1WT2A

Mutant human abo(h) blood group glycosyltransferase a with bound udp and inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQSKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Structural basis for the inactivity of human blood group o2 glycosyltransferase
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1wt2A00
4C2SA 5C49A 1E5KA 1ZI1A 4HCQA 2A8WA 1O7QA 1W77A 5FTSA 3SXAA 2FYDB 1G97A 2APCA 3SXCA 3V0PA 4P00A 4XWIA 2WVLA 2VSIA 4G3QA 1H4CA 2RJ8A 1WT3A 1ZI4A 4AYLA 2Y6PA 2O1HA 3CGXA 2A8UA 3V8YA 2JCKA 2FYAA 1H7FA 1S4OA 2V0IA 1WSZA 3E25A 4M2BA 1H3MA 2AH9A 1HJLA 1H5RA 5EJ1A 1VZTA 4J18A 3OGZA 4KXOA 1LZ7A 4Y7TA 1QWJA 1V82A 1VGZA 2YC5A 2YQSA 4G3PA 4CJBA 3T7MA 2VD4A 4B4GA 1S4NA 4NALA 3V8ZA 4EEOA 3V91A 2AGDA 1ZJ3A 3POLA 3I0JA 2W0VA 1V83A 3K8EA 3FOQA 3PKPA 5EIYA 1H5SD 1FR8A 2WAWA 4AAWA 1O23B 3DK5A 4Y64A 2E8BA 4ZDQA 4FRLA 4JD0A 2ICYA 1H7LA 1PZTA 3CKJA 5IFYA 2OI5A 3I0KA 5L6VA 2OEGA 3OH1A 3D8VA 2XWMA 2O1FA 2YQCA 4B2WA 1GX4A 4FREA 3V90A 2FYCB 4ASJA 4HO0A 2JCLA 1NHEB 2OEFA 3I0DA 3DUVA 4LW6A 1LL0A 4B5BA 1WT0A 5C1LA 5C4FA 2Z87A 1K4VA 5FUHA 3OH4A 3CKNA 2Y4KA 3F1YA 3F1CA 3NGWA 2PA4A 3JUJA 3BCVA 2RJ0A 5FU8A 4Y63A 2QH5A 2E3DA 5C1HA 1QGQA 3D5NA 1W55A 4E1KA 4EEGA 4HO6A 2XMHA 4JISA 5CMJA 2VXLA 1MP3A 2FFVA 1JV1A 4YS8A 4HO2A 1W57A 1FR9A 3O3PA 3Q80A 5IDTA 2V0KA 3DJ4A 1JVDA 5CMHA 4FRPA 3ZGGA 3RMWA 2GGQA 5L6SA 1R7VA 2PGYA 2WVMA 3RSBA 1R7XA 1FGGA 5CMGX 4KPZA 3SPTA 2GGOA 2FFUA 3ZGFA 4CJCA 4BMAA 2YQHA 4DECA 1QG8A 2QGIA 4FCEA 3U2VA 4FROA 5C8RA 2YESA 3R3IA 3T7OA 3ZLLA 2V0LA 5EJZA 1H7QA 1ZHJA 1QGSA 1FO8A 1WT2A 3PNNA 5C4BA 1ZJOA 4KNXA 3KIAA 1KWSA 1GQCA 3SX5A 1GWWA 2VS5A 2WVKA 1G23A 3SXGA 4IRQA 3OKRA 4KC1A 1G0RA 3I0EA 5J49A 4FRQA 2XMEA 1H5TA 4G87A 2YQJA 1IIMA 4M2AA 3ST8A 5C38A 4KQLA 1PZYB 1FXJA 5C4CA 1TW5A 3IOHA 1HJJA 4FCUA 4HO9A 5CQMX 3QVBA 3SX8A 4ECMA 1R81A 1VH1A 5AJNA 1YROB 5DDVA 1R7YA 1VH3A 2VSHA 4FRMA 1EYRA 2RJ6A 2X60A 1LZIA 2W0WA 3R2WA 5C3BA 2Z86A 1HM8A 1ZCTA 3I0IX 2FYBA 1R80A 4G3SA 1G95A 3I0HA 1H5TB 1ZCUA 5BXCA 1FGXA 3V0QA 4M4KA 5DDTA 4CVHA 2D7RA 3JUKA 1SS9A 2VXMA 1I52A 3I0CA 2Y4LA 2MZBA 3OC9A 4HO8A 4B3UA 1G1LA 3I0GA 4EEMA 4D11A 2RJ9A 4DE7A 1FO9A 1G3LA 3N9WA 2RIYA 1ZIZA 1NMMB 4D11C 2D7IA 1NWGB 2D0JA 2PX7A 3TQDA 1MP4A 5HS2A 4ARWA 1MP5A 1FWYA 2AE7A 3ZF8A 5FU0A 2AESA 3U0XA 2O1GA 1VPAA 1IINA 2WEEA 5CQPA 1ON6A 3IOJA 3SX7A 4ASYA 1YP3A 1R7TA 2OI7A 1HM9A 2I5KA 4KC4A 5FTVA 4HG6A 4Y7VA 1O7OA 1TZFA 2WGZA 1G8OA 2NXVA 5AJPA 3D98A 1MC3A 5CQOA 2X65A 4EEAA 1VZXA 1H4EA 4CJ8A 3JTJA 1LZ0A 3TZTA 4Y9XA 2ZU9A 1O0RA 2V0JA 1H7HA 1TW1A 2Y7AA 2PGVA 3USRA 3U2TA 1VGUA 2RJ7A 3Q7UA 4FRAA 5C47A 3HL3A 2BO7A 1JV3A 2Y4JA 2FY7A 1VZUA 1GQ9A 4R7PA 2XWNA 1INIA 5CQNX 1LL3A 1YP2A 1R7UA 2OI6A 4EE5A 1H5SC 1VGWA 3I0LA 1FZWA 1FG5N 4MYBA 1FRWA 4GBPA 1ZDFA 1HV9A 1VGTA 2RIXA 4HO5A 1H7GA 2CU2A 4K6RA 4KPXA 2RITA 1G2VA 5FYEA 1ZJPA 4D0TA 3Q4SA 4NAIA 2ZU7A 3CKVA 1H5SB 1FXOA 3V0LA 5C36A 1S4PA 1H4DA 3U2UA 4EE4A 2QKXA 5IDSA 4KNRA 3GUEA 4KRVA 1JYKA 2BO4A 2UX8A 3RMVA 2Y4MA 2BO6A 3LW6A 3I0FA 1OQMB 5C4EA 5CQLX 4B42A 3CU0A 5CMFX 2X5SA 1FOAA 4FQWA 3U0YA 1ZCYA 1ZDGA 2JCJA 4FRBA 3CKQA 2XWLA 4Y62A 5FV9A 3V0OA 4P02A 4IRPA 3SXEA 2WE9A 5CMIA 2JCOA 4Y6NA 5C48A 5C3AA 1ZJ1A 1XHBA 4LW3A 4AC3A 4Y7GA 4Y7UA 1JYLA 3USQA 1OMXA 1GA8A 2X5ZA 2P6WA 3U2WA 4DDZA 1TVYA 4KT7A 3BRKX 2RJ4A 1H7EA 4Y7FA 4NAKA 1YP4A 5C3DA 1H5RB 3SXDA 1V84A 1ON8A 1ZJ0A 3IOIA 1ZI5A 2YCMA 4BQHA 5JQQA 2BO8A 2VFZA 4EVWA 1XZ6A 4D0ZA 1VICA 4M28A 1WT1A 2YC3A 4L41C 4Y6UA 1WVCA 4FRHA 1ZJ2A 1EZIA 1ZI3A 3PKQA 5I1FA 1LZJA 4D48A 1OMZA 2Q4JA 2ICXA 1ZCVA 1NKHB 2VS4A 4FRDA 1NF5B 4HO4A 2I7BA 2ZU8A 1H5SA 1H7TA 1G9RA 1G93A 1LVWA 2RIZA 2RJ5A 3K8DA 4NANA 2P72A 1VM8A 1NQIB 3OH0A 2AM5A 2AM4A 1INJA 1GWVA 2VS3A 3EE5A 3V0NA 4B4MA 1GX0A 4AYJA 2P73A 3E26A 2DPWA 4HOCA 3V0MA 2AM3A 4B4BA 1JVGA 2V0HA 3OAMA 2RJ1A 3SX3A 1R82A 3SXBA 4UEGA 4B2XA 3ZLKA 3FWWA 3U2XA 1HM0A 1LL2A 5C4DA 3OH3A 4MNDA 3CKOA 5AJOA 2AECA 5C1GA 3OH2A 4HO3A 3T7NA 2I5EA 4KC2A 4EE3A 1Z90A
