1WT2A

Mutant human abo(h) blood group glycosyltransferase a with bound udp and inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQSKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Structural basis for the inactivity of human blood group o2 glycosyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1wt2A00
1G97A 2D0JA 1HM8A 1H7GA 1SS9A 5AJNA 2AGDA 3D98A 3E25A 4EEMA 3V0MA 3SX8A 1E5KA 2ICXA 2V0IA 5IDSA 1ZCUA 1VGZA 5AJPA 1EYRA 1QGQA 4D11A 1ZI4A 3I0CA 4FQWA 1VGTA 1YP2A 1MC3A 5FV9A 2QKXA 5I1FA 1WSZA 1ZDFA 5FTSA 2ICYA 2WVLA 4FRPA 1FR8A 1H5TB 2PGYA 2YQCA 4XWIA 4ECMA 4L41C 4DDZA 1HJJA 3JUJA 2JCLA 1FXJA 1ZHJA 3V0QA 2RJ5A 2VXLA 2QGIA 2P73A 3SX5A 4HO2A 2XMEA 5CMHA 1JVDA 3BCVA 3IOHA 1G1LA 2XMHA 3I0EA 4C2SA 5C38A 1GWVA 2RIYA 4FROA 3TQDA 3I0HA 1GX0A 5C8RA 5DDTA 5IDTA 3V8ZA 2YQJA 1S4OA 2GGQA 1ON8A 2QH5A 1H7LA 1ZJ1A 2WGZA 2ZU7A 4BQHA 3SXDA 2E8BA 3JUKA 2OI7A 1S4NA 2RJ7A 5HS2A 1LZIA 4DECA 4AYJA 3SXGA 5CQNX 5C4FA 4KNRA 2FYDB 1LL2A 2X5SA 1H7QA 3I0GA 1YP4A 3I0KA 1TZFA 3F1CA 3U2VA 3U0YA 4HO4A 1WT1A 1ZJ2A 3R2WA 3RMVA 3ZGGA 2V0LA 5CQLX 4FRLA 4M2AA 4D0TA 1H5SB 1H4EA 2VXMA 2AESA 4FREA 2JCOA 1O23B 3V0PA 1R7VA 1OQMB 2Y4JA 3DJ4A 3Q7UA 4FRHA 4EEGA 1VICA 3ZGFA 1TW5A 2OEGA 1FXOA 3BRKX 5DDVA 1VZUA 3SPTA 1W55A 3LW6A 5C3BA 1ZJ0A 4HO0A 3FWWA 1H7TA 3USQA 1LZ7A 1ZIZA 3I0DA 2I5EA 5C48A 5C49A 1FR9A 1HJLA 2RJ1A 4KPZA 2Z86A 3HL3A 4EE3A 4FRAA 4EVWA 3CKJA 1ZI1A 2YQHA 4Y7UA 2NXVA 5IFYA 1JYLA 1MP3A 2I7BA 4M4KA 3F1YA 2JCKA 4G3PA 1FG5N 1NQIB 4G87A 4CJBA 5AJOA 1W57A 2BO7A 4LW6A 3TZTA 3T7MA 1R82A 1NMMB 2PX7A 3PKPA 2X5ZA 1FZWA 1TVYA 1VPAA 1FRWA 2FYBA 5J49A 2X60A 2FFUA 2O1HA 5FYEA 4CJ8A 1GA8A 4JD0A 4E1KA 4KC2A 4Y7GA 2E3DA 3EE5A 1NWGB 2YESA 4FCUA 1QGSA 2VSHA 2A8WA 5CQPA 5L6SA 1H4CA 2BO4A 1QG8A 2RJ6A 5C36A 2ZU9A 1G95A 3DK5A 2OI5A 4J18A 2FYCB 2YCMA 2P72A 3OH2A 1LL3A 1FGXA 1VZXA 2MZBA 5EIYA 1KWSA 1WT2A 4Y64A 3SXAA 3OH1A 4LW3A 2OEFA 4ASYA 1I52A 4FRQA 4NAIA 4HG6A 1HM9A 1QWJA 5CMGX 4D11C 3U2XA 3POLA 2YC5A 2JCJA 4B42A 4IRPA 1WVCA 1GQCA 3CKOA 1LZJA 3D8VA 2VS4A 3DUVA 2XWNA 2YQSA 1H5RA 1ZJOA 4P00A 5C47A 3V0OA 4CVHA 4EE5A 2V0JA 1NF5B 1WT3A 2VS5A 1NKHB 1MP5A 5FTVA 3U2WA 1H3MA 1JV1A 2AH9A 4Y63A 2PA4A 2I5KA 4Y7TA 3I0JA 4AAWA 3U2TA 3V0NA 2WVMA 1ZI3A 2WAWA 3SX7A 3OGZA 1FO9A 1W77A 1FO8A 1VH3A 3QVBA 3GUEA 2RIZA 4M28A 5FUHA 3SXBA 3SXCA 2FY7A 1VGWA 2O1GA 1R7YA 2AM5A 2ZU8A 