1WT2A

Mutant human abo(h) blood group glycosyltransferase a with bound udp and inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQSKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Structural basis for the inactivity of human blood group o2 glycosyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1wt2A00
1VZTA 2FYCB 4KC2A 3U2UA 4EEAA 1R7UA 1H7GA 1ZJ1A 3JTJA 3U0XA 1LL3A 2X60A 1FGGA 3QVBA 3V0MA 2APCA 1FR9A 3Q7UA 1JYLA 5EIYA 5C8RA 1R80A 3ZGGA 1H5RA 2P6WA 2V0IA 1YP4A 5FTSA 3EE5A 1LVWA 1LL2A 3IOIA 3OKRA 1ZDFA 1HM8A 1GQCA 4NANA 4IRQA 3O3PA 4ASJA 1H5SD 3I0KA 3SXEA 3V8ZA 1G97A 1R81A 1EZIA 1FO9A 2YQJA 1LL0A 1HJJA 1G0RA 2ICXA 2JCKA 3F1CA 4BQHA 1G2VA 1H5SC 1Z90A 2GGOA 2I5EA 4FQWA 4KC4A 2WVKA 2QGIA 2RIYA 3LW6A 5AJNA 1JVDA 4KQLA 2Z87A 1WSZA 2JCLA 2WAWA 1HV9A 3K8EA 1E5KA 3V0PA 1YP3A 1ZJ3A 3E26A 1VGTA 4ECMA 2VS3A 5HS2A 4B2XA 1LZIA 5C3BA 3IOHA 4HO9A 4KPZA 5C4BA 1HM0A 4FRQA 3ZGFA 3U2VA 3F1YA 1KWSA 1V83A 5C4CA 3OH2A 1ON6A 3USQA 1W77A 1QGQA 3TQDA 4ARWA 3PKQA 4NALA 2VD4A 1WT0A 1TW5A 1OMZA 4FRAA 5J49A 4M28A 2YC3A 1VH3A 4NAIA 4Y7GA 2D7RA 1G9RA 1PZTA 4HO3A 2FY7A 2RJ0A 3OC9A 5C38A 2OEGA 4G3PA 1ZCTA 3U2TA 4FRMA 4HO5A 4EE4A 4KT7A 3CKJA 2V0JA 5DDTA 3RMVA 5IDSA 2RJ8A 2JCOA 2RJ4A 2PA4A 3N9WA 1HJLA 4HO4A 4P02A 1R7TA 3T7OA 4EE5A 2XWMA 4B5BA 1G8OA 2AE7A 1R7VA 2FYDB 1LZ0A 2WEEA 2AGDA 1GA8A 1G3LA 2W0VA 3NGWA 3ST8A 2D0JA 4LW6A 3I0FA 4Y7FA 4CVHA 4EVWA 2RIXA 1MP5A 3SX7A 2UX8A 1ZI3A 4C2SA 2V0KA 4GBPA 4FROA 2OEFA 4KC1A 2RJ5A 1VZXA 1INIA 1SS9A 4EEOA 4Y9XA 5IDTA 1NQIB 4XWIA 4G3SA 2YCMA 3V8YA 2WGZA 2ZU8A 2A8UA 2E8BA 3JUKA 1H5RB 2XMHA 2W0WA 3T7NA 1JYKA 3I0LA 5FU0A 4BMAA 2Y4KA 1QWJA 1EYRA 1ZJ0A 3SX3A 1VICA 1I52A 2RJ9A 5C3DA 1IIMA 4L41C 1JV1A 1YROB 1TW1A 3OH1A 4JISA 2BO6A 4HO0A 4EEGA 3DK5A 2I5KA 5JQQA 5IFYA 3RSBA 3Q80A 1R82A 3V90A 2A8WA 3T7MA 1GQ9A 2O1GA 1QGSA 1S4OA 1H7LA 2YQCA 5CMJA 1H3MA 5AJPA 4MYBA 3ZLLA 1ZCVA 3D98A 3BRKX 2I7BA 2GGQA 1ZI4A 2X5ZA 3V91A 2JCJA 5CMFX 4Y7UA 5DDVA 5C3AA 4DECA 2RJ7A 5FV9A 1ZJPA 2XWLA 3U2XA 1FOAA 2YQSA 3OGZA 4FCEA 3PKPA 1VM8A 5FYEA 1H7QA 4Y7VA 5FU8A 4Y63A 1JV3A 1INJA 4D11C 4YS8A 4HO6A 2D7IA 2ZU9A 2BO7A 5EJ1A 4D0ZA 2AECA 4HOCA 1NF5B 2X65A 4FREA 2RITA 2ZU7A 1H7HA 3SXDA 1TZFA 4FRPA 2YESA 2VS4A 3HL3A 1FO8A 1YP2A 2Y4LA 2V0HA 4HO2A 4B4MA 1HM9A 1OMXA 2PGYA 2PGVA 4MNDA 1H7TA 1H7FA 1WVCA 1OQMB 1GX0A 4Y62A 1V82A 1H5TA 2VSHA 1GX4A 3RMWA 5C4FA 5C1HA 1ZIZA 2P72A 3V0QA 2AH9A 1WT3A 3R3IA 1PZYB 3KIAA 5C4EA 2AESA 2OI5A 2VFZA 1IINA 5C36A 4HG6A 3SXAA 4CJBA 2FFUA 4Y7TA 5CMHA 3E25A 2FFVA 3OAMA 2OI7A 5C1LA 1ZI5A 3OH0A 3SX5A 1O7OA 2V0LA 1H7EA 3SPTA 4Y6UA 1V84A 2O1FA 1H5SA 4FCUA 5CQPA 3U0YA 4B42A 2BO4A 1R7XA 2FYAA 4UEGA 2Y4JA 4Y64A 4D0TA 1TVYA 3V0OA 1VPAA 4B2WA 4FRHA 3TZTA 2WVLA 4HO8A 1LZ7A 2YQHA 3K8DA 1FGXA 4CJCA 4M4KA 2RJ6A 3SXBA 3U2WA 1ZCUA 1S4NA 1NHEB 4NAKA 2WE9A 2BO8A 3DJ4A 2MZBA 2VS5A 5C1GA 2E3DA 4Y6NA 5CQOA 4KXOA 5CMGX 3V0NA 3ZLKA 4FRDA 1NMMB 3CKNA 4KRVA 1H4EA 2WVMA 3USRA 2Q4JA 1GWWA 4P00A 1NKHB 1ZJ2A 4KPXA 4M2AA 4D11A 1K4VA 4DDZA 5I1FA 2O1HA 1H4CA 4G87A 3OH3A 1XZ6A 1FR8A 1ZDGA 3D8VA 3V0LA 1O7QA 3BCVA 5FUHA 2NXVA 2Z86A 1ZCYA 4KNXA 5CMIA 5EJZA 1W57A 3SX8A 5BXCA 1O23B 1FXJA 2QH5A 1O0RA 1FWYA 4FRLA 3I0CA 1GWVA 1R7YA 3CKOA 2Y4MA 2Y6PA 3CU0A 4CJ8A 1MP3A 4AC3A 1MC3A 1MP4A 5FTVA 2P73A 4DE7A 4G3QA 3GUEA 1VGZA 5CQMX 4AAWA 4KNRA 1VGWA 1W55A 4K6RA 4ZDQA 4E1KA 2YC5A 1S4PA 1ZJOA 2ICYA 1FRWA 1VGUA 3D5NA 5C47A 2CU2A 2XMEA 1LZJA 5CQLX 5C49A 1FZWA 3ZF8A 5AJOA 2AM4A 1NWGB 3OH4A 4HCQA 4IRPA 4M2BA 3FOQA 4EE3A 4R7PA 3CKVA 1XHBA 3CGXA 4J18A 4D48A 2Y7AA 1H5TB 2OI6A 3JUJA 4JD0A 2FYBA 5L6SA 1ON8A 4LW3A 1G93A 3I0GA 3CKQA 3FWWA 1ZHJA 2PX7A 3IOJA 2RIZA 3POLA 5C48A 2AM5A 3I0DA 3I0EA 3I0HA 5CQNX 1G23A 1H4DA 3PNNA 1QG8A 2AM3A 1G1LA 2VXLA 2QKXA 4FRBA 1WT1A 1JVGA 1G95A 4B3UA 3DUVA 1ZI1A 3SXGA 4B4BA 5L6VA 2VXMA 3SXCA 3R2WA 1FG5N 1WT2A 4B4GA 5C4DA 1VZUA 3I0JA 2RJ1A 3Q4SA 4AYLA 4AYJA 2VSIA 1H5SB 2DPWA 1VH1A 2X5SA 3I0IX 4ASYA 2XWNA 1FXOA 4EEMA