chains in the Genus database with same CATH superfamily
4C2SA 5C49A 1E5KA 1ZI1A 4HCQA 2A8WA 1O7QA 1W77A 5FTSA 3SXAA 2FYDB 1G97A 2APCA 3SXCA 3V0PA 4P00A 4XWIA 2WVLA 2VSIA 4G3QA 1H4CA 2RJ8A 1WT3A 1ZI4A 4AYLA 2Y6PA 2O1HA 3CGXA 2A8UA 3V8YA 2JCKA 2FYAA 1H7FA 1S4OA 2V0IA 1WSZA 3E25A 4M2BA 1H3MA 2AH9A 1HJLA 1H5RA 5EJ1A 1VZTA 4J18A 3OGZA 4KXOA 1LZ7A 4Y7TA 1QWJA 1V82A 1VGZA 2YC5A 2YQSA 4G3PA 4CJBA 2J0AA 3T7MA 2VD4A 4B4GA 1S4NA 4NALA 3V8ZA 4EEOA 3V91A 2AGDA 1ZJ3A 3POLA 3I0JA 2W0VA 1V83A 3K8EA 3FOQA 3PKPA 5EIYA 1H5SD 1FR8A 2WAWA 4AAWA 4FIXA 1O23B 3DK5A 4Y64A 2E8BA 4ZDQA 4FRLA 4JD0A 2ICYA 1H7LA 2C0NA 1PZTA 3CKJA 5IFYA 2OI5A 3I0KA 5L6VA 2OEGA 3OH1A 3D8VA 2XWMA 2O1FA 2YQCA 4B2WA 1GX4A 4FREA 3V90A 2FYCB 4ASJA 4HO0A 2JCLA 1NHEB 2OEFA 3I0DA 3DUVA 4LW6A 1LL0A 4B5BA 1WT0A 5C1LA 5C4FA 2Z87A 1K4VA 5FUHA 3OH4A 3CKNA 2Y4KA 3F1YA 3F1CA 3NGWA 2PA4A 3JUJA 3BCVA 2RJ0A 5FU8A 4Y63A 2QH5A 2E3DA 5C1HA 1QGQA 3D5NA 1W55A 4E1KA 4EEGA 4HO6A 2XMHA 4JISA 5CMJA 2VXLA 1MP3A 2FFVA 1JV1A 4YS8A 4HO2A 1W57A 1FR9A 3O3PA 3Q80A 5IDTA 2V0KA 3DJ4A 1JVDA 5CMHA 4FRPA 3ZGGA 3RMWA 2GGQA 5L6SA 1R7VA 2VK9A 2PGYA 2WVMA 3RSBA 1R7XA 1FGGA 5CMGX 4KPZA 3SPTA 2GGOA 2FFUA 3ZGFA 4CJCA 4BMAA 2YQHA 4DECA 1QG8A 2QGIA 4FCEA 3U2VA 4FROA 5C8RA 2YESA 3R3IA 3T7OA 3ZLLA 2V0LA 5EJZA 1H7QA 1ZHJA 1QGSA 1FO8A 1WT2A 3PNNA 5C4BA 1ZJOA 4KNXA 3KIAA 1KWSA 1GQCA 3SX5A 1GWWA 2VS5A 2WVKA 1G23A 3SXGA 4IRQA 4Q7CA 3OKRA 4KC1A 1G0RA 3I0EA 5J49A 4FRQA 2XMEA 1H5TA 4G87A 2YQJA 1IIMA 4M2AA 3ST8A 5C38A 4KQLA 1PZYB 1FXJA 5C4CA 1TW5A 3IOHA 1HJJA 4FCUA 4HO9A 5CQMX 3QVBA 3SX8A 4ECMA 1R81A 1VH1A 5AJNA 1YROB 5DDVA 1R7YA 1VH3A 2VSHA 4FRMA 1EYRA 2RJ6A 2X60A 1LZIA 2W0WA 3R2WA 5C3BA 2Z86A 1HM8A 1ZCTA 4O6MA 3I0IX 4FIYA 2FYBA 1R80A 4G3SA 1G95A 3I0HA 1H5TB 1ZCUA 5BXCA 1FGXA 3V0QA 4M4KA 5DDTA 4CVHA 2D7RA 3JUKA 1SS9A 2VXMA 1I52A 3I0CA 2Y4LA 2MZBA 3OC9A 4HO8A 4B3UA 1G1LA 3I0GA 4EEMA 4D11A 2RJ9A 4DE7A 1FO9A 1G3LA 3N9WA 2RIYA 1ZIZA 1NMMB 4D11C 2D7IA 1NWGB 2D0JA 2PX7A 3TQDA 1MP4A 5HS2A 4ARWA 1MP5A 1FWYA 2AE7A 3ZF8A 5FU0A 2AESA 3U0XA 2O1GA 1VPAA 1IINA 2WEEA 5CQPA 1ON6A 3IOJA 3SX7A 4ASYA 1YP3A 1R7TA 2OI7A 1HM9A 2I5KA 4KC4A 5FTVA 4HG6A 4Y7VA 1O7OA 1TZFA 2WGZA 1G8OA 2NXVA 5AJPA 3D98A 1MC3A 5CQOA 2X65A 4EEAA 1VZXA 1H4EA 4CJ8A 3JTJA 1LZ0A 3TZTA 4Y9XA 2ZU9A 1O0RA 2V0JA 1H7HA 1TW1A 2Y7AA 2PGVA 3USRA 3U2TA 1VGUA 2RJ7A 3Q7UA 4FRAA 5C47A 3HL3A 2BO7A 1JV3A 2Y4JA 2FY7A 1VZUA 1GQ9A 4O6NA 4R7PA 2XWNA 1INIA 5CQNX 1LL3A 1YP2A 1R7UA 2OI6A 4EE5A 1H5SC 1VGWA 3I0LA 1FZWA 1FG5N 4MYBA 1FRWA 4GBPA 1ZDFA 1HV9A 1VGTA 2RIXA 4HO5A 1H7GA 2CU2A 4K6RA 4KPXA 2RITA 1G2VA 5FYEA 1ZJPA 4D0TA 3Q4SA 4NAIA 2ZU7A 3CKVA 1H5SB 1FXOA 3V0LA 5C36A 1S4PA 1H4DA 3U2UA 4EE4A 2QKXA 5IDSA 4KNRA 3GUEA 4KRVA 1JYKA 2BO4A 2UX8A 3RMVA 2Y4MA 2BO6A 3LW6A 3I0FA 1OQMB 5C4EA 5CQLX 4B42A 3CU0A 5CMFX 2X5SA 1FOAA 4FQWA 3U0YA 1ZCYA 1ZDGA 2JCJA 4FRBA 3CKQA 2XWLA 4Y62A 5FV9A 3V0OA 4P02A 4IRPA 3SXEA 2WE9A 5CMIA 2JCOA 4Y6NA 5C48A 5C3AA 1ZJ1A 1XHBA 4LW3A 4AC3A 4Y7GA 4Y7UA 1JYLA 3USQA 1OMXA 1GA8A 2X5ZA 2P6WA 3U2WA 4DDZA 1TVYA 4KT7A 3BRKX 2RJ4A 1H7EA 4Y7FA 