3O3PA 5C3AA 2AECA 4FCEA 3E26A 3OKRA 5JQQA 5BXCA 1R7TA 3NGWA 4KNXA 1HV9A 3ST8A 4Y7VA 4ARWA 3R3IA 4KRVA 1G23A 2AM4A 4G3QA 1INJA 3K8DA 3OH0A 5CQMX 1GWWA 1EZIA 1JVGA 4Y6NA 3U0XA 2WEEA 3IOJA 1R80A 2XWMA 3I0LA 1ZCTA 5L6VA 2Y4MA 4D0ZA 2V0KA 4DE7A 1OMZA 2AM3A 1H5TA 2RITA 2RJ8A 3OAMA 4EEAA 3PNNA 4P02A 4K6RA 1HM0A 4CJCA 4HO6A 3IOIA 5C4DA 1O7OA 1H4DA 4KXOA 4BMAA 2D7IA 1R7UA 4KC4A 2RJ0A 4HO3A 4HO9A 1FOAA 1H5SD 3KIAA 1GX4A 4Y6UA 1VZTA 2A8UA 5C1HA 4AC3A 2YC3A 2PGVA 2AE7A 1FWYA 1K4VA 5FU8A 1FGGA 3Q4SA 4HCQA 1O0RA 2P6WA 4Y7FA 1ZJ3A 1INIA 5EJZA 3U2UA 2CU2A 4G3SA 1IINA 1JV3A 2RJ4A 1G3LA 3T7OA 4B5BA 2FYAA 2V0HA 1G8OA 3CKVA 1S4PA 3RMWA 1V84A 4B4BA 4Y9XA 1H7EA 1Z90A 4JISA 3USRA 3ZLLA 4ZDQA 1G93A 1WT0A 4UEGA 4NALA 5C4BA 3FOQA 1ZJPA 4EE4A 2O1FA 4HO5A 1H5SA 3JTJA 1H7HA 3V8YA 4KC1A 5EJ1A 5C1LA 5CQOA 4R7PA 4B4GA 1LL0A 4KT7A 1ON6A 3SX3A 5CMJA 2VSIA 3K8EA 3CGXA 4KQLA 1OMXA 1R7XA 3I0IX 2GGOA 2D7RA 5C1GA 4MNDA 1V83A 4HOCA 4ASJA 2APCA 1VM8A 1IIMA 1ZCYA 1XHBA 2Y4LA 2RIXA 4M2BA 4Y62A 3RSBA 1GQ9A 4GBPA 1ZDGA 2WE9A 3OH4A 1V82A 5CMFX 3D5NA 4NANA 2Q4JA 2Y4KA 5C3DA 2BO8A 4FRBA 2Y6PA 1TW1A 1VGUA 1YP3A 2OI6A 1ZCVA 3V91A 3ZF8A 1H5SC 3PKQA 2XWLA 3V90A 1G0RA 4B4MA 4HO8A 3Q80A 4B2XA 1NHEB 2VFZA 1JYKA 4IRQA 2BO6A 1H7FA 3CKQA 1LVWA 1ZI5A 4YS8A 3SXEA 1YROB 4FRDA 1G2VA 1LZ0A 1H5RB 2FFVA 2DPWA 4D48A 2X65A 3I0FA 3N9WA 4NAKA 1XZ6A 1MP4A 3OC9A 1O7QA 2W0VA 1PZTA 2W0WA 2Y7AA 3OH3A 4AYLA 4MYBA 2VD4A 2UX8A 4B3UA 1R81A 2WVKA 3V0LA 2RJ9A 4EEOA 5C4EA 3T7NA 5CMIA 2VS3A 3CKNA 1VH1A 3ZLKA 4B2WA 5C4CA 1PZYB 1G9RA 3CU0A 5FU0A 2Z87A 4KPXA 4FRMA
chains in the Genus database with same CATH superfamily
1G97A 2D0JA 1HM8A 1H7GA 1SS9A 5AJNA 2AGDA 3D98A 3E25A 4EEMA 3V0MA 3SX8A 1E5KA 2ICXA 2V0IA 5IDSA 1ZCUA 1VGZA 5AJPA 1EYRA 1QGQA 4Q7CA 4D11A 1ZI4A 2C0NA 3I0CA 4FQWA 1VGTA 1YP2A 1MC3A 5FV9A 2QKXA 5I1FA 1WSZA 1ZDFA 5FTSA 4O6MA 2ICYA 2WVLA 5D92A 5D91A 4FRPA 1FR8A 2J0AA 1H5TB 2PGYA 2YQCA 4XWIA 4ECMA 4L41C 4DDZA 1HJJA 3JUJA 2JCLA 1FXJA 1ZHJA 3V0QA 2RJ5A 2VXLA 2QGIA 2P73A 3SX5A 4HO2A 2XMEA 5CMHA 1JVDA 3BCVA 3IOHA 1G1LA 2XMHA 3I0EA 4C2SA 5C38A 1GWVA 2RIYA 4FROA 3TQDA 3I0HA 1GX0A 5C8RA 5DDTA 5IDTA 3V8ZA 2YQJA 1S4OA 2GGQA 1ON8A 2QH5A 1H7LA 1ZJ1A 2WGZA 2ZU7A 4BQHA 3SXDA 2E8BA 3JUKA 2OI7A 1S4NA 2RJ7A 5HS2A 1LZIA 4DECA 4AYJA 3SXGA 5CQNX 5C4FA 4KNRA 2FYDB 1LL2A 2X5SA 1H7QA 3I0GA 1YP4A 3I0KA 