1GX0 A;  4Y7V A;  4BMA A;  3IOH A;  4MYB A;  1WT1 A;  1NF5 B;  3U0Y A;  3EE5 A;  2FYC B;  1NWG B;  1ZI4 A;  1R82 A;  4LW6 A;  5CMI A;  2I5E A;  3V90 A;  1FR8 A;  1H5T B;  3OH2 A;  4EEA A;  1FWY A;  1S4N A;  1XHB A;  5C4C A;  5C36 A;  3USR A;  1R7Y A;  3CKV A;  2UX8 A;  4ASJ A;  4ASY A;  4B4M A;  3R2W A;  4HOC A;  1FG5 N;  1W77 A;  4HO8 A;  1JVD A;  1QG8 A;  4CJB A;  1HJJ A;  2I7B A;  3V0Q A;  3I0C A;  1FZW A;  2WGZ A;  2BO4 A;  1Z90 A;  1VZT A;  3V91 A;  5FTV A;  2RJ5 A;  1LZI A;  1G9R A;  2P73 A;  5C4D A;  1ZCU A;  5IDS A;  1R7X A;  1H5S A;  4ZDQ A;  4B3U A;  5I1F A;  5C1L A;  4Y7F A;  1ZCV A;  4M4K A;  2AEC A;  1HM8 A;  3RMV A;  1H7Q A;  2VK9 A;  2RJ4 A;  4K6R A;  2A8U A;  3V0L A;  2VSI A;  1SS9 A;  2E8B A;  1ON8 A;  2YES A;  3OAM A;  1G97 A;  3K8E A;  5DDT A;  5C49 A;  1FRW A;  3V0O A;  2RJ0 A;  1O23 B;  5C1H A;  2YC5 A;  1H7L A;  1W55 A;  1INJ A;  4B2X A;  2Y4L A;  2RIZ A;  2P6W A;  4MND A;  3F1C A;  4P02 A;  5CQL X;  1VGW A;  1VIC A;  1ZIZ A;  1W57 A;  1G2V A;  5D92 A;  5FYE A;  4EEG A;  2OEF A;  3DK5 A;  1LZ7 A;  5C3B A;  1ZCY A;  3D8V A;  2AES A;  3TZT A;  4IRQ A;  1H4E A;  2Y4J A;  5AJO A;  3T7M A;  2VS4 A;  1LVW A;  5FU8 A;  3O3P A;  4D11 A;  2BO6 A;  1HJL A;  3ZF8 A;  2WEE A;  4P00 A;  4AAW A;  1H7H A;  3I0I X;  2YQH A;  4Y7G A;  2RJ9 A;  1OQM B;  5FU0 A;  4JIS A;  5IFY A;  2JCJ A;  2RJ7 A;  3V8Z A;  3K8D A;  1O0R A;  4EE3 A;  4BQH A;  4AYL A;  4Y62 A;  1H5R A;  3N9W A;  2ZU8 A;  4MIX A;  2WVL A;  4AYJ A;  3D5N A;  2APC A;  4FRE A;  1QGQ A;  2AGD A;  4Y63 A;  1MC3 A;  4JD0 A;  4J18 A;  5C3D A;  1G23 A;  2X60 A;  1OMX A;  3I0H A;  4D11 C;  1V84 A;  1I52 A;  4B42 A;  4CJ8 A;  3Q4S A;  4O6N A;  3IOI A;  1EYR A;  4DEC A;  3RMW A;  2RIT A;  4HO0 A;  1FOA A;  2OI7 A;  1H4C A;  4KC2 A;  4FRL A;  5EJZ A;  5C1G A;  2Y7A A;  3PKP A;  2XWM A;  2W0W A;  1FO9 A;  3E25 A;  4HCQ A;  1XZ6 A;  1VM8 A;  2X5Z A;  3FWW A;  2D7R A;  2Z87 A;  4ARW A;  5CMJ A;  3TQD A;  1S4O A;  2XMH A;  3SXA A;  4FRH A;  3I0L A;  4G87 A;  3SPT A;  2Z86 A;  4B5B A;  2ZU9 A;  1JVG A;  5CMG X;  1ZI1 A;  1R7U A;  2VXL A;  5CQM X;  1ZJ3 A;  3FOQ A;  1NHE B;  2FY7 A;  2FFV A;  3I0K A;  3GUE A;  1KWS A;  4UEG A;  4EEM A;  1TZF A;  2D7I A;  4EE4 A;  2VSH A;  4M28 A;  1S4P A;  4B4G A;  3I0E A;  4FRA A;  1FO8 A;  3U2V A;  3BRK X;  3CKO A;  3CKN A;  3SXC A;  4D0T A;  1TW1 A;  4HG6 A;  4D48 A;  1LZJ A;  4IRP A;  3RSB A;  2GGQ A;  3V8Y A;  4M2A A;  2AM3 A;  1GWV A;  1WT2 A;  4KRV A;  1VGU A;  4G3S A;  1V83 A;  2YCM A;  5C3A A;  4DDZ A;  1H5T A;  2P72 A;  2MZB A;  1ZI3 A;  1VGT A;  1JYK A;  1YP3 A;  1G1L A;  4CJC A;  1FXO A;  1VGZ A;  4LW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...