4NAKA 1YP4A 5C3DA 1H5RB 3SXDA 1V84A 1ON8A 1ZJ0A 3IOIA 2J0BA 1ZI5A 2YCMA 4BQHA 5JQQA 2BO8A 2VFZA 4EVWA 1XZ6A 4D0ZA 1VICA 4M28A 1WT1A 2YC3A 4L41C 4Y6UA 1WVCA 4FRHA 1ZJ2A 1EZIA 1ZI3A 3PKQA 5I1FA 4MIXA 1LZJA 4D48A 1OMZA 2Q4JA 2ICXA 1ZCVA 1NKHB 5D91A 2VS4A 5D92A 4FRDA 1NF5B 4HO4A 2I7BA 2ZU8A 1H5SA 1H7TA 1G9RA 1G93A 1LVWA 2RIZA 2RJ5A 3K8DA 4NANA 2P72A 1VM8A 1NQIB 3OH0A 2AM5A 2AM4A 1INJA 1GWVA 2VS3A 3EE5A 3V0NA 4B4MA 1GX0A 4AYJA 2P73A 3E26A 2DPWA 4HOCA 3V0MA 2AM3A 4B4BA 1JVGA 2V0HA 3OAMA 2RJ1A 3SX3A 1R82A 3SXBA 4UEGA 4B2XA 3ZLKA 3FWWA 3U2XA 1HM0A 1LL2A 5C4DA 3OH3A 4MNDA 3CKOA 5AJOA 2AECA 5C1GA 3OH2A 4HO3A 3T7NA 2I5EA 4KC2A 4EE3A 1Z90A
chains in the Genus database with same CATH topology
4C2SA 5C49A 1E5KA 1ZI1A 4HCQA 2A8WA 1O7QA 1W77A 5FTSA 3SXAA 2FYDB 1G97A 2APCA 3SXCA 3V0PA 4P00A 4XWIA 2WVLA 2VSIA 4G3QA 1H4CA 2RJ8A 1WT3A 1ZI4A 4AYLA 2Y6PA 2O1HA 3CGXA 2A8UA 3V8YA 2JCKA 2FYAA 1H7FA 1S4OA 2V0IA 1WSZA 3E25A 4M2BA 1H3MA 2AH9A 1HJLA 1H5RA 5EJ1A 1VZTA 4J18A 3OGZA 4KXOA 1LZ7A 4Y7TA 1QWJA 1V82A 1VGZA 2YC5A 2YQSA 4G3PA 4CJBA 2J0AA 3T7MA 2VD4A 4B4GA 1S4NA 4NALA 3V8ZA 4EEOA 3V91A 2AGDA 1ZJ3A 3POLA 3I0JA 2W0VA 1V83A 3K8EA 3FOQA 3PKPA 5EIYA 1H5SD 1FR8A 2WAWA 4AAWA 4FIXA 1O23B 3DK5A 4Y64A 2E8BA 4ZDQA 4FRLA 4JD0A 2ICYA 1H7LA 2C0NA 1PZTA 3CKJA 5IFYA 2OI5A 3I0KA 5L6VA 2OEGA 3OH1A 3D8VA 2XWMA 2O1FA 2YQCA 4B2WA 1GX4A 4FREA 3V90A 2FYCB 4ASJA 4HO0A 2JCLA 1NHEB 2OEFA 3I0DA 3DUVA 4LW6A 1LL0A 4B5BA 1WT0A 5C1LA 5C4FA 2Z87A 1K4VA 5FUHA 3OH4A 3CKNA 2Y4KA 3F1YA 3F1CA 3NGWA 2PA4A 3JUJA 3BCVA 2RJ0A 5FU8A 4Y63A 2QH5A 2E3DA 5C1HA 1QGQA 3D5NA 1W55A 4E1KA 4EEGA 4HO6A 2XMHA 4JISA 5CMJA 2VXLA 1MP3A 2FFVA 1JV1A 4YS8A 4HO2A 1W57A 1FR9A 3O3PA 3Q80A 5IDTA 2V0KA 3DJ4A 1JVDA 5CMHA 4FRPA 3ZGGA 3RMWA 2GGQA 5L6SA 1R7VA 2VK9A 2PGYA 2WVMA 3RSBA 1R7XA 1FGGA 5CMGX 4KPZA 3SPTA 2GGOA 2FFUA 3ZGFA 4CJCA 4BMAA 2YQHA 4DECA 1QG8A 2QGIA 4FCEA 3U2VA 4FROA 5C8RA 2YESA 3R3IA 3T7OA 3ZLLA 2V0LA 5EJZA 1H7QA 1ZHJA 1QGSA 1FO8A 1WT2A 3PNNA 5C4BA 1ZJOA 4KNXA 3KIAA 1KWSA 1GQCA 3SX5A 1GWWA 2VS5A 2WVKA 1G23A 3SXGA 4IRQA 4Q7CA 3OKRA 4KC1A 1G0RA 3I0EA 5J49A 4FRQA 2XMEA 1H5TA 4G87A 2YQJA 1IIMA 4M2AA 3ST8A 5C38A 4KQLA 1PZYB 1FXJA 5C4CA 1TW5A 3IOHA 1HJJA 4FCUA 4HO9A 5CQMX 3QVBA 3SX8A 4ECMA 1R81A 1VH1A 5AJNA 1YROB 5DDVA 1R7YA 1VH3A 2VSHA 4FRMA 1EYRA 2RJ6A 2X60A 1LZIA 2W0WA 3R2WA 5C3BA 2Z86A 1HM8A 1ZCTA 4O6MA 3I0IX 4FIYA 2FYBA 1R80A 4G3SA 1G95A 3I0HA 1H5TB 1ZCUA 5BXCA 1FGXA 3V0QA 4M4KA 5DDTA 4CVHA 2D7RA 3JUKA 1SS9A 2VXMA 1I52A 3I0CA 2Y4LA 2MZBA 3OC9A 4HO8A 4B3UA 1G1LA 3I0GA 4EEMA 4D11A 2RJ9A 4DE7A 1FO9A 1G3LA 3N9WA 2RIYA 1ZIZA 1NMMB 4D11C 2D7IA 1NWGB 2D0JA 2PX7A 3TQDA 1MP4A 5HS2A 4ARWA 1MP5A 1FWYA 2AE7A 3ZF8A 5FU0A 2AESA 3U0XA 2O1GA 1VPAA 1IINA 2WEEA 5CQPA 1ON6A 3IOJA 3SX7A 4ASYA 1YP3A 1R7TA 2OI7A 1HM9A 2I5KA 4KC4A 5FTVA 4HG6A 4Y7VA 1O7OA 1TZFA 2WGZA 1G8OA 2NXVA 5AJPA 3D98A 1MC3A 5CQOA 2X65A 4EEAA 1VZXA 1H4EA 4CJ8A 3JTJA 1LZ0A 3TZTA 4Y9XA 2ZU9A 1O0RA 2V0JA 1H7HA 1TW1A 2Y7AA 2PGVA 3USRA 3U2TA 1VGUA 2RJ7A 3Q7UA 4FRAA 5C47A 3HL3A 2BO7A 1JV3A 2Y4JA 2FY7A 1VZUA 1GQ9A 4O6NA 4R7PA 2XWNA 1INIA 5CQNX 1LL3A 1YP2A 1R7UA 2OI6A 4EE5A 1H5SC 1VGWA 3I0LA 1FZWA 1FG5N 4MYBA 1FRWA 4GBPA 1ZDFA 1HV9A 1VGTA 2RIXA 4HO5A 1H7GA 2CU2A 4K6RA 4KPXA 2RITA 1G2VA 5FYEA 1ZJPA 4D0TA 3Q4SA 4NAIA 2ZU7A 3CKVA 1H5SB 1FXOA 3V0LA 5C36A 1S4PA 1H4DA 3U2UA 4EE4A 2QKXA 5IDSA 4KNRA 3GUEA 4KRVA 1JYKA 2BO4A 2UX8A 3RMVA 2Y4MA 2BO6A 3LW6A 3I0FA 1OQMB 5C4EA 5CQLX 4B42A 3CU0A 5CMFX 2X5SA 1FOAA 4FQWA 3U0YA 1ZCYA 1ZDGA 