1TZFA 3F1CA 3U2VA 3U0YA 4HO4A 1WT1A 1ZJ2A 3R2WA 3RMVA 3ZGGA 2V0LA 5CQLX 4FRLA 4M2AA 4D0TA 1H5SB 4O6NA 1H4EA 2VXMA 2AESA 4FREA 2JCOA 1O23B 3V0PA 1R7VA 1OQMB 2Y4JA 3DJ4A 3Q7UA 4FRHA 4EEGA 1VICA 3ZGFA 1TW5A 2OEGA 1FXOA 3BRKX 5DDVA 1VZUA 3SPTA 1W55A 3LW6A 5C3BA 1ZJ0A 4HO0A 3FWWA 1H7TA 3USQA 1LZ7A 1ZIZA 3I0DA 2I5EA 5C48A 5C49A 1FR9A 1HJLA 2RJ1A 4KPZA 2Z86A 3HL3A 4EE3A 4FRAA 4EVWA 3CKJA 1ZI1A 2YQHA 4Y7UA 2NXVA 5IFYA 1JYLA 1MP3A 2I7BA 4M4KA 3F1YA 2JCKA 4G3PA 1FG5N 1NQIB 4G87A 4CJBA 5AJOA 1W57A 2BO7A 4LW6A 3TZTA 3T7MA 1R82A 1NMMB 2PX7A 3PKPA 2X5ZA 1FZWA 1TVYA 1VPAA 1FRWA 2FYBA 5J49A 2X60A 2FFUA 2O1HA 5FYEA 4CJ8A 1GA8A 4JD0A 4E1KA 4FIYA 4KC2A 4Y7GA 2E3DA 3EE5A 1NWGB 2YESA 4FCUA 1QGSA 2VSHA 2A8WA 5CQPA 5L6SA 1H4CA 2BO4A 1QG8A 2RJ6A 5C36A 2ZU9A 1G95A 3DK5A 2OI5A 4J18A 2FYCB 2YCMA 2P72A 3OH2A 1LL3A 1FGXA 1VZXA 2MZBA 5EIYA 1KWSA 1WT2A 4Y64A 3SXAA 3OH1A 4LW3A 2OEFA 4ASYA 1I52A 4FRQA 4NAIA 4HG6A 1HM9A 1QWJA 5CMGX 4D11C 3U2XA 3POLA 2YC5A 2JCJA 4B42A 4IRPA 1WVCA 1GQCA 3CKOA 1LZJA 3D8VA 2VS4A 3DUVA 2XWNA 2YQSA 1H5RA 1ZJOA 4P00A 5C47A 3V0OA 4CVHA 4EE5A 2V0JA 1NF5B 1WT3A 2VS5A 1NKHB 1MP5A 5FTVA 3U2WA 1H3MA 1JV1A 2AH9A 4Y63A 2PA4A 2I5KA 4Y7TA 3I0JA 4AAWA 3U2TA 3V0NA 2WVMA 1ZI3A 2WAWA 3SX7A 3OGZA 1FO9A 1W77A 1FO8A 1VH3A 3QVBA 3GUEA 2RIZA 4M28A 5FUHA 3SXBA 3SXCA 2FY7A 1VGWA 2O1GA 1R7YA 2AM5A 2ZU8A 3O3PA 5C3AA 2AECA 4FCEA 3E26A 3OKRA 5JQQA 5BXCA 1R7TA 3NGWA 4KNXA 1HV9A 3ST8A 4Y7VA 4ARWA 3R3IA 4KRVA 1G23A 2AM4A 4G3QA 1INJA 3K8DA 3OH0A 5CQMX 1GWWA 1EZIA 1JVGA 4Y6NA 3U0XA 2WEEA 3IOJA 1R80A 2XWMA 3I0LA 1ZCTA 5L6VA 2Y4MA 4D0ZA 2V0KA 4DE7A 1OMZA 2AM3A 1H5TA 2RITA 2RJ8A 3OAMA 4EEAA 2VK9A 3PNNA 4P02A 4K6RA 1HM0A 4CJCA 4HO6A 3IOIA 5C4DA 1O7OA 1H4DA 4KXOA 4BMAA 2D7IA 1R7UA 4KC4A 2RJ0A 4HO3A 4HO9A 1FOAA 1H5SD 3KIAA 1GX4A 4Y6UA 1VZTA 2A8UA 5C1HA 4AC3A 2YC3A 2PGVA 2AE7A 1FWYA 1K4VA 5FU8A 1FGGA 3Q4SA 4HCQA 1O0RA 2P6WA 4Y7FA 1ZJ3A 1INIA 5EJZA 3U2UA 2CU2A 4G3SA 1IINA 1JV3A 2RJ4A 1G3LA 3T7OA 4B5BA 2FYAA 2V0HA 1G8OA 3CKVA 1S4PA 3RMWA 1V84A 4B4BA 4Y9XA 1H7EA 1Z90A 4JISA 3USRA 3ZLLA 4ZDQA 1G93A 1WT0A 4UEGA 4NALA 5C4BA 3FOQA 1ZJPA 4EE4A 2O1FA 4HO5A 1H5SA 3JTJA 1H7HA 3V8YA 4KC1A 5EJ1A 5C1LA 4MIXA 5CQOA 4R7PA 4B4GA 1LL0A 4KT7A 1ON6A 3SX3A 5CMJA 2VSIA 3K8EA 3CGXA 4KQLA 2J0BA 1OMXA 1R7XA 3I0IX 2GGOA 2D7RA 5C1GA 4MNDA 1V83A 4HOCA 4ASJA 2APCA 1VM8A 1IIMA 1ZCYA 