chains in the Genus database with same CATH superfamily
1VZTA 2FYCB 4KC2A 3U2UA 4EEAA 1R7UA 1H7GA 1ZJ1A 3JTJA 3U0XA 1LL3A 2X60A 1FGGA 3QVBA 3V0MA 2APCA 1FR9A 3Q7UA 1JYLA 5EIYA 5C8RA 1R80A 3ZGGA 1H5RA 2P6WA 2V0IA 1YP4A 5FTSA 3EE5A 1LVWA 1LL2A 3IOIA 3OKRA 1ZDFA 1HM8A 1GQCA 4NANA 4IRQA 4O6NA 3O3PA 4ASJA 1H5SD 3I0KA 3SXEA 3V8ZA 1G97A 1R81A 1EZIA 1FO9A 2YQJA 1LL0A 1HJJA 4FIXA 1G0RA 2ICXA 2JCKA 3F1CA 4BQHA 1G2VA 1H5SC 1Z90A 2GGOA 2I5EA 4FQWA 4KC4A 2WVKA 2QGIA 2RIYA 3LW6A 5AJNA 1JVDA 4KQLA 2Z87A 1WSZA 2JCLA 2WAWA 1HV9A 3K8EA 1E5KA 3V0PA 1YP3A 1ZJ3A 3E26A 1VGTA 4ECMA 2VS3A 5HS2A 4B2XA 1LZIA 5C3BA 3IOHA 4HO9A 4KPZA 5C4BA 1HM0A 4FRQA 3ZGFA 3U2VA 3F1YA 1KWSA 1V83A 5C4CA 3OH2A 1ON6A 3USQA 1W77A 1QGQA 3TQDA 4ARWA 3PKQA 4NALA 2VD4A 1WT0A 1TW5A 1OMZA 4FRAA 5J49A 4M28A 2YC3A 4FIYA 1VH3A 4NAIA 4Y7GA 2D7RA 1G9RA 1PZTA 4HO3A 2FY7A 2RJ0A 3OC9A 5C38A 2OEGA 4G3PA 1ZCTA 3U2TA 4FRMA 4HO5A 4EE4A 4KT7A 3CKJA 2V0JA 5DDTA 3RMVA 5IDSA 2RJ8A 2JCOA 2RJ4A 2PA4A 3N9WA 1HJLA 4HO4A 4P02A 1R7TA 3T7OA 4EE5A 2XWMA 4B5BA 1G8OA 2AE7A 1R7VA 2FYDB 1LZ0A 2WEEA 2AGDA 4Q7CA 1GA8A 1G3LA 2W0VA 3NGWA 3ST8A 2D0JA 4LW6A 3I0FA 4Y7FA 4CVHA 4EVWA 2RIXA 1MP5A 3SX7A 2UX8A 1ZI3A 4C2SA 2V0KA 4GBPA 4FROA 2OEFA 4KC1A 2RJ5A 1VZXA 1INIA 1SS9A 4EEOA 4Y9XA 5IDTA 1NQIB 4XWIA 4G3SA 2YCMA 3V8YA 2WGZA 2ZU8A 2A8UA 2E8BA 3JUKA 1H5RB 2XMHA 2W0WA 3T7NA 1JYKA 3I0LA 5FU0A 4BMAA 2Y4KA 1QWJA 1EYRA 1ZJ0A 4O6MA 3SX3A 1VICA 1I52A 2RJ9A 5C3DA 1IIMA 4L41C 1JV1A 1YROB 1TW1A 3OH1A 4JISA 2BO6A 4HO0A 5D91A 4EEGA 3DK5A 2I5KA 5JQQA 5IFYA 3RSBA 3Q80A 1R82A 3V90A 2A8WA 3T7MA 1GQ9A 5D92A 2O1GA 1QGSA 1S4OA 1H7LA 2YQCA 5CMJA 1H3MA 5AJPA 4MYBA 3ZLLA 1ZCVA 3D98A 3BRKX 2I7BA 2GGQA 1ZI4A 2X5ZA 3V91A 2JCJA 5CMFX 4Y7UA 5DDVA 5C3AA 4DECA 2RJ7A 5FV9A 1ZJPA 2XWLA 3U2XA 1FOAA 2YQSA 3OGZA 4FCEA 3PKPA 1VM8A 4MIXA 5FYEA 1H7QA 4Y7VA 5FU8A 4Y63A 1JV3A 1INJA 4D11C 4YS8A 4HO6A 2D7IA 2ZU9A 2BO7A 5EJ1A 4D0ZA 2AECA 4HOCA 2C0NA 1NF5B 2X65A 4FREA 2RITA 2ZU7A 1H7HA 3SXDA 1TZFA 4FRPA 2YESA 2VS4A 3HL3A 1FO8A 1YP2A 2Y4LA 2V0HA 4HO2A 4B4MA 1HM9A 1OMXA 2PGYA 2PGVA 4MNDA 1H7TA 1H7FA 1WVCA 1OQMB 1GX0A 4Y62A 1V82A 1H5TA 2VSHA 1GX4A 3RMWA 5C4FA 5C1HA 1ZIZA 2P72A 3V0QA 2AH9A 1WT3A 3R3IA 1PZYB 3KIAA 5C4EA 2AESA 2OI5A 2VFZA 1IINA 5C36A 4HG6A 3SXAA 4CJBA 2FFUA 4Y7TA 5CMHA 3E25A 2FFVA 3OAMA 2OI7A 5C1LA 1ZI5A 3OH0A 3SX5A 1O7OA 2V0LA 1H7EA 3SPTA 4Y6UA 1V84A 2O1FA 1H5SA 4FCUA 5CQPA 3U0YA 4B42A 2BO4A 1R7XA 2FYAA 4UEGA 2Y4JA 4Y64A 4D0TA 1TVYA 3V0OA 1VPAA 4B2WA 4FRHA 3TZTA 2WVLA 4HO8A 1LZ7A 2YQHA 3K8DA 1FGXA 4CJCA 4M4KA 2RJ6A 3SXBA 3U2WA 1ZCUA 1S4NA 1NHEB 4NAKA 2WE9A 2BO8A 3DJ4A 2MZBA 2VS5A 5C1GA 2E3DA 4Y6NA 5CQOA 4KXOA 5CMGX 3V0NA 3ZLKA 4FRDA 1NMMB 3CKNA 4KRVA 1H4EA 2WVMA 3USRA 2Q4JA 1GWWA 4P00A 1NKHB 1ZJ2A 4KPXA 4M2AA 4D11A 1K4VA 4DDZA 5I1FA 2O1HA 1H4CA 4G87A 3OH3A 1XZ6A 1FR8A 1ZDGA 3D8VA 3V0LA 1O7QA 3BCVA 5FUHA 2NXVA 2Z86A 1ZCYA 4KNXA 5CMIA 5EJZA 1W57A 2J0BA 3SX8A 5BXCA 1O23B 1FXJA 2QH5A 1O0RA 1FWYA 4FRLA 3I0CA 1GWVA 1R7YA 3CKOA 2Y4MA 2Y6PA 3CU0A 4CJ8A 1MP3A 4AC3A 1MC3A 1MP4A 5FTVA 2P73A 4DE7A 4G3QA 3GUEA 1VGZA 