2JCJA 4FRBA 3CKQA 2XWLA 4Y62A 5FV9A 3V0OA 4P02A 4IRPA 3SXEA 2WE9A 5CMIA 2JCOA 4Y6NA 5C48A 5C3AA 1ZJ1A 1XHBA 4LW3A 4AC3A 4Y7GA 4Y7UA 1JYLA 3USQA 1OMXA 1GA8A 2X5ZA 2P6WA 3U2WA 4DDZA 1TVYA 4KT7A 3BRKX 2RJ4A 1H7EA 4Y7FA 4NAKA 1YP4A 5C3DA 1H5RB 3SXDA 1V84A 1ON8A 1ZJ0A 3IOIA 2J0BA 1ZI5A 2YCMA 4BQHA 5JQQA 2BO8A 2VFZA 4EVWA 1XZ6A 4D0ZA 1VICA 4M28A 1WT1A 2YC3A 4L41C 4Y6UA 1WVCA 4FRHA 1ZJ2A 1EZIA 1ZI3A 3PKQA 5I1FA 4MIXA 1LZJA 4D48A 1OMZA 2Q4JA 2ICXA 1ZCVA 1NKHB 5D91A 2VS4A 5D92A 4FRDA 1NF5B 4HO4A 2I7BA 2ZU8A 1H5SA 1H7TA 1G9RA 1G93A 1LVWA 2RIZA 2RJ5A 3K8DA 4NANA 2P72A 1VM8A 1NQIB 3OH0A 2AM5A 2AM4A 1INJA 1GWVA 2VS3A 3EE5A 3V0NA 4B4MA 1GX0A 4AYJA 2P73A 3E26A 2DPWA 4HOCA 3V0MA 2AM3A 4B4BA 1JVGA 2V0HA 3OAMA 2RJ1A 3SX3A 1R82A 3SXBA 4UEGA 4B2XA 3ZLKA 3FWWA 3U2XA 1HM0A 1LL2A 5C4DA 3OH3A 4MNDA 3CKOA 5AJOA 2AECA 5C1GA 3OH2A 4HO3A 3T7NA 2I5EA 4KC2A 4EE3A 1Z90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2S A;  5C49 A;  1E5K A;  1ZI1 A;  4HCQ A;  2A8W A;  1O7Q A;  1W77 A;  5FTS A;  3SXA A;  2FYD B;  1G97 A;  2APC A;  3SXC A;  3V0P A;  4P00 A;  4XWI A;  2WVL A;  2VSI A;  4G3Q A;  1H4C A;  2RJ8 A;  1WT3 A;  1ZI4 A;  4AYL A;  2Y6P A;  2O1H A;  3CGX A;  2A8U A;  3V8Y A;  2JCK A;  2FYA A;  1H7F A;  1S4O A;  2V0I A;  1WSZ A;  3E25 A;  4M2B A;  1H3M A;  2AH9 A;  1HJL A;  1H5R A;  5EJ1 A;  1VZT A;  4J18 A;  3OGZ A;  4KXO A;  1LZ7 A;  4Y7T A;  1QWJ A;  1V82 A;  1VGZ A;  2YC5 A;  2YQS A;  4G3P A;  4CJB A;  3T7M A;  2VD4 A;  4B4G A;  1S4N A;  4NAL A;  3V8Z A;  4EEO A;  3V91 A;  2AGD A;  1ZJ3 A;  3POL A;  3I0J A;  2W0V A;  1V83 A;  3K8E A;  3FOQ A;  3PKP A;  5EIY A;  1H5S D;  1FR8 A;  2WAW A;  4AAW A;  1O23 B;  3DK5 A;  4Y64 A;  2E8B A;  4ZDQ A;  4FRL A;  4JD0 A;  2ICY A;  1H7L A;  1PZT A;  3CKJ A;  5IFY A;  2OI5 A;  3I0K A;  5L6V A;  2OEG A;  3OH1 A;  3D8V A;  2XWM A;  2O1F A;  2YQC A;  4B2W A;  1GX4 A;  4FRE A;  3V90 A;  2FYC B;  4ASJ A;  4HO0 A;  2JCL A;  1NHE B;  2OEF A;  3I0D A;  3DUV A;  4LW6 A;  1LL0 A;  4B5B A;  1WT0 A;  5C1L A;  5C4F A;  2Z87 A;  1K4V A;  5FUH A;  3OH4 A;  3CKN A;  2Y4K A;  3F1Y A;  3F1C A;  3NGW A;  2PA4 A;  3JUJ A;  3BCV A;  2RJ0 A;  5FU8 A;  4Y63 A;  2QH5 A;  2E3D A;  5C1H A;  1QGQ A;  3D5N A;  1W55 A;  4E1K A;  4EEG A;  4HO6 A;  2XMH A;  4JIS A;  5CMJ A;  2VXL A;  1MP3 A;  2FFV A;  1JV1 A;  4YS8 A;  4HO2 A;  1W57 A;  1FR9 A;  3O3P A;  3Q80 A;  5IDT A;  2V0K A;  3DJ4 A;  1JVD A;  5CMH A;  4FRP A;  3ZGG A;  3RMW A;  2GGQ A;  5L6S A;  1R7V A;  2PGY A;  2WVM A;  3RSB A;  1R7X A;  1FGG A;  5CMG X;  4KPZ A;  3SPT A;  2GGO A;  2FFU A;  3ZGF A;  4CJC A;  4BMA A;  2YQH A;  4DEC A;  1QG8 A;  2QGI A;  4FCE A;  3U2V A;  4FRO A;  5C8R A;  2YES A;  3R3I A;  3T7O A;  3ZLL A;  2V0L A;  5EJZ A;  1H7Q A;  1ZHJ A;  1QGS A;  1FO8 A;  1WT2 A;  3PNN A;  5C4B A;  1ZJO A;  4KNX A;  3KIA A;  1KWS A;  1GQC A;  3SX5 A;  1GWW A;  2VS5 A;  2WVK A;  1G23 A;  3SXG A;  4IRQ A;  3OKR A;  4KC1 A;  1G0R A;  3I0E A;  5J49 A;  4FRQ A;  2XME A;  1H5T A;  4G87 A;  2YQJ A;  1IIM A;  4M2A A;  3ST8 A;  5C38 A;  4KQL A;  1PZY B;  1FXJ A;  5C4C A;  1TW5 A;  3IOH A;  1HJJ A;  4FCU A;  4HO9 A;  5CQM X;  3QVB A;  3SX8 A;  4ECM A;  1R81 A;  1VH1 A;  5AJN A;  1YRO B;  5DDV A;  1R7Y A;  1VH3 A;  2VSH A;  4FRM A;  1EYR A;  2RJ6 A;  2X60 A;  1LZI A;  2W0W A;  3R2W A;  5C3B A;  2Z86 A;  1HM8 A;  1ZCT A;  3I0I X;  2FYB A;  1R80 A;  4G3S A;  1G95 A;  3I0H A;  1H5T B;  1ZCU A;  5BXC A;  1FGX A;  3V0Q A;  4M4K A;  5DDT A;  4CVH A;  2D7R A;  