1XHBA 2Y4LA 2RIXA 4M2BA 4Y62A 3RSBA 1GQ9A 4GBPA 1ZDGA 2WE9A 3OH4A 1V82A 5CMFX 3D5NA 4NANA 2Q4JA 2Y4KA 5C3DA 2BO8A 4FRBA 2Y6PA 1TW1A 1VGUA 1YP3A 2OI6A 1ZCVA 3V91A 3ZF8A 1H5SC 3PKQA 2XWLA 3V90A 1G0RA 4B4MA 4HO8A 3Q80A 4B2XA 1NHEB 2VFZA 1JYKA 4IRQA 2BO6A 1H7FA 3CKQA 1LVWA 1ZI5A 4YS8A 3SXEA 1YROB 4FRDA 1G2VA 1LZ0A 1H5RB 2FFVA 2DPWA 4D48A 2X65A 3I0FA 3N9WA 4NAKA 1XZ6A 1MP4A 3OC9A 1O7QA 2W0VA 1PZTA 2W0WA 2Y7AA 3OH3A 4AYLA 4MYBA 2VD4A 2UX8A 4B3UA 1R81A 2WVKA 3V0LA 2RJ9A 4EEOA 5C4EA 3T7NA 5CMIA 2VS3A 3CKNA 1VH1A 3ZLKA 4B2WA 5C4CA 1PZYB 4FIXA 1G9RA 3CU0A 5FU0A 2Z87A 4KPXA 4FRMA
chains in the Genus database with same CATH topology
1G97A 2D0JA 1HM8A 1H7GA 1SS9A 5AJNA 2AGDA 3D98A 3E25A 4EEMA 3V0MA 3SX8A 1E5KA 2ICXA 2V0IA 5IDSA 1ZCUA 1VGZA 5AJPA 1EYRA 1QGQA 4Q7CA 4D11A 1ZI4A 2C0NA 3I0CA 4FQWA 1VGTA 1YP2A 1MC3A 5FV9A 2QKXA 5I1FA 1WSZA 1ZDFA 5FTSA 4O6MA 2ICYA 2WVLA 5D92A 5D91A 4FRPA 1FR8A 2J0AA 1H5TB 2PGYA 2YQCA 4XWIA 4ECMA 4L41C 4DDZA 1HJJA 3JUJA 2JCLA 1FXJA 1ZHJA 3V0QA 2RJ5A 2VXLA 2QGIA 2P73A 3SX5A 4HO2A 2XMEA 5CMHA 1JVDA 3BCVA 3IOHA 1G1LA 2XMHA 3I0EA 4C2SA 5C38A 1GWVA 2RIYA 4FROA 3TQDA 3I0HA 1GX0A 5C8RA 5DDTA 5IDTA 3V8ZA 2YQJA 1S4OA 2GGQA 1ON8A 2QH5A 1H7LA 1ZJ1A 2WGZA 2ZU7A 4BQHA 3SXDA 2E8BA 3JUKA 2OI7A 1S4NA 2RJ7A 5HS2A 1LZIA 4DECA 4AYJA 3SXGA 5CQNX 5C4FA 4KNRA 2FYDB 1LL2A 2X5SA 1H7QA 3I0GA 1YP4A 3I0KA 1TZFA 3F1CA 3U2VA 3U0YA 4HO4A 1WT1A 1ZJ2A 3R2WA 3RMVA 3ZGGA 2V0LA 5CQLX 4FRLA 4M2AA 4D0TA 1H5SB 4O6NA 1H4EA 2VXMA 2AESA 4FREA 2JCOA 1O23B 3V0PA 1R7VA 1OQMB 2Y4JA 3DJ4A 3Q7UA 4FRHA 4EEGA 1VICA 3ZGFA 1TW5A 2OEGA 1FXOA 3BRKX 5DDVA 1VZUA 3SPTA 1W55A 3LW6A 5C3BA 1ZJ0A 4HO0A 3FWWA 1H7TA 3USQA 1LZ7A 1ZIZA 3I0DA 2I5EA 5C48A 5C49A 1FR9A 1HJLA 2RJ1A 4KPZA 2Z86A 3HL3A 4EE3A 4FRAA 4EVWA 3CKJA 1ZI1A 2YQHA 4Y7UA 2NXVA 5IFYA 1JYLA 1MP3A 2I7BA 4M4KA 3F1YA 2JCKA 4G3PA 1FG5N 1NQIB 4G87A 4CJBA 5AJOA 1W57A 2BO7A 4LW6A 3TZTA 3T7MA 1R82A 1NMMB 2PX7A 3PKPA 2X5ZA 1FZWA 1TVYA 1VPAA 1FRWA 2FYBA 5J49A 2X60A 2FFUA 2O1HA 5FYEA 4CJ8A 1GA8A 4JD0A 4E1KA 4FIYA 4KC2A 4Y7GA 2E3DA 3EE5A 1NWGB 2YESA 4FCUA 1QGSA 2VSHA 2A8WA 5CQPA 5L6SA 1H4CA 2BO4A 1QG8A 2RJ6A 5C36A 2ZU9A 1G95A 3DK5A 2OI5A 4J18A 2FYCB 2YCMA 2P72A 3OH2A 1LL3A 1FGXA 1VZXA 2MZBA 5EIYA 1KWSA 1WT2A 4Y64A 3SXAA 3OH1A 4LW3A 2OEFA 4ASYA 1I52A 4FRQA 4NAIA 4HG6A 1HM9A 1QWJA 5CMGX 4D11C 3U2XA 3POLA 