5CQMX 4AAWA 4KNRA 1VGWA 1W55A 4K6RA 4ZDQA 4E1KA 2YC5A 1S4PA 1ZJOA 2ICYA 1FRWA 2VK9A 1VGUA 3D5NA 5C47A 2CU2A 2XMEA 1LZJA 5CQLX 5C49A 1FZWA 3ZF8A 5AJOA 2AM4A 1NWGB 3OH4A 4HCQA 4IRPA 4M2BA 3FOQA 4EE3A 4R7PA 3CKVA 1XHBA 3CGXA 4J18A 4D48A 2Y7AA 1H5TB 2OI6A 3JUJA 4JD0A 2FYBA 5L6SA 1ON8A 4LW3A 1G93A 2J0AA 3I0GA 3CKQA 3FWWA 1ZHJA 2PX7A 3IOJA 2RIZA 3POLA 5C48A 2AM5A 3I0DA 3I0EA 3I0HA 5CQNX 1G23A 1H4DA 3PNNA 1QG8A 2AM3A 1G1LA 2VXLA 2QKXA 4FRBA 1WT1A 1JVGA 1G95A 4B3UA 3DUVA 1ZI1A 3SXGA 4B4BA 5L6VA 2VXMA 3SXCA 3R2WA 1FG5N 1WT2A 4B4GA 5C4DA 1VZUA 3I0JA 2RJ1A 3Q4SA 4AYLA 4AYJA 2VSIA 1H5SB 2DPWA 1VH1A 2X5SA 3I0IX 4ASYA 2XWNA 1FXOA 4EEMA
chains in the Genus database with same CATH topology
1VZTA 2FYCB 4KC2A 3U2UA 4EEAA 1R7UA 1H7GA 1ZJ1A 3JTJA 3U0XA 1LL3A 2X60A 1FGGA 3QVBA 3V0MA 2APCA 1FR9A 3Q7UA 1JYLA 5EIYA 5C8RA 1R80A 3ZGGA 1H5RA 2P6WA 2V0IA 1YP4A 5FTSA 3EE5A 1LVWA 1LL2A 3IOIA 3OKRA 1ZDFA 1HM8A 1GQCA 4NANA 4IRQA 4O6NA 3O3PA 4ASJA 1H5SD 3I0KA 3SXEA 3V8ZA 1G97A 1R81A 1EZIA 1FO9A 2YQJA 1LL0A 1HJJA 4FIXA 1G0RA 2ICXA 2JCKA 3F1CA 4BQHA 1G2VA 1H5SC 1Z90A 2GGOA 2I5EA 4FQWA 4KC4A 2WVKA 2QGIA 2RIYA 3LW6A 5AJNA 1JVDA 4KQLA 2Z87A 1WSZA 2JCLA 2WAWA 1HV9A 3K8EA 1E5KA 3V0PA 1YP3A 1ZJ3A 3E26A 1VGTA 4ECMA 2VS3A 5HS2A 4B2XA 1LZIA 5C3BA 3IOHA 4HO9A 4KPZA 5C4BA 1HM0A 4FRQA 3ZGFA 3U2VA 3F1YA 1KWSA 1V83A 5C4CA 3OH2A 1ON6A 3USQA 1W77A 1QGQA 3TQDA 4ARWA 3PKQA 4NALA 2VD4A 1WT0A 1TW5A 1OMZA 4FRAA 5J49A 4M28A 2YC3A 4FIYA 1VH3A 4NAIA 4Y7GA 2D7RA 1G9RA 1PZTA 4HO3A 2FY7A 2RJ0A 3OC9A 5C38A 2OEGA 4G3PA 1ZCTA 3U2TA 4FRMA 4HO5A 4EE4A 4KT7A 3CKJA 2V0JA 5DDTA 3RMVA 5IDSA 2RJ8A 2JCOA 2RJ4A 2PA4A 3N9WA 1HJLA 4HO4A 4P02A 1R7TA 3T7OA 4EE5A 2XWMA 4B5BA 1G8OA 2AE7A 1R7VA 2FYDB 1LZ0A 2WEEA 2AGDA 4Q7CA 1GA8A 1G3LA 2W0VA 3NGWA 3ST8A 2D0JA 4LW6A 3I0FA 4Y7FA 4CVHA 4EVWA 2RIXA 1MP5A 3SX7A 2UX8A 1ZI3A 4C2SA 2V0KA 4GBPA 4FROA 2OEFA 4KC1A 2RJ5A 1VZXA 1INIA 1SS9A 4EEOA 4Y9XA 5IDTA 1NQIB 4XWIA 4G3SA 2YCMA 3V8YA 2WGZA 2ZU8A 2A8UA 2E8BA 3JUKA 1H5RB 2XMHA 2W0WA 3T7NA 1JYKA 3I0LA 5FU0A 4BMAA 2Y4KA 1QWJA 1EYRA 1ZJ0A 4O6MA 3SX3A 1VICA 1I52A 2RJ9A 5C3DA 1IIMA 4L41C 1JV1A 1YROB 1TW1A 3OH1A 4JISA 2BO6A 4HO0A 5D91A 4EEGA 3DK5A 2I5KA 5JQQA 5IFYA 3RSBA 3Q80A 1R82A 3V90A 2A8WA 3T7MA 1GQ9A 5D92A 2O1GA 1QGSA 1S4OA 1H7LA 2YQCA 5CMJA 1H3MA 5AJPA 4MYBA 3ZLLA 1ZCVA 3D98A 3BRKX 2I7BA 2GGQA 1ZI4A 2X5ZA 3V91A 2JCJA 5CMFX 4Y7UA 5DDVA 5C3AA 4DECA 2RJ7A 5FV9A 1ZJPA 2XWLA 3U2XA 1FOAA 2YQSA 3OGZA 4FCEA 3PKPA 1VM8A 4MIXA 5FYEA 1H7QA 4Y7VA 5FU8A 4Y63A 1JV3A 1INJA 4D11C 4YS8A 4HO6A 2D7IA 2ZU9A 2BO7A 5EJ1A 4D0ZA 2AECA 4HOCA 2C0NA 1NF5B 2X65A 4FREA 2RITA 2ZU7A 1H7HA 3SXDA 1TZFA 4FRPA 2YESA 2VS4A 3HL3A 1FO8A 1YP2A 2Y4LA 2V0HA 4HO2A 4B4MA 1HM9A 1OMXA 2PGYA 2PGVA 4MNDA 1H7TA 1H7FA 1WVCA 1OQMB 1GX0A 4Y62A 1V82A 1H5TA 2VSHA 1GX4A 3RMWA 5C4FA 5C1HA 1ZIZA 2P72A 3V0QA 2AH9A 1WT3A 3R3IA 1PZYB 3KIAA 5C4EA 2AESA 2OI5A 2VFZA 1IINA 5C36A 4HG6A 3SXAA 4CJBA 2FFUA 4Y7TA 5CMHA 3E25A 2FFVA 3OAMA 2OI7A 5C1LA 1ZI5A 3OH0A 3SX5A 1O7OA 2V0LA 1H7EA 3SPTA 4Y6UA 1V84A 2O1FA 1H5SA 4FCUA 5CQPA 3U0YA 4B42A 2BO4A 1R7XA 2FYAA 4UEGA 2Y4JA 4Y64A 4D0TA 1TVYA 3V0OA 1VPAA 4B2WA 4FRHA 3TZTA 2WVLA 4HO8A 1LZ7A 2YQHA 3K8DA 1FGXA 4CJCA 4M4KA 2RJ6A 3SXBA 3U2WA 1ZCUA 1S4NA 1NHEB 4NAKA 2WE9A 2BO8A 3DJ4A 2MZBA 2VS5A 5C1GA 2E3DA 4Y6NA 5CQOA 4KXOA 5CMGX 3V0NA 3ZLKA 4FRDA 1NMMB 3CKNA 4KRVA 1H4EA 2WVMA 3USRA 2Q4JA 1GWWA 4P00A 1NKHB 1ZJ2A 4KPXA 4M2AA 4D11A 1K4VA 4DDZA 5I1FA 2O1HA 1H4CA 4G87A 3OH3A 1XZ6A 1FR8A 1ZDGA 3D8VA 3V0LA 1O7QA 