3JUK A;  1SS9 A;  2VXM A;  1I52 A;  3I0C A;  2Y4L A;  2MZB A;  3OC9 A;  4HO8 A;  4B3U A;  1G1L A;  3I0G A;  4EEM A;  4D11 A;  2RJ9 A;  4DE7 A;  1FO9 A;  1G3L A;  3N9W A;  2RIY A;  1ZIZ A;  1NMM B;  4D11 C;  2D7I A;  1NWG B;  2D0J A;  2PX7 A;  3TQD A;  1MP4 A;  5HS2 A;  4ARW A;  1MP5 A;  1FWY A;  2AE7 A;  3ZF8 A;  5FU0 A;  2AES A;  3U0X A;  2O1G A;  1VPA A;  1IIN A;  2WEE A;  5CQP A;  1ON6 A;  3IOJ A;  3SX7 A;  4ASY A;  1YP3 A;  1R7T A;  2OI7 A;  1HM9 A;  2I5K A;  4KC4 A;  5FTV A;  4HG6 A;  4Y7V A;  1O7O A;  1TZF A;  2WGZ A;  1G8O A;  2NXV A;  5AJP A;  3D98 A;  1MC3 A;  5CQO A;  2X65 A;  4EEA A;  1VZX A;  1H4E A;  4CJ8 A;  3JTJ A;  1LZ0 A;  3TZT A;  4Y9X A;  2ZU9 A;  1O0R A;  2V0J A;  1H7H A;  1TW1 A;  2Y7A A;  2PGV A;  3USR A;  3U2T A;  1VGU A;  2RJ7 A;  3Q7U A;  4FRA A;  5C47 A;  3HL3 A;  2BO7 A;  1JV3 A;  2Y4J A;  2FY7 A;  1VZU A;  1GQ9 A;  4R7P A;  2XWN A;  1INI A;  5CQN X;  1LL3 A;  1YP2 A;  1R7U A;  2OI6 A;  4EE5 A;  1H5S C;  1VGW A;  3I0L A;  1FZW A;  1FG5 N;  4MYB A;  1FRW A;  4GBP A;  1ZDF A;  1HV9 A;  1VGT A;  2RIX A;  4HO5 A;  1H7G A;  2CU2 A;  4K6R A;  4KPX A;  2RIT A;  1G2V A;  5FYE A;  1ZJP A;  4D0T A;  3Q4S A;  4NAI A;  2ZU7 A;  3CKV A;  1H5S B;  1FXO A;  3V0L A;  5C36 A;  1S4P A;  1H4D A;  3U2U A;  4EE4 A;  2QKX A;  5IDS A;  4KNR A;  3GUE A;  4KRV A;  1JYK A;  2BO4 A;  2UX8 A;  3RMV A;  2Y4M A;  2BO6 A;  3LW6 A;  3I0F A;  1OQM B;  5C4E A;  5CQL X;  4B42 A;  3CU0 A;  5CMF X;  2X5S A;  1FOA A;  4FQW A;  3U0Y A;  1ZCY A;  1ZDG A;  2JCJ A;  4FRB A;  3CKQ A;  2XWL A;  4Y62 A;  5FV9 A;  3V0O A;  4P02 A;  4IRP A;  3SXE A;  2WE9 A;  5CMI A;  2JCO A;  4Y6N A;  5C48 A;  5C3A A;  1ZJ1 A;  1XHB A;  4LW3 A;  4AC3 A;  4Y7G A;  4Y7U A;  1JYL A;  3USQ A;  1OMX A;  1GA8 A;  2X5Z A;  2P6W A;  3U2W A;  4DDZ A;  1TVY A;  4KT7 A;  3BRK X;  2RJ4 A;  1H7E A;  4Y7F A;  4NAK A;  1YP4 A;  5C3D A;  1H5R B;  3SXD A;  1V84 A;  1ON8 A;  1ZJ0 A;  3IOI A;  1ZI5 A;  2YCM A;  4BQH A;  5JQQ A;  2BO8 A;  2VFZ A;  4EVW A;  1XZ6 A;  4D0Z A;  1VIC A;  4M28 A;  1WT1 A;  2YC3 A;  4L41 C;  4Y6U A;  1WVC A;  4FRH A;  1ZJ2 A;  1EZI A;  1ZI3 A;  3PKQ A;  5I1F A;  1LZJ A;  4D48 A;  1OMZ A;  2Q4J A;  2ICX A;  1ZCV A;  1NKH B;  2VS4 A;  4FRD A;  1NF5 B;  4HO4 A;  2I7B A;  2ZU8 A;  1H5S A;  1H7T A;  1G9R A;  1G93 A;  1LVW A;  2RIZ A;  2RJ5 A;  3K8D A;  4NAN A;  2P72 A;  1VM8 A;  1NQI B;  3OH0 A;  2AM5 A;  2AM4 A;  1INJ A;  1GWV A;  2VS3 A;  3EE5 A;  3V0N A;  4B4M A;  1GX0 A;  4AYJ A;  2P73 A;  3E26 A;  2DPW A;  4HOC A;  3V0M A;  2AM3 A;  4B4B A;  1JVG A;  2V0H A;  3OAM A;  2RJ1 A;  3SX3 A;  1R82 A;  3SXB A;  4UEG A;  4B2X A;  3ZLK A;  3FWW A;  3U2X A;  1HM0 A;  1LL2 A;  5C4D A;  3OH3 A;  4MND A;  3CKO A;  5AJO A;  2AEC A;  5C1G A;  3OH2 A;  4HO3 A;  3T7N A;  2I5E A;  4KC2 A;  4EE3 A;  1Z90 A; 
#chains in the Genus database with same CATH topology
 4C2S A;  5C49 A;  1E5K A;  1ZI1 A;  4HCQ A;  2A8W A;  1O7Q A;  1W77 A;  5FTS A;  3SXA A;  2FYD B;  1G97 A;  2APC A;  3SXC A;  3V0P A;  4P00 A;  4XWI A;  2WVL A;  2VSI A;  4G3Q A;  1H4C A;  2RJ8 A;  1WT3 A;  1ZI4 A;  4AYL A;  2Y6P A;  2O1H A;  3CGX A;  2A8U A;  3V8Y A;  2JCK A;  2FYA A;  1H7F A;  1S4O A;  2V0I A;  1WSZ A;  3E25 A;  4M2B A;  1H3M A;  2AH9 A;  1HJL A;  1H5R A;  5EJ1 A;  1VZT A;  4J18 A;  3OGZ A;  4KXO A;  1LZ7 A;  4Y7T A;  1QWJ A;  1V82 A;  1VGZ A;  2YC5 A;  2YQS A;  4G3P A;  4CJB A;  2J0A A;  3T7M A;  2VD4 A;  4B4G A;  1S4N A;  4NAL A;  3V8Z A;  4EEO A;  3V91 A;  