2YC5A 2JCJA 4B42A 4IRPA 1WVCA 1GQCA 3CKOA 1LZJA 3D8VA 2VS4A 3DUVA 2XWNA 2YQSA 1H5RA 1ZJOA 4P00A 5C47A 3V0OA 4CVHA 4EE5A 2V0JA 1NF5B 1WT3A 2VS5A 1NKHB 1MP5A 5FTVA 3U2WA 1H3MA 1JV1A 2AH9A 4Y63A 2PA4A 2I5KA 4Y7TA 3I0JA 4AAWA 3U2TA 3V0NA 2WVMA 1ZI3A 2WAWA 3SX7A 3OGZA 1FO9A 1W77A 1FO8A 1VH3A 3QVBA 3GUEA 2RIZA 4M28A 5FUHA 3SXBA 3SXCA 2FY7A 1VGWA 2O1GA 1R7YA 2AM5A 2ZU8A 3O3PA 5C3AA 2AECA 4FCEA 3E26A 3OKRA 5JQQA 5BXCA 1R7TA 3NGWA 4KNXA 1HV9A 3ST8A 4Y7VA 4ARWA 3R3IA 4KRVA 1G23A 2AM4A 4G3QA 1INJA 3K8DA 3OH0A 5CQMX 1GWWA 1EZIA 1JVGA 4Y6NA 3U0XA 2WEEA 3IOJA 1R80A 2XWMA 3I0LA 1ZCTA 5L6VA 2Y4MA 4D0ZA 2V0KA 4DE7A 1OMZA 2AM3A 1H5TA 2RITA 2RJ8A 3OAMA 4EEAA 2VK9A 3PNNA 4P02A 4K6RA 1HM0A 4CJCA 4HO6A 3IOIA 5C4DA 1O7OA 1H4DA 4KXOA 4BMAA 2D7IA 1R7UA 4KC4A 2RJ0A 4HO3A 4HO9A 1FOAA 1H5SD 3KIAA 1GX4A 4Y6UA 1VZTA 2A8UA 5C1HA 4AC3A 2YC3A 2PGVA 2AE7A 1FWYA 1K4VA 5FU8A 1FGGA 3Q4SA 4HCQA 1O0RA 2P6WA 4Y7FA 1ZJ3A 1INIA 5EJZA 3U2UA 2CU2A 4G3SA 1IINA 1JV3A 2RJ4A 1G3LA 3T7OA 4B5BA 2FYAA 2V0HA 1G8OA 3CKVA 1S4PA 3RMWA 1V84A 4B4BA 4Y9XA 1H7EA 1Z90A 4JISA 3USRA 3ZLLA 4ZDQA 1G93A 1WT0A 4UEGA 4NALA 5C4BA 3FOQA 1ZJPA 4EE4A 2O1FA 4HO5A 1H5SA 3JTJA 1H7HA 3V8YA 4KC1A 5EJ1A 5C1LA 4MIXA 5CQOA 4R7PA 4B4GA 1LL0A 4KT7A 1ON6A 3SX3A 5CMJA 2VSIA 3K8EA 3CGXA 4KQLA 2J0BA 1OMXA 1R7XA 3I0IX 2GGOA 2D7RA 5C1GA 4MNDA 1V83A 4HOCA 4ASJA 2APCA 1VM8A 1IIMA 1ZCYA 1XHBA 2Y4LA 2RIXA 4M2BA 4Y62A 3RSBA 1GQ9A 4GBPA 1ZDGA 2WE9A 3OH4A 1V82A 5CMFX 3D5NA 4NANA 2Q4JA 2Y4KA 5C3DA 2BO8A 4FRBA 2Y6PA 1TW1A 1VGUA 1YP3A 2OI6A 1ZCVA 3V91A 3ZF8A 1H5SC 3PKQA 2XWLA 3V90A 1G0RA 4B4MA 4HO8A 3Q80A 4B2XA 1NHEB 2VFZA 1JYKA 4IRQA 2BO6A 1H7FA 3CKQA 1LVWA 1ZI5A 4YS8A 3SXEA 1YROB 4FRDA 1G2VA 1LZ0A 1H5RB 2FFVA 2DPWA 4D48A 2X65A 3I0FA 3N9WA 4NAKA 1XZ6A 1MP4A 3OC9A 1O7QA 2W0VA 1PZTA 2W0WA 2Y7AA 3OH3A 4AYLA 4MYBA 2VD4A 2UX8A 4B3UA 1R81A 2WVKA 3V0LA 2RJ9A 4EEOA 5C4EA 3T7NA 5CMIA 2VS3A 3CKNA 1VH1A 3ZLKA 4B2WA 5C4CA 1PZYB 4FIXA 1G9RA 3CU0A 5FU0A 2Z87A 4KPXA 4FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G97 A;  2D0J A;  1HM8 A;  1H7G A;  1SS9 A;  5AJN A;  2AGD A;  3D98 A;  3E25 A;  4EEM A;  3V0M A;  3SX8 A;  1E5K A;  2ICX A;  2V0I A;  5IDS A;  1ZCU A;  1VGZ A;  5AJP A;  1EYR A;  1QGQ A;  4D11 A;  1ZI4 A;  3I0C A;  4FQW A;  1VGT A;  1YP2 A;  1MC3 A;  5FV9 A;  2QKX A;  5I1F A;  1WSZ A;  1ZDF A;  5FTS A;  