3BCVA 5FUHA 2NXVA 2Z86A 1ZCYA 4KNXA 5CMIA 5EJZA 1W57A 2J0BA 3SX8A 5BXCA 1O23B 1FXJA 2QH5A 1O0RA 1FWYA 4FRLA 3I0CA 1GWVA 1R7YA 3CKOA 2Y4MA 2Y6PA 3CU0A 4CJ8A 1MP3A 4AC3A 1MC3A 1MP4A 5FTVA 2P73A 4DE7A 4G3QA 3GUEA 1VGZA 5CQMX 4AAWA 4KNRA 1VGWA 1W55A 4K6RA 4ZDQA 4E1KA 2YC5A 1S4PA 1ZJOA 2ICYA 1FRWA 2VK9A 1VGUA 3D5NA 5C47A 2CU2A 2XMEA 1LZJA 5CQLX 5C49A 1FZWA 3ZF8A 5AJOA 2AM4A 1NWGB 3OH4A 4HCQA 4IRPA 4M2BA 3FOQA 4EE3A 4R7PA 3CKVA 1XHBA 3CGXA 4J18A 4D48A 2Y7AA 1H5TB 2OI6A 3JUJA 4JD0A 2FYBA 5L6SA 1ON8A 4LW3A 1G93A 2J0AA 3I0GA 3CKQA 3FWWA 1ZHJA 2PX7A 3IOJA 2RIZA 3POLA 5C48A 2AM5A 3I0DA 3I0EA 3I0HA 5CQNX 1G23A 1H4DA 3PNNA 1QG8A 2AM3A 1G1LA 2VXLA 2QKXA 4FRBA 1WT1A 1JVGA 1G95A 4B3UA 3DUVA 1ZI1A 3SXGA 4B4BA 5L6VA 2VXMA 3SXCA 3R2WA 1FG5N 1WT2A 4B4GA 5C4DA 1VZUA 3I0JA 2RJ1A 3Q4SA 4AYLA 4AYJA 2VSIA 1H5SB 2DPWA 1VH1A 2X5SA 3I0IX 4ASYA 2XWNA 1FXOA 4EEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZT A;  2FYC B;  4KC2 A;  3U2U A;  4EEA A;  1R7U A;  1H7G A;  1ZJ1 A;  3JTJ A;  3U0X A;  1LL3 A;  2X60 A;  1FGG A;  3QVB A;  3V0M A;  2APC A;  1FR9 A;  3Q7U A;  1JYL A;  5EIY A;  5C8R A;  1R80 A;  3ZGG A;  1H5R A;  2P6W A;  2V0I A;  1YP4 A;  5FTS A;  3EE5 A;  1LVW A;  1LL2 A;  3IOI A;  3OKR A;  1ZDF A;  1HM8 A;  1GQC A;  4NAN A;  4IRQ A;  3O3P A;  4ASJ A;  1H5S D;  3I0K A;  3SXE A;  3V8Z A;  1G97 A;  1R81 A;  1EZI A;  1FO9 A;  2YQJ A;  1LL0 A;  1HJJ A;  1G0R A;  2ICX A;  2JCK A;  3F1C A;  4BQH A;  1G2V A;  1H5S C;  1Z90 A;  2GGO A;  2I5E A;  4FQW A;  4KC4 A;  2WVK A;  2QGI A;  2RIY A;  3LW6 A;  5AJN A;  1JVD A;  4KQL A;  2Z87 A;  1WSZ A;  2JCL A;  2WAW A;  1HV9 A;  3K8E A;  1E5K A;  3V0P A;  1YP3 A;  1ZJ3 A;  3E26 A;  1VGT A;  4ECM A;  2VS3 A;  5HS2 A;  4B2X A;  1LZI A;  5C3B A;  3IOH A;  4HO9 A;  4KPZ A;  5C4B A;  1HM0 A;  4FRQ A;  3ZGF A;  3U2V A;  3F1Y A;  1KWS A;  1V83 A;  5C4C A;  3OH2 A;  1ON6 A;  3USQ A;  1W77 A;  1QGQ A;  3TQD A;  4ARW A;  3PKQ A;  4NAL A;  2VD4 A;  1WT0 A;  1TW5 A;  1OMZ A;  4FRA A;  5J49 A;  4M28 A;  2YC3 A;  1VH3 A;  4NAI A;  4Y7G A;  2D7R A;  1G9R A;  1PZT A;  4HO3 A;  2FY7 A;  2RJ0 A;  3OC9 A;  5C38 A;  2OEG A;  4G3P A;  1ZCT A;  3U2T A;  4FRM A;  4HO5 A;  4EE4 A;  4KT7 A;  3CKJ A;  2V0J A;  5DDT A;  3RMV A;  5IDS A;  2RJ8 A;  2JCO A;  2RJ4 A;  2PA4 A;  3N9W A;  1HJL A;  4HO4 A;  4P02 A;  1R7T A;  3T7O A;  4EE5 A;  2XWM A;  4B5B A;  1G8O A;  2AE7 A;  1R7V A;  2FYD B;  1LZ0 A;  2WEE A;  2AGD A;  1GA8 A;  1G3L A;  2W0V A;  3NGW A;  3ST8 A;  2D0J A;  4LW6 A;  3I0F A;  4Y7F A;  4CVH A;  4EVW A;  2RIX A;  1MP5 A;  3SX7 A;  2UX8 A;  1ZI3 A;  4C2S A;  2V0K A;  4GBP A;  4FRO A;  2OEF A;  4KC1 A;  2RJ5 A;  1VZX A;  1INI A;  1SS9 A;  4EEO A;  4Y9X A;  5IDT A;  1NQI B;  4XWI A;  4G3S A;  2YCM A;  3V8Y A;  2WGZ A;  2ZU8 A;  2A8U A;  2E8B A;  3JUK A;  1H5R B;  2XMH A;  2W0W A;  3T7N A;  1JYK A;  3I0L A;  5FU0 A;  4BMA A;  2Y4K A;  1QWJ A;  1EYR A;  1ZJ0 A;  3SX3 A;  1VIC A;  1I52 A;  2RJ9 A;  5C3D A;  1IIM A;  4L41 C;  1JV1 A;  1YRO B;  1TW1 A;  3OH1 A;  4JIS A;  2BO6 A;  4HO0 A;  4EEG A;  3DK5 A;  2I5K A;  5JQQ A;  5IFY A;  3RSB A;  3Q80 A;  1R82 A;  3V90 A;  2A8W A;  3T7M A;  1GQ9 A;  2O1G A;  1QGS A;  1S4O A;  1H7L A;  2YQC A;  5CMJ A;  1H3M A;  5AJP A;  4MYB A;  3ZLL A;  1ZCV A;  3D98 A;  3BRK X;  2I7B A;  2GGQ A;  1ZI4 A;  2X5Z A;  3V91 A;  2JCJ A;  5CMF X;  4Y7U A;  5DDV A;  5C3A A;  4DEC A;  2RJ7 A;  5FV9 A;  1ZJP A;  2XWL A;  3U2X A;  1FOA A;  2YQS A;  3OGZ A;  4FCE A;  3PKP A;  1VM8 A;  