2AGD A;  1ZJ3 A;  3POL A;  3I0J A;  2W0V A;  1V83 A;  3K8E A;  3FOQ A;  3PKP A;  5EIY A;  1H5S D;  1FR8 A;  2WAW A;  4AAW A;  4FIX A;  1O23 B;  3DK5 A;  4Y64 A;  2E8B A;  4ZDQ A;  4FRL A;  4JD0 A;  2ICY A;  1H7L A;  2C0N A;  1PZT A;  3CKJ A;  5IFY A;  2OI5 A;  3I0K A;  5L6V A;  2OEG A;  3OH1 A;  3D8V A;  2XWM A;  2O1F A;  2YQC A;  4B2W A;  1GX4 A;  4FRE A;  3V90 A;  2FYC B;  4ASJ A;  4HO0 A;  2JCL A;  1NHE B;  2OEF A;  3I0D A;  3DUV A;  4LW6 A;  1LL0 A;  4B5B A;  1WT0 A;  5C1L A;  5C4F A;  2Z87 A;  1K4V A;  5FUH A;  3OH4 A;  3CKN A;  2Y4K A;  3F1Y A;  3F1C A;  3NGW A;  2PA4 A;  3JUJ A;  3BCV A;  2RJ0 A;  5FU8 A;  4Y63 A;  2QH5 A;  2E3D A;  5C1H A;  1QGQ A;  3D5N A;  1W55 A;  4E1K A;  4EEG A;  4HO6 A;  2XMH A;  4JIS A;  5CMJ A;  2VXL A;  1MP3 A;  2FFV A;  1JV1 A;  4YS8 A;  4HO2 A;  1W57 A;  1FR9 A;  3O3P A;  3Q80 A;  5IDT A;  2V0K A;  3DJ4 A;  1JVD A;  5CMH A;  4FRP A;  3ZGG A;  3RMW A;  2GGQ A;  5L6S A;  1R7V A;  2VK9 A;  2PGY A;  2WVM A;  3RSB A;  1R7X A;  1FGG A;  5CMG X;  4KPZ A;  3SPT A;  2GGO A;  2FFU A;  3ZGF A;  4CJC A;  4BMA A;  2YQH A;  4DEC A;  1QG8 A;  2QGI A;  4FCE A;  3U2V A;  4FRO A;  5C8R A;  2YES A;  3R3I A;  3T7O A;  3ZLL A;  2V0L A;  5EJZ A;  1H7Q A;  1ZHJ A;  1QGS A;  1FO8 A;  1WT2 A;  3PNN A;  5C4B A;  1ZJO A;  4KNX A;  3KIA A;  1KWS A;  1GQC A;  3SX5 A;  1GWW A;  2VS5 A;  2WVK A;  1G23 A;  3SXG A;  4IRQ A;  4Q7C A;  3OKR A;  4KC1 A;  1G0R A;  3I0E A;  5J49 A;  4FRQ A;  2XME A;  1H5T A;  4G87 A;  2YQJ A;  1IIM A;  4M2A A;  3ST8 A;  5C38 A;  4KQL A;  1PZY B;  1FXJ A;  5C4C A;  1TW5 A;  3IOH A;  1HJJ A;  4FCU A;  4HO9 A;  5CQM X;  3QVB A;  3SX8 A;  4ECM A;  1R81 A;  1VH1 A;  5AJN A;  1YRO B;  5DDV A;  1R7Y A;  1VH3 A;  2VSH A;  4FRM A;  1EYR A;  2RJ6 A;  2X60 A;  1LZI A;  2W0W A;  3R2W A;  5C3B A;  2Z86 A;  1HM8 A;  1ZCT A;  4O6M A;  3I0I X;  4FIY A;  2FYB A;  1R80 A;  4G3S A;  1G95 A;  3I0H A;  1H5T B;  1ZCU A;  5BXC A;  1FGX A;  3V0Q A;  4M4K A;  5DDT A;  4CVH A;  2D7R A;  3JUK A;  1SS9 A;  2VXM A;  1I52 A;  3I0C A;  2Y4L A;  2MZB A;  3OC9 A;  4HO8 A;  4B3U A;  1G1L A;  3I0G A;  4EEM A;  4D11 A;  2RJ9 A;  4DE7 A;  1FO9 A;  1G3L A;  3N9W A;  2RIY A;  1ZIZ A;  1NMM B;  4D11 C;  2D7I A;  1NWG B;  2D0J A;  2PX7 A;  3TQD A;  1MP4 A;  5HS2 A;  4ARW A;  1MP5 A;  1FWY A;  2AE7 A;  3ZF8 A;  5FU0 A;  2AES A;  3U0X A;  2O1G A;  1VPA A;  1IIN A;  2WEE A;  5CQP A;  1ON6 A;  3IOJ A;  3SX7 A;  4ASY A;  1YP3 A;  1R7T A;  2OI7 A;  1HM9 A;  2I5K A;  4KC4 A;  5FTV A;  4HG6 A;  4Y7V A;  1O7O A;  1TZF A;  2WGZ A;  1G8O A;  2NXV A;  5AJP A;  3D98 A;  1MC3 A;  5CQO A;  2X65 A;  4EEA A;  1VZX A;  1H4E A;  4CJ8 A;  3JTJ A;  1LZ0 A;  3TZT A;  4Y9X A;  2ZU9 A;  1O0R A;  2V0J A;  1H7H A;  1TW1 A;  2Y7A A;  2PGV A;  3USR A;  3U2T A;  1VGU A;  2RJ7 A;  3Q7U A;  4FRA A;  5C47 A;  3HL3 A;  2BO7 A;  1JV3 A;  2Y4J A;  2FY7 A;  1VZU A;  1GQ9 A;  4O6N A;  4R7P A;  2XWN A;  1INI A;  5CQN X;  1LL3 A;  1YP2 A;  1R7U A;  2OI6 A;  4EE5 A;  1H5S C;  1VGW A;  3I0L A;  1FZW A;  1FG5 N;  4MYB A;  1FRW A;  4GBP A;  1ZDF A;  1HV9 A;  1VGT A;  2RIX A;  4HO5 A;  1H7G A;  2CU2 A;  4K6R A;  4KPX A;  2RIT A;  1G2V A;  5FYE A;  1ZJP A;  4D0T A;  3Q4S A;  4NAI A;  2ZU7 A;  3CKV A;  1H5S B;  1FXO A;  3V0L A;  5C36 A;  1S4P A;  1H4D A;  3U2U A;  4EE4 A;  2QKX A;  5IDS A;  4KNR A;  3GUE A;  4KRV A;  1JYK A;  2BO4 A;  2UX8 A;  3RMV A;  2Y4M A;  2BO6 A;  3LW6 A;  3I0F A;  1OQM B;  5C4E A;  5CQL X;  4B42 A;  3CU0 A;  5CMF X;  2X5S