2ICY A;  2WVL A;  4FRP A;  1FR8 A;  1H5T B;  2PGY A;  2YQC A;  4XWI A;  4ECM A;  4L41 C;  4DDZ A;  1HJJ A;  3JUJ A;  2JCL A;  1FXJ A;  1ZHJ A;  3V0Q A;  2RJ5 A;  2VXL A;  2QGI A;  2P73 A;  3SX5 A;  4HO2 A;  2XME A;  5CMH A;  1JVD A;  3BCV A;  3IOH A;  1G1L A;  2XMH A;  3I0E A;  4C2S A;  5C38 A;  1GWV A;  2RIY A;  4FRO A;  3TQD A;  3I0H A;  1GX0 A;  5C8R A;  5DDT A;  5IDT A;  3V8Z A;  2YQJ A;  1S4O A;  2GGQ A;  1ON8 A;  2QH5 A;  1H7L A;  1ZJ1 A;  2WGZ A;  2ZU7 A;  4BQH A;  3SXD A;  2E8B A;  3JUK A;  2OI7 A;  1S4N A;  2RJ7 A;  5HS2 A;  1LZI A;  4DEC A;  4AYJ A;  3SXG A;  5CQN X;  5C4F A;  4KNR A;  2FYD B;  1LL2 A;  2X5S A;  1H7Q A;  3I0G A;  1YP4 A;  3I0K A;  1TZF A;  3F1C A;  3U2V A;  3U0Y A;  4HO4 A;  1WT1 A;  1ZJ2 A;  3R2W A;  3RMV A;  3ZGG A;  2V0L A;  5CQL X;  4FRL A;  4M2A A;  4D0T A;  1H5S B;  1H4E A;  2VXM A;  2AES A;  4FRE A;  2JCO A;  1O23 B;  3V0P A;  1R7V A;  1OQM B;  2Y4J A;  3DJ4 A;  3Q7U A;  4FRH A;  4EEG A;  1VIC A;  3ZGF A;  1TW5 A;  2OEG A;  1FXO A;  3BRK X;  5DDV A;  1VZU A;  3SPT A;  1W55 A;  3LW6 A;  5C3B A;  1ZJ0 A;  4HO0 A;  3FWW A;  1H7T A;  3USQ A;  1LZ7 A;  1ZIZ A;  3I0D A;  2I5E A;  5C48 A;  5C49 A;  1FR9 A;  1HJL A;  2RJ1 A;  4KPZ A;  2Z86 A;  3HL3 A;  4EE3 A;  4FRA A;  4EVW A;  3CKJ A;  1ZI1 A;  2YQH A;  4Y7U A;  2NXV A;  5IFY A;  1JYL A;  1MP3 A;  2I7B A;  4M4K A;  3F1Y A;  2JCK A;  4G3P A;  1FG5 N;  1NQI B;  4G87 A;  4CJB A;  5AJO A;  1W57 A;  2BO7 A;  4LW6 A;  3TZT A;  3T7M A;  1R82 A;  1NMM B;  2PX7 A;  3PKP A;  2X5Z A;  1FZW A;  1TVY A;  1VPA A;  1FRW A;  2FYB A;  5J49 A;  2X60 A;  2FFU A;  2O1H A;  5FYE A;  4CJ8 A;  1GA8 A;  4JD0 A;  4E1K A;  4KC2 A;  4Y7G A;  2E3D A;  3EE5 A;  1NWG B;  2YES A;  4FCU A;  1QGS A;  2VSH A;  2A8W A;  5CQP A;  5L6S A;  1H4C A;  2BO4 A;  1QG8 A;  2RJ6 A;  5C36 A;  2ZU9 A;  1G95 A;  3DK5 A;  2OI5 A;  4J18 A;  2FYC B;  2YCM A;  2P72 A;  3OH2 A;  1LL3 A;  1FGX A;  1VZX A;  2MZB A;  5EIY A;  1KWS A;  1WT2 A;  4Y64 A;  3SXA A;  3OH1 A;  4LW3 A;  2OEF A;  4ASY A;  1I52 A;  4FRQ A;  4NAI A;  4HG6 A;  1HM9 A;  1QWJ A;  5CMG X;  4D11 C;  3U2X A;  3POL A;  2YC5 A;  2JCJ A;  4B42 A;  4IRP A;  1WVC A;  1GQC A;  3CKO A;  1LZJ A;  3D8V A;  2VS4 A;  3DUV A;  2XWN A;  2YQS A;  1H5R A;  1ZJO A;  4P00 A;  5C47 A;  3V0O A;  4CVH A;  4EE5 A;  2V0J A;  1NF5 B;  1WT3 A;  