5FYE A;  1H7Q A;  4Y7V A;  5FU8 A;  4Y63 A;  1JV3 A;  1INJ A;  4D11 C;  4YS8 A;  4HO6 A;  2D7I A;  2ZU9 A;  2BO7 A;  5EJ1 A;  4D0Z A;  2AEC A;  4HOC A;  1NF5 B;  2X65 A;  4FRE A;  2RIT A;  2ZU7 A;  1H7H A;  3SXD A;  1TZF A;  4FRP A;  2YES A;  2VS4 A;  3HL3 A;  1FO8 A;  1YP2 A;  2Y4L A;  2V0H A;  4HO2 A;  4B4M A;  1HM9 A;  1OMX A;  2PGY A;  2PGV A;  4MND A;  1H7T A;  1H7F A;  1WVC A;  1OQM B;  1GX0 A;  4Y62 A;  1V82 A;  1H5T A;  2VSH A;  1GX4 A;  3RMW A;  5C4F A;  5C1H A;  1ZIZ A;  2P72 A;  3V0Q A;  2AH9 A;  1WT3 A;  3R3I A;  1PZY B;  3KIA A;  5C4E A;  2AES A;  2OI5 A;  2VFZ A;  1IIN A;  5C36 A;  4HG6 A;  3SXA A;  4CJB A;  2FFU A;  4Y7T A;  5CMH A;  3E25 A;  2FFV A;  3OAM A;  2OI7 A;  5C1L A;  1ZI5 A;  3OH0 A;  3SX5 A;  1O7O A;  2V0L A;  1H7E A;  3SPT A;  4Y6U A;  1V84 A;  2O1F A;  1H5S A;  4FCU A;  5CQP A;  3U0Y A;  4B42 A;  2BO4 A;  1R7X A;  2FYA A;  4UEG A;  2Y4J A;  4Y64 A;  4D0T A;  1TVY A;  3V0O A;  1VPA A;  4B2W A;  4FRH A;  3TZT A;  2WVL A;  4HO8 A;  1LZ7 A;  2YQH A;  3K8D A;  1FGX A;  4CJC A;  4M4K A;  2RJ6 A;  3SXB A;  3U2W A;  1ZCU A;  1S4N A;  1NHE B;  4NAK A;  2WE9 A;  2BO8 A;  3DJ4 A;  2MZB A;  2VS5 A;  5C1G A;  2E3D A;  4Y6N A;  5CQO A;  4KXO A;  5CMG X;  3V0N A;  3ZLK A;  4FRD A;  1NMM B;  3CKN A;  4KRV A;  1H4E A;  2WVM A;  3USR A;  2Q4J A;  1GWW A;  4P00 A;  1NKH B;  1ZJ2 A;  4KPX A;  4M2A A;  4D11 A;  1K4V A;  4DDZ A;  5I1F A;  2O1H A;  1H4C A;  4G87 A;  3OH3 A;  1XZ6 A;  1FR8 A;  1ZDG A;  3D8V A;  3V0L A;  1O7Q A;  3BCV A;  5FUH A;  2NXV A;  2Z86 A;  1ZCY A;  4KNX A;  5CMI A;  5EJZ A;  1W57 A;  3SX8 A;  5BXC A;  1O23 B;  1FXJ A;  2QH5 A;  1O0R A;  1FWY A;  4FRL A;  3I0C A;  1GWV A;  1R7Y A;  3CKO A;  2Y4M A;  2Y6P A;  3CU0 A;  4CJ8 A;  1MP3 A;  4AC3 A;  1MC3 A;  1MP4 A;  5FTV A;  2P73 A;  4DE7 A;  4G3Q A;  3GUE A;  1VGZ A;  5CQM X;  4AAW A;  4KNR A;  1VGW A;  1W55 A;  4K6R A;  4ZDQ A;  4E1K A;  2YC5 A;  1S4P A;  1ZJO A;  2ICY A;  1FRW A;  1VGU A;  3D5N A;  5C47 A;  2CU2 A;  2XME A;  1LZJ A;  5CQL X;  5C49 A;  1FZW A;  3ZF8 A;  5AJO A;  2AM4 A;  1NWG B;  3OH4 A;  4HCQ A;  4IRP A;  4M2B A;  3FOQ A;  4EE3 A;  4R7P A;  3CKV A;  1XHB A;  3CGX A;  4J18 A;  4D48 A;  2Y7A A;  1H5T B;  2OI6 A;  3JUJ A;  4JD0 A;  2FYB A;  5L6S A;  1ON8 A;  4LW3 A;  1G93 A;  3I0G A;  3CKQ A;  3FWW A;  1ZHJ A;  2PX7 A;  3IOJ A;  2RIZ A;  3POL A;  5C48 A;  2AM5 A;  3I0D A;  3I0E A;  3I0H A;  5CQN X;  1G23 A;  1H4D A;  3PNN A;  1QG8 A;  2AM3 A;  1G1L A;  2VXL A;  2QKX A;  4FRB A;  1WT1 A;  1JVG A;  1G95 A;  4B3U A;  3DUV A;  1ZI1 A;  3SXG A;  4B4B A;  5L6V A;  2VXM A;  3SXC A;  3R2W A;  1FG5 N;  1WT2 A;  4B4G A;  5C4D A;  1VZU A;  3I0J A;  2RJ1 A;  3Q4S A;  4AYL A;  4AYJ A;  2VSI A;  1H5S B;  2DPW A;  1VH1 A;  2X5S A;  3I0I X;  4ASY A;  2XWN A;  1FXO A;  4EEM A; 
#chains in the Genus database with same CATH topology
 1VZT A;  2FYC B;  4KC2 A;  3U2U A;  4EEA A;  1R7U A;  1H7G A;  1ZJ1 A;  3JTJ A;  3U0X A;  1LL3 A;  2X60 A;  1FGG A;  3QVB A;  3V0M A;  2APC A;  1FR9 A;  3Q7U A;  1JYL A;  5EIY A;  5C8R A;  1R80 A;  3ZGG A;  1H5R A;  2P6W A;  2V0I A;  1YP4 A;  5FTS A;  3EE5 A;  1LVW A;  1LL2 A;  3IOI A;  3OKR A;  1ZDF A;  1HM8 A;  1GQC A;  4NAN A;  4IRQ A;  4O6N A;  3O3P A;  4ASJ A;  1H5S D;  3I0K A;  3SXE A;  3V8Z A;  1G97 A;  1R81 A;  1EZI A;  1FO9 A;  2YQJ A;  1LL0 A;  1HJJ A;  4FIX A;  1G0R A;  2ICX A;  2JCK A;  3F1C A;  4BQH A;  1G2V A;  1H5S C;  1Z90 A;  2GGO A;  2I5E A;  4FQW A;  4KC4 A;  2WVK A;  