A;  1FOA A;  4FQW A;  3U0Y A;  1ZCY A;  1ZDG A;  2JCJ A;  4FRB A;  3CKQ A;  2XWL A;  4Y62 A;  5FV9 A;  3V0O A;  4P02 A;  4IRP A;  3SXE A;  2WE9 A;  5CMI A;  2JCO A;  4Y6N A;  5C48 A;  5C3A A;  1ZJ1 A;  1XHB A;  4LW3 A;  4AC3 A;  4Y7G A;  4Y7U A;  1JYL A;  3USQ A;  1OMX A;  1GA8 A;  2X5Z A;  2P6W A;  3U2W A;  4DDZ A;  1TVY A;  4KT7 A;  3BRK X;  2RJ4 A;  1H7E A;  4Y7F A;  4NAK A;  1YP4 A;  5C3D A;  1H5R B;  3SXD A;  1V84 A;  1ON8 A;  1ZJ0 A;  3IOI A;  2J0B A;  1ZI5 A;  2YCM A;  4BQH A;  5JQQ A;  2BO8 A;  2VFZ A;  4EVW A;  1XZ6 A;  4D0Z A;  1VIC A;  4M28 A;  1WT1 A;  2YC3 A;  4L41 C;  4Y6U A;  1WVC A;  4FRH A;  1ZJ2 A;  1EZI A;  1ZI3 A;  3PKQ A;  5I1F A;  4MIX A;  1LZJ A;  4D48 A;  1OMZ A;  2Q4J A;  2ICX A;  1ZCV A;  1NKH B;  5D91 A;  2VS4 A;  5D92 A;  4FRD A;  1NF5 B;  4HO4 A;  2I7B A;  2ZU8 A;  1H5S A;  1H7T A;  1G9R A;  1G93 A;  1LVW A;  2RIZ A;  2RJ5 A;  3K8D A;  4NAN A;  2P72 A;  1VM8 A;  1NQI B;  3OH0 A;  2AM5 A;  2AM4 A;  1INJ A;  1GWV A;  2VS3 A;  3EE5 A;  3V0N A;  4B4M A;  1GX0 A;  4AYJ A;  2P73 A;  3E26 A;  2DPW A;  4HOC A;  3V0M A;  2AM3 A;  4B4B A;  1JVG A;  2V0H A;  3OAM A;  2RJ1 A;  3SX3 A;  1R82 A;  3SXB A;  4UEG A;  4B2X A;  3ZLK A;  3FWW A;  3U2X A;  1HM0 A;  1LL2 A;  5C4D A;  3OH3 A;  4MND A;  3CKO A;  5AJO A;  2AEC A;  5C1G A;  3OH2 A;  4HO3 A;  3T7N A;  2I5E A;  4KC2 A;  4EE3 A;  1Z90 A; 
#chains in the Genus database with same CATH homology
 4C2S A;  5C49 A;  1E5K A;  1ZI1 A;  4HCQ A;  2A8W A;  1O7Q A;  1W77 A;  5FTS A;  3SXA A;  2FYD B;  1G97 A;  2APC A;  3SXC A;  3V0P A;  4P00 A;  4XWI A;  2WVL A;  2VSI A;  4G3Q A;  1H4C A;  2RJ8 A;  1WT3 A;  1ZI4 A;  4AYL A;  2Y6P A;  2O1H A;  3CGX A;  2A8U A;  3V8Y A;  2JCK A;  2FYA A;  1H7F A;  1S4O A;  2V0I A;  1WSZ A;  3E25 A;  4M2B A;  1H3M A;  2AH9 A;  1HJL A;  1H5R A;  5EJ1 A;  1VZT A;  4J18 A;  3OGZ A;  4KXO A;  1LZ7 A;  4Y7T A;  1QWJ A;  1V82 A;  1VGZ A;  2YC5 A;  2YQS A;  4G3P A;  4CJB A;  2J0A A;  3T7M A;  2VD4 A;  4B4G A;  1S4N A;  4NAL A;  3V8Z A;  4EEO A;  3V91 A;  2AGD A;  1ZJ3 A;  3POL A;  3I0J A;  2W0V A;  1V83 A;  3K8E A;  3FOQ A;  3PKP A;  5EIY A;  1H5S D;  1FR8 A;  2WAW A;  4AAW A;  4FIX A;  1O23 B;  3DK5 A;  4Y64 A;  2E8B A;  4ZDQ A;  4FRL A;  4JD0 A;  2ICY A;  1H7L A;  2C0N A;  1PZT A;  3CKJ A;  5IFY A;  2OI5 A;  3I0K A;  5L6V A;  2OEG A;  3OH1 A;  3D8V A;  2XWM A;  2O1F A;  2YQC A;  4B2W A;  1GX4 A;  4FRE A;  3V90 A;  2FYC B;  4ASJ A;  4HO0 A;  2JCL A;  1NHE B;  2OEF A;  3I0D A;  3DUV A;  4LW6 A;  1LL0 A;  4B5B A;  1WT0 A;  5C1L A;  5C4F A;  2Z87 A;  1K4V A;  5FUH A;  3OH4 A;  3CKN A;  2Y4K A;  3F1Y A;  3F1C A;  3NGW A;  2PA4 A;  3JUJ A;  3BCV A;  2RJ0 A;  5FU8 A;  4Y63 A;  2QH5 A;  2E3D A;  5C1H A;  1QGQ A;  3D5N A;  1W55 A;  4E1K A;  4EEG A;  4HO6 A;  2XMH A;  4JIS A;  5CMJ A;  2VXL A;  1MP3 A;  2FFV A;  1JV1 A;  4YS8 A;  4HO2 A;  1W57 A;  1FR9 A;  3O3P A;  3Q80 A;  5IDT A;  2V0K A;  3DJ4 A;  1JVD A;  5CMH A;  4FRP A;  3ZGG A;  3RMW A;  2GGQ A;  5L6S A;  1R7V A;  2VK9 A;  2PGY A;  2WVM A;  3RSB A;  1R7X A;  1FGG A;  5CMG X;  4KPZ A;  3SPT A;  2GGO A;  2FFU A;  3ZGF A;  4CJC A;  4BMA A;  2YQH A;  4DEC A;  1QG8 A;  2QGI A;  4FCE A;  3U2V A;  4FRO A;  5C8R A;  2YES A;  3R3I A;  3T7O A;  3ZLL A;  2V0L A;  5EJZ A;  1H7Q A;  1ZHJ A;  1QGS A;  1FO8 A;  1WT2 A;  3PNN A;  5C4B A;  1ZJO A;  4KNX A;  3KIA A;  1KWS A;  1GQC A;  3SX5 A;  1GWW A;  2VS5 A;  2WVK A;  1G23 A;  3SXG A;  4IRQ A;  4Q7C A;  3OKR A;  4KC1 A;  1G0R