2VS5 A;  1NKH B;  1MP5 A;  5FTV A;  3U2W A;  1H3M A;  1JV1 A;  2AH9 A;  4Y63 A;  2PA4 A;  2I5K A;  4Y7T A;  3I0J A;  4AAW A;  3U2T A;  3V0N A;  2WVM A;  1ZI3 A;  2WAW A;  3SX7 A;  3OGZ A;  1FO9 A;  1W77 A;  1FO8 A;  1VH3 A;  3QVB A;  3GUE A;  2RIZ A;  4M28 A;  5FUH A;  3SXB A;  3SXC A;  2FY7 A;  1VGW A;  2O1G A;  1R7Y A;  2AM5 A;  2ZU8 A;  3O3P A;  5C3A A;  2AEC A;  4FCE A;  3E26 A;  3OKR A;  5JQQ A;  5BXC A;  1R7T A;  3NGW A;  4KNX A;  1HV9 A;  3ST8 A;  4Y7V A;  4ARW A;  3R3I A;  4KRV A;  1G23 A;  2AM4 A;  4G3Q A;  1INJ A;  3K8D A;  3OH0 A;  5CQM X;  1GWW A;  1EZI A;  1JVG A;  4Y6N A;  3U0X A;  2WEE A;  3IOJ A;  1R80 A;  2XWM A;  3I0L A;  1ZCT A;  5L6V A;  2Y4M A;  4D0Z A;  2V0K A;  4DE7 A;  1OMZ A;  2AM3 A;  1H5T A;  2RIT A;  2RJ8 A;  3OAM A;  4EEA A;  3PNN A;  4P02 A;  4K6R A;  1HM0 A;  4CJC A;  4HO6 A;  3IOI A;  5C4D A;  1O7O A;  1H4D A;  4KXO A;  4BMA A;  2D7I A;  1R7U A;  4KC4 A;  2RJ0 A;  4HO3 A;  4HO9 A;  1FOA A;  1H5S D;  3KIA A;  1GX4 A;  4Y6U A;  1VZT A;  2A8U A;  5C1H A;  4AC3 A;  2YC3 A;  2PGV A;  2AE7 A;  1FWY A;  1K4V A;  5FU8 A;  1FGG A;  3Q4S A;  4HCQ A;  1O0R A;  2P6W A;  4Y7F A;  1ZJ3 A;  1INI A;  5EJZ A;  3U2U A;  2CU2 A;  4G3S A;  1IIN A;  1JV3 A;  2RJ4 A;  1G3L A;  3T7O A;  4B5B A;  2FYA A;  2V0H A;  1G8O A;  3CKV A;  1S4P A;  3RMW A;  1V84 A;  4B4B A;  4Y9X A;  1H7E A;  1Z90 A;  4JIS A;  3USR A;  3ZLL A;  4ZDQ A;  1G93 A;  1WT0 A;  4UEG A;  4NAL A;  5C4B A;  3FOQ A;  1ZJP A;  4EE4 A;  2O1F A;  4HO5 A;  1H5S A;  3JTJ A;  1H7H A;  3V8Y A;  4KC1 A;  5EJ1 A;  5C1L A;  5CQO A;  4R7P A;  4B4G A;  1LL0 A;  4KT7 A;  1ON6 A;  3SX3 A;  5CMJ A;  2VSI A;  3K8E A;  3CGX A;  4KQL A;  1OMX A;  1R7X A;  3I0I X;  2GGO A;  2D7R A;  5C1G A;  4MND A;  1V83 A;  4HOC A;  4ASJ A;  2APC A;  1VM8 A;  1IIM A;  1ZCY A;  1XHB A;  2Y4L A;  2RIX A;  4M2B A;  4Y62 A;  3RSB A;  1GQ9 A;  4GBP A;  1ZDG A;  2WE9 A;  3OH4 A;  1V82 A;  5CMF X;  3D5N A;  4NAN A;  2Q4J A;  2Y4K A;  5C3D A;  2BO8 A;  4FRB A;  2Y6P A;  1TW1 A;  1VGU A;  1YP3 A;  2OI6 A;  1ZCV A;  3V91 A;  3ZF8 A;  1H5S C;  3PKQ A;  2XWL A;  3V90 A;  1G0R A;  4B4M A;  4HO8 A;  3Q80 A;  4B2X A;  1NHE B;  2VFZ A;  1JYK A;  4IRQ A;  2BO6 A;  1H7F A;  3CKQ A;  1LVW A;  1ZI5 A;  4YS8 A;  3SXE A;  1YRO B;  4FRD A;  1G2V A;  1LZ0 A;  1H5R B;  2FFV A;  2DPW A;  4D48 