2QGI A;  2RIY A;  3LW6 A;  5AJN A;  1JVD A;  4KQL A;  2Z87 A;  1WSZ A;  2JCL A;  2WAW A;  1HV9 A;  3K8E A;  1E5K A;  3V0P A;  1YP3 A;  1ZJ3 A;  3E26 A;  1VGT A;  4ECM A;  2VS3 A;  5HS2 A;  4B2X A;  1LZI A;  5C3B A;  3IOH A;  4HO9 A;  4KPZ A;  5C4B A;  1HM0 A;  4FRQ A;  3ZGF A;  3U2V A;  3F1Y A;  1KWS A;  1V83 A;  5C4C A;  3OH2 A;  1ON6 A;  3USQ A;  1W77 A;  1QGQ A;  3TQD A;  4ARW A;  3PKQ A;  4NAL A;  2VD4 A;  1WT0 A;  1TW5 A;  1OMZ A;  4FRA A;  5J49 A;  4M28 A;  2YC3 A;  4FIY A;  1VH3 A;  4NAI A;  4Y7G A;  2D7R A;  1G9R A;  1PZT A;  4HO3 A;  2FY7 A;  2RJ0 A;  3OC9 A;  5C38 A;  2OEG A;  4G3P A;  1ZCT A;  3U2T A;  4FRM A;  4HO5 A;  4EE4 A;  4KT7 A;  3CKJ A;  2V0J A;  5DDT A;  3RMV A;  5IDS A;  2RJ8 A;  2JCO A;  2RJ4 A;  2PA4 A;  3N9W A;  1HJL A;  4HO4 A;  4P02 A;  1R7T A;  3T7O A;  4EE5 A;  2XWM A;  4B5B A;  1G8O A;  2AE7 A;  1R7V A;  2FYD B;  1LZ0 A;  2WEE A;  2AGD A;  4Q7C A;  1GA8 A;  1G3L A;  2W0V A;  3NGW A;  3ST8 A;  2D0J A;  4LW6 A;  3I0F A;  4Y7F A;  4CVH A;  4EVW A;  2RIX A;  1MP5 A;  3SX7 A;  2UX8 A;  1ZI3 A;  4C2S A;  2V0K A;  4GBP A;  4FRO A;  2OEF A;  4KC1 A;  2RJ5 A;  1VZX A;  1INI A;  1SS9 A;  4EEO A;  4Y9X A;  5IDT A;  1NQI B;  4XWI A;  4G3S A;  2YCM A;  3V8Y A;  2WGZ A;  2ZU8 A;  2A8U A;  2E8B A;  3JUK A;  1H5R B;  2XMH A;  2W0W A;  3T7N A;  1JYK A;  3I0L A;  5FU0 A;  4BMA A;  2Y4K A;  1QWJ A;  1EYR A;  1ZJ0 A;  4O6M A;  3SX3 A;  1VIC A;  1I52 A;  2RJ9 A;  5C3D A;  1IIM A;  4L41 C;  1JV1 A;  1YRO B;  1TW1 A;  3OH1 A;  4JIS A;  2BO6 A;  4HO0 A;  5D91 A;  4EEG A;  3DK5 A;  2I5K A;  5JQQ A;  5IFY A;  3RSB A;  3Q80 A;  1R82 A;  3V90 A;  2A8W A;  3T7M A;  1GQ9 A;  5D92 A;  2O1G A;  1QGS A;  1S4O A;  1H7L A;  2YQC A;  5CMJ A;  1H3M A;  5AJP A;  4MYB A;  3ZLL A;  1ZCV A;  3D98 A;  3BRK X;  2I7B A;  2GGQ A;  1ZI4 A;  2X5Z A;  3V91 A;  2JCJ A;  5CMF X;  4Y7U A;  5DDV A;  5C3A A;  4DEC A;  2RJ7 A;  5FV9 A;  1ZJP A;  2XWL A;  3U2X A;  1FOA A;  2YQS A;  3OGZ A;  4FCE A;  3PKP A;  1VM8 A;  4MIX A;  5FYE A;  1H7Q A;  4Y7V A;  5FU8 A;  4Y63 A;  1JV3 A;  1INJ A;  4D11 C;  4YS8 A;  4HO6 A;  2D7I A;  2ZU9 A;  2BO7 A;  5EJ1 A;  4D0Z A;  2AEC A;  4HOC A;  2C0N A;  1NF5 B;  2X65 A;  4FRE A;  2RIT A;  2ZU7 A;  1H7H A;  3SXD A;  1TZF A;  4FRP A;  2YES A;  2VS4 A;  3HL3 A;  1FO8 A;  1YP2 A;  2Y4L A;  2V0H A;  4HO2 A;  4B4M A;  1HM9 A;  1OMX A;  2PGY A;  2PGV A;  4MND A;  1H7T A;  1H7F A;  1WVC A;  1OQM B;  1GX0 A;  4Y62 A;  1V82 A;  1H5T A;  2VSH A;  1GX4 A;  3RMW A;  5C4F A;  5C1H A;  1ZIZ A;  2P72 A;  3V0Q A;  2AH9 A;  1WT3 A;  3R3I A;  1PZY B;  3KIA A;  5C4E A;  2AES A;  2OI5 A;  2VFZ A;  1IIN A;  5C36 A;  4HG6 A;  3SXA A;  4CJB A;  2FFU A;  4Y7T A;  5CMH A;  3E25 A;  2FFV A;  3OAM A;  2OI7 A;  5C1L A;  1ZI5 A;  3OH0 A;  3SX5 A;  1O7O A;  2V0L A;  1H7E A;  3SPT A;  4Y6U A;  1V84 A;  2O1F A;  1H5S A;  4FCU A;  5CQP A;  3U0Y A;  4B42 A;  2BO4 A;  1R7X A;  2FYA A;  4UEG A;  2Y4J A;  4Y64 A;  4D0T A;  1TVY A;  3V0O A;  1VPA A;  4B2W A;  4FRH A;  3TZT A;  2WVL A;  4HO8 A;  1LZ7 A;  2YQH A;  3K8D A;  1FGX A;  4CJC A;  4M4K A;  2RJ6 A;  3SXB A;  3U2W A;  1ZCU A;  1S4N A;  1NHE B;  4NAK A;  2WE9 A;  2BO8 A;  3DJ4 A;  2MZB A;  2VS5 A;  5C1G A;  2E3D A;  4Y6N A;  5CQO A;  4KXO A;  5CMG X;  3V0N A;  3ZLK A;  4FRD A;  1NMM B;  3CKN A;  4KRV A;  1H4E A;  2WVM A;  3USR A;  2Q4J A;  1GWW A;  4P00 A;  1NKH B;  1ZJ2 A;  4KPX A;  4M2A A;  4D11 A;  1K4V A;  4DDZ A;  5I1F A;  2O1H A;  1H4C A;  4G87 A;  3OH3 