A;  3I0E A;  5J49 A;  4FRQ A;  2XME A;  1H5T A;  4G87 A;  2YQJ A;  1IIM A;  4M2A A;  3ST8 A;  5C38 A;  4KQL A;  1PZY B;  1FXJ A;  5C4C A;  1TW5 A;  3IOH A;  1HJJ A;  4FCU A;  4HO9 A;  5CQM X;  3QVB A;  3SX8 A;  4ECM A;  1R81 A;  1VH1 A;  5AJN A;  1YRO B;  5DDV A;  1R7Y A;  1VH3 A;  2VSH A;  4FRM A;  1EYR A;  2RJ6 A;  2X60 A;  1LZI A;  2W0W A;  3R2W A;  5C3B A;  2Z86 A;  1HM8 A;  1ZCT A;  4O6M A;  3I0I X;  4FIY A;  2FYB A;  1R80 A;  4G3S A;  1G95 A;  3I0H A;  1H5T B;  1ZCU A;  5BXC A;  1FGX A;  3V0Q A;  4M4K A;  5DDT A;  4CVH A;  2D7R A;  3JUK A;  1SS9 A;  2VXM A;  1I52 A;  3I0C A;  2Y4L A;  2MZB A;  3OC9 A;  4HO8 A;  4B3U A;  1G1L A;  3I0G A;  4EEM A;  4D11 A;  2RJ9 A;  4DE7 A;  1FO9 A;  1G3L A;  3N9W A;  2RIY A;  1ZIZ A;  1NMM B;  4D11 C;  2D7I A;  1NWG B;  2D0J A;  2PX7 A;  3TQD A;  1MP4 A;  5HS2 A;  4ARW A;  1MP5 A;  1FWY A;  2AE7 A;  3ZF8 A;  5FU0 A;  2AES A;  3U0X A;  2O1G A;  1VPA A;  1IIN A;  2WEE A;  5CQP A;  1ON6 A;  3IOJ A;  3SX7 A;  4ASY A;  1YP3 A;  1R7T A;  2OI7 A;  1HM9 A;  2I5K A;  4KC4 A;  5FTV A;  4HG6 A;  4Y7V A;  1O7O A;  1TZF A;  2WGZ A;  1G8O A;  2NXV A;  5AJP A;  3D98 A;  1MC3 A;  5CQO A;  2X65 A;  4EEA A;  1VZX A;  1H4E A;  4CJ8 A;  3JTJ A;  1LZ0 A;  3TZT A;  4Y9X A;  2ZU9 A;  1O0R A;  2V0J A;  1H7H A;  1TW1 A;  2Y7A A;  2PGV A;  3USR A;  3U2T A;  1VGU A;  2RJ7 A;  3Q7U A;  4FRA A;  5C47 A;  3HL3 A;  2BO7 A;  1JV3 A;  2Y4J A;  2FY7 A;  1VZU A;  1GQ9 A;  4O6N A;  4R7P A;  2XWN A;  1INI A;  5CQN X;  1LL3 A;  1YP2 A;  1R7U A;  2OI6 A;  4EE5 A;  1H5S C;  1VGW A;  3I0L A;  1FZW A;  1FG5 N;  4MYB A;  1FRW A;  4GBP A;  1ZDF A;  1HV9 A;  1VGT A;  2RIX A;  4HO5 A;  1H7G A;  2CU2 A;  4K6R A;  4KPX A;  2RIT A;  1G2V A;  5FYE A;  1ZJP A;  4D0T A;  3Q4S A;  4NAI A;  2ZU7 A;  3CKV A;  1H5S B;  1FXO A;  3V0L A;  5C36 A;  1S4P A;  1H4D A;  3U2U A;  4EE4 A;  2QKX A;  5IDS A;  4KNR A;  3GUE A;  4KRV A;  1JYK A;  2BO4 A;  2UX8 A;  3RMV A;  2Y4M A;  2BO6 A;  3LW6 A;  3I0F A;  1OQM B;  5C4E A;  5CQL X;  4B42 A;  3CU0 A;  5CMF X;  2X5S A;  1FOA A;  4FQW A;  3U0Y A;  1ZCY A;  1ZDG A;  2JCJ A;  4FRB A;  3CKQ A;  2XWL A;  4Y62 A;  5FV9 A;  3V0O A;  4P02 A;  4IRP A;  3SXE A;  2WE9 A;  5CMI A;  2JCO A;  4Y6N A;  5C48 A;  5C3A A;  1ZJ1 A;  1XHB A;  4LW3 A;  4AC3 A;  4Y7G A;  4Y7U A;  1JYL A;  3USQ A;  1OMX A;  1GA8 A;  2X5Z A;  2P6W A;  3U2W A;  4DDZ A;  1TVY A;  4KT7 A;  3BRK X;  2RJ4 A;  1H7E A;  4Y7F A;  4NAK A;  1YP4 A;  5C3D A;  1H5R B;  3SXD A;  1V84 A;  1ON8 A;  1ZJ0 A;  3IOI A;  2J0B A;  1ZI5 A;  2YCM A;  4BQH A;  5JQQ A;  2BO8 A;  2VFZ A;  4EVW A;  1XZ6 A;  4D0Z A;  1VIC A;  4M28 A;  1WT1 A;  2YC3 A;  4L41 C;  4Y6U A;  1WVC A;  4FRH A;  1ZJ2 A;  1EZI A;  1ZI3 A;  3PKQ A;  5I1F A;  4MIX A;  1LZJ A;  4D48 A;  1OMZ A;  2Q4J A;  2ICX A;  1ZCV A;  1NKH B;  5D91 A;  2VS4 A;  5D92 A;  4FRD A;  1NF5 B;  4HO4 A;  2I7B A;  2ZU8 A;  1H5S A;  1H7T A;  1G9R A;  1G93 A;  1LVW A;  2RIZ A;  2RJ5 A;  3K8D A;  4NAN A;  2P72 A;  1VM8 A;  1NQI B;  3OH0 A;  2AM5 A;  2AM4 A;  1INJ A;  1GWV A;  2VS3 A;  3EE5 A;  3V0N A;  4B4M A;  1GX0 A;  4AYJ A;  2P73 A;  3E26 A;  2DPW A;  4HOC A;  3V0M A;  2AM3 A;  4B4B A;  1JVG A;  2V0H A;  3OAM A;  2RJ1 A;  3SX3 A;  1R82 A;  3SXB A;  4UEG A;  4B2X A;  3ZLK A;  3FWW A;  3U2X A;  1HM0 A;  1LL2 A;  5C4D A;  3OH3 A;  4MND A;  3CKO A;  5AJO A;  2AEC A;  5C1G A;  3OH2 A;  4HO3 A;  3T7N A;  2I5E A;  4KC2 A;  4EE3 A;  1Z90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...