A;  1XZ6 A;  1FR8 A;  1ZDG A;  3D8V A;  3V0L A;  1O7Q A;  3BCV A;  5FUH A;  2NXV A;  2Z86 A;  1ZCY A;  4KNX A;  5CMI A;  5EJZ A;  1W57 A;  2J0B A;  3SX8 A;  5BXC A;  1O23 B;  1FXJ A;  2QH5 A;  1O0R A;  1FWY A;  4FRL A;  3I0C A;  1GWV A;  1R7Y A;  3CKO A;  2Y4M A;  2Y6P A;  3CU0 A;  4CJ8 A;  1MP3 A;  4AC3 A;  1MC3 A;  1MP4 A;  5FTV A;  2P73 A;  4DE7 A;  4G3Q A;  3GUE A;  1VGZ A;  5CQM X;  4AAW A;  4KNR A;  1VGW A;  1W55 A;  4K6R A;  4ZDQ A;  4E1K A;  2YC5 A;  1S4P A;  1ZJO A;  2ICY A;  1FRW A;  2VK9 A;  1VGU A;  3D5N A;  5C47 A;  2CU2 A;  2XME A;  1LZJ A;  5CQL X;  5C49 A;  1FZW A;  3ZF8 A;  5AJO A;  2AM4 A;  1NWG B;  3OH4 A;  4HCQ A;  4IRP A;  4M2B A;  3FOQ A;  4EE3 A;  4R7P A;  3CKV A;  1XHB A;  3CGX A;  4J18 A;  4D48 A;  2Y7A A;  1H5T B;  2OI6 A;  3JUJ A;  4JD0 A;  2FYB A;  5L6S A;  1ON8 A;  4LW3 A;  1G93 A;  2J0A A;  3I0G A;  3CKQ A;  3FWW A;  1ZHJ A;  2PX7 A;  3IOJ A;  2RIZ A;  3POL A;  5C48 A;  2AM5 A;  3I0D A;  3I0E A;  3I0H A;  5CQN X;  1G23 A;  1H4D A;  3PNN A;  1QG8 A;  2AM3 A;  1G1L A;  2VXL A;  2QKX A;  4FRB A;  1WT1 A;  1JVG A;  1G95 A;  4B3U A;  3DUV A;  1ZI1 A;  3SXG A;  4B4B A;  5L6V A;  2VXM A;  3SXC A;  3R2W A;  1FG5 N;  1WT2 A;  4B4G A;  5C4D A;  1VZU A;  3I0J A;  2RJ1 A;  3Q4S A;  4AYL A;  4AYJ A;  2VSI A;  1H5S B;  2DPW A;  1VH1 A;  2X5S A;  3I0I X;  4ASY A;  2XWN A;  1FXO A;  4EEM A; 
#chains in the Genus database with same CATH homology
 1VZT A;  2FYC B;  4KC2 A;  3U2U A;  4EEA A;  1R7U A;  1H7G A;  1ZJ1 A;  3JTJ A;  3U0X A;  1LL3 A;  2X60 A;  1FGG A;  3QVB A;  3V0M A;  2APC A;  1FR9 A;  3Q7U A;  1JYL A;  5EIY A;  5C8R A;  1R80 A;  3ZGG A;  1H5R A;  2P6W A;  2V0I A;  1YP4 A;  5FTS A;  3EE5 A;  1LVW A;  1LL2 A;  3IOI A;  3OKR A;  1ZDF A;  1HM8 A;  1GQC A;  4NAN A;  4IRQ A;  4O6N A;  3O3P A;  4ASJ A;  1H5S D;  3I0K A;  3SXE A;  3V8Z A;  1G97 A;  1R81 A;  1EZI A;  1FO9 A;  2YQJ A;  1LL0 A;  1HJJ A;  4FIX A;  1G0R A;  2ICX A;  2JCK A;  3F1C A;  4BQH A;  1G2V A;  1H5S C;  1Z90 A;  2GGO A;  2I5E A;  4FQW A;  4KC4 A;  2WVK A;  2QGI A;  2RIY A;  3LW6 A;  5AJN A;  1JVD A;  4KQL A;  2Z87 A;  1WSZ A;  2JCL A;  2WAW A;  1HV9 A;  3K8E A;  1E5K A;  3V0P A;  1YP3 A;  1ZJ3 A;  3E26 A;  1VGT A;  4ECM A;  2VS3 A;  5HS2 A;  4B2X A;  1LZI A;  5C3B A;  3IOH A;  4HO9 A;  4KPZ A;  5C4B A;  1HM0 A;  4FRQ A;  3ZGF A;  3U2V A;  3F1Y A;  1KWS A;  1V83 A;  5C4C A;  3OH2 A;  1ON6 A;  3USQ A;  1W77 A;  1QGQ A;  3TQD A;  4ARW A;  3PKQ A;  4NAL A;  2VD4 A;  1WT0 A;  1TW5 A;  1OMZ A;  4FRA A;  5J49 A;  4M28 A;  2YC3 A;  4FIY A;  1VH3 A;  4NAI A;  4Y7G A;  2D7R A;  1G9R A;  1PZT A;  4HO3 A;  2FY7 A;  2RJ0 A;  3OC9 A;  5C38 A;  2OEG A;  4G3P A;  1ZCT A;  3U2T A;  4FRM A;  4HO5 A;  4EE4 A;  4KT7 A;  3CKJ A;  2V0J A;  5DDT A;  3RMV A;  5IDS A;  2RJ8 A;  2JCO A;  2RJ4 A;  2PA4 A;  3N9W A;  1HJL A;  4HO4 A;  4P02 A;  1R7T A;  3T7O A;  4EE5 A;  2XWM A;  4B5B A;  1G8O A;  2AE7 A;  1R7V A;  2FYD B;  1LZ0 A;  2WEE A;  2AGD A;  4Q7C A;  1GA8 A;  1G3L A;  2W0V A;  3NGW A;  3ST8 A;  2D0J A;  4LW6 A;  3I0F A;  4Y7F A;  4CVH A;  4EVW A;  2RIX A;  1MP5 A;  3SX7 A;  2UX8 A;  1ZI3 A;  4C2S A;  2V0K A;  4GBP A;  4FRO A;  2OEF A;  4KC1 A;  2RJ5 A;  1VZX A;  1INI A;  1SS9 A;  4EEO A;  4Y9X A;  5IDT A;  1NQI B;  4XWI A;  4G3S A;  2YCM A;  3V8Y A;  2WGZ A;  2ZU8 A;  2A8U A;  2E8B A;  3JUK A;  1H5R B;  2XMH A;  2W0W A;  3T7N A;  1JYK A;  3I0L A;  5FU0 A;  4BMA A;  2Y4K A;  1QWJ A;  1EYR A;  1ZJ0 A;  4O6M A;  3SX3 A;  1VIC A;  1I52 A;  2RJ9 A;  5C3D A;  1IIM A;  4L41 C;  1JV1 A;  1YRO B;  1TW1 A;  3OH1 A;  4JIS A;  2BO6 A;  4HO0 A;  5D91 A;  4EEG A;  3DK5 A;  2I5K A;  5JQQ A;  5IFY A;  3RSB A;  3Q80 A;  1R82 A;  3V90 A;  2A8W A;  3T7M A;  1GQ9 A;  5D92 A;  2O1G A;  1QGS A;  1S4O A;  1H7L A;  2YQC A;  5CMJ A;  1H3M A;  5AJP A;  4MYB A;  3ZLL A;  1ZCV A;  3D98 A;  3BRK X;  2I7B A;  2GGQ A;  1ZI4 A;  2X5Z A;  3V91 A;  2JCJ A;  5CMF X;  4Y7U A;  5DDV A;  5C3A A;  4DEC A;  2RJ7 A;  5FV9 A;  1ZJP A;  2XWL A;  3U2X A;  1FOA A;  2YQS A;  3OGZ A;  4FCE A;  3PKP A;  1VM8 A;  4MIX A;  5FYE A;  1H7Q A;  4Y7V A;  5FU8 A;  4Y63 A;  1JV3 A;  1INJ A;  4D11 C;  4YS8 A;  4HO6 A;  2D7I A;  2ZU9 A;  2BO7 A;  5EJ1 A;  4D0Z A;  2AEC A;  4HOC A;  2C0N A;  1NF5 B;  2X65 A;  4FRE A;  2RIT A;  2ZU7 A;  1H7H A;  3SXD A;  1TZF A;  4FRP A;  2YES A;  2VS4 A;  3HL3 A;  1FO8 A;  1YP2 A;  2Y4L A;  2V0H A;  4HO2 A;  4B4M A;  1HM9 A;  1OMX A;  2PGY A;  2PGV A;  4MND A;  1H7T A;  1H7F A;  1WVC A;  1OQM B;  1GX0 A;  4Y62 A;  1V82 A;  1H5T A;  2VSH A;  1GX4 A;  3RMW A;  5C4F A;  5C1H A;  1ZIZ A;  2P72 A;  3V0Q A;  2AH9 A;  1WT3 A;  3R3I A;  1PZY B;  3KIA A;  5C4E A;  2AES A;  2OI5 A;  2VFZ A;  1IIN A;  5C36 A;  4HG6 A;  3SXA A;  4CJB A;  2FFU A;  4Y7T A;  5CMH A;  3E25 A;  2FFV A;  3OAM A;  2OI7 A;  5C1L A;  1ZI5 A;  3OH0 A;  3SX5 A;  1O7O A;  2V0L A;  1H7E A;  3SPT A;  4Y6U A;  1V84 A;  2O1F A;  1H5S A;  4FCU A;  5CQP A;  3U0Y A;  4B42 A;  2BO4 A;  1R7X A;  2FYA A;  4UEG A;  2Y4J A;  4Y64 A;  4D0T A;  1TVY A;  3V0O A;  1VPA A;  4B2W A;  4FRH A;  3TZT A;  2WVL A;  4HO8 A;  1LZ7 A;  2YQH A;  3K8D A;  1FGX A;  4CJC A;  4M4K A;  2RJ6 A;  3SXB A;  3U2W A;  1ZCU A;  1S4N A;  1NHE B;  4NAK A;  2WE9 A;  2BO8 A;  3DJ4 A;  2MZB A;  2VS5 A;  5C1G A;  2E3D A;  4Y6N A;  5CQO A;  4KXO A;  5CMG X;  3V0N A;  3ZLK A;  4FRD A;  1NMM B;  3CKN A;  4KRV A;  1H4E A;  2WVM A;  3USR A;  2Q4J A;  1GWW A;  4P00 A;  1NKH B;  1ZJ2 A;  4KPX A;  4M2A A;  4D11 A;  1K4V A;  4DDZ A;  5I1F A;  2O1H A;  1H4C A;  4G87 A;  3OH3 A;  1XZ6 A;  1FR8 A;  1ZDG A;  3D8V A;  3V0L A;  1O7Q A;  3BCV A;  5FUH A;  2NXV A;  2Z86 A;  1ZCY A;  4KNX A;  5CMI A;  5EJZ A;  1W57 A;  2J0B A;  3SX8 A;  5BXC A;  1O23 B;  1FXJ A;  2QH5 A;  1O0R A;  1FWY A;  4FRL A;  3I0C A;  1GWV A;  1R7Y A;  3CKO A;  2Y4M A;  2Y6P A;  3CU0 A;  4CJ8 A;  1MP3 A;  4AC3 A;  1MC3 A;  1MP4 A;  5FTV A;  2P73 A;  4DE7 A;  4G3Q A;  3GUE A;  1VGZ A;  5CQM X;  4AAW A;  4KNR A;  1VGW A;  1W55 A;  4K6R A;  4ZDQ A;  4E1K A;  2YC5 A;  1S4P A;  1ZJO A;  2ICY A;  1FRW A;  2VK9 A;  1VGU A;  3D5N A;  5C47 A;  2CU2 A;  2XME A;  1LZJ A;  5CQL X;  5C49 A;  1FZW A;  3ZF8 A;  5AJO A;  2AM4 A;  1NWG B;  3OH4 A;  4HCQ A;  4IRP A;  4M2B A;  3FOQ A;  4EE3 A;  4R7P A;  3CKV A;  1XHB A;  3CGX A;  4J18 A;  4D48 A;  2Y7A A;  1H5T B;  2OI6 A;  3JUJ A;  4JD0 A;  2FYB A;  5L6S A;  1ON8 A;  4LW3 A;  1G93 A;  2J0A A;  3I0G A;  3CKQ A;  3FWW A;  1ZHJ A;  2PX7 A;  3IOJ A;  2RIZ A;  3POL A;  5C48 A;  2AM5 A;  3I0D A;  3I0E A;  3I0H A;  5CQN X;  1G23 A;  1H4D A;  3PNN A;  1QG8 A;  2AM3 A;  1G1L A;  2VXL A;  2QKX A;  4FRB A;  1WT1 A;  1JVG A;  1G95 A;  4B3U A;  3DUV A;  1ZI1 A;  3SXG A;  4B4B A;  5L6V A;  2VXM A;  3SXC A;  3R2W A;  1FG5 N;  1WT2 A;  4B4G A;  5C4D A;  1VZU A;  3I0J A;  2RJ1 A;  3Q4S A;  4AYL A;  4AYJ A;  2VSI A;  1H5S B;  2DPW A;  1VH1 A;  2X5S A;  3I0I X;  4ASY A;  2XWN A;  1FXO A;  4EEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...