A;  2X65 A;  3I0F A;  3N9W A;  4NAK A;  1XZ6 A;  1MP4 A;  3OC9 A;  1O7Q A;  2W0V A;  1PZT A;  2W0W A;  2Y7A A;  3OH3 A;  4AYL A;  4MYB A;  2VD4 A;  2UX8 A;  4B3U A;  1R81 A;  2WVK A;  3V0L A;  2RJ9 A;  4EEO A;  5C4E A;  3T7N A;  5CMI A;  2VS3 A;  3CKN A;  1VH1 A;  3ZLK A;  4B2W A;  5C4C A;  1PZY B;  1G9R A;  3CU0 A;  5FU0 A;  2Z87 A;  4KPX A;  4FRM A; 
#chains in the Genus database with same CATH topology
 1G97 A;  2D0J A;  1HM8 A;  1H7G A;  1SS9 A;  5AJN A;  2AGD A;  3D98 A;  3E25 A;  4EEM A;  3V0M A;  3SX8 A;  1E5K A;  2ICX A;  2V0I A;  5IDS A;  1ZCU A;  1VGZ A;  5AJP A;  1EYR A;  1QGQ A;  4Q7C A;  4D11 A;  1ZI4 A;  2C0N A;  3I0C A;  4FQW A;  1VGT A;  1YP2 A;  1MC3 A;  5FV9 A;  2QKX A;  5I1F A;  1WSZ A;  1ZDF A;  5FTS A;  4O6M A;  2ICY A;  2WVL A;  5D92 A;  5D91 A;  4FRP A;  1FR8 A;  2J0A A;  1H5T B;  2PGY A;  2YQC A;  4XWI A;  4ECM A;  4L41 C;  4DDZ A;  1HJJ A;  3JUJ A;  2JCL A;  1FXJ A;  1ZHJ A;  3V0Q A;  2RJ5 A;  2VXL A;  2QGI A;  2P73 A;  3SX5 A;  4HO2 A;  2XME A;  5CMH A;  1JVD A;  3BCV A;  3IOH A;  1G1L A;  2XMH A;  3I0E A;  4C2S A;  5C38 A;  1GWV A;  2RIY A;  4FRO A;  3TQD A;  3I0H A;  1GX0 A;  5C8R A;  5DDT A;  5IDT A;  3V8Z A;  2YQJ A;  1S4O A;  2GGQ A;  1ON8 A;  2QH5 A;  1H7L A;  1ZJ1 A;  2WGZ A;  2ZU7 A;  4BQH A;  3SXD A;  2E8B A;  3JUK A;  2OI7 A;  1S4N A;  2RJ7 A;  5HS2 A;  1LZI A;  4DEC A;  4AYJ A;  3SXG A;  5CQN X;  5C4F A;  4KNR A;  2FYD B;  1LL2 A;  2X5S A;  1H7Q A;  3I0G A;  1YP4 A;  3I0K A;  1TZF A;  3F1C A;  3U2V A;  3U0Y A;  4HO4 A;  1WT1 A;  1ZJ2 A;  3R2W A;  3RMV A;  3ZGG A;  2V0L A;  5CQL X;  4FRL A;  4M2A A;  4D0T A;  1H5S B;  4O6N A;  1H4E A;  2VXM A;  2AES A;  4FRE A;  2JCO A;  1O23 B;  3V0P A;  1R7V A;  1OQM B;  2Y4J A;  3DJ4 A;  3Q7U A;  4FRH A;  4EEG A;  1VIC A;  3ZGF A;  1TW5 A;  2OEG A;  1FXO A;  3BRK X;  5DDV A;  1VZU A;  3SPT A;  1W55 A;  3LW6 A;  5C3B A;  1ZJ0 A;  4HO0 A;  3FWW A;  1H7T A;  3USQ A;  1LZ7 A;  1ZIZ A;  3I0D A;  2I5E A;  5C48 A;  5C49 A;  1FR9 A;  1HJL A;  2RJ1 A;  4KPZ A;  2Z86 A;  3HL3 A;  4EE3 A;  4FRA A;  4EVW A;  3CKJ A;  1ZI1 A;  2YQH A;  4Y7U A;  2NXV A;  5IFY A;  1JYL A;  1MP3 A;  2I7B A;  4M4K A;  3F1Y A;  2JCK A;  4G3P A;  1FG5 N;  1NQI B;  4G87 A;  4CJB A;  5AJO A;  1W57 A;  2BO7 A;  4LW6 A;  3TZT A;  3T7M A;  1R82 A;  1NMM B;  2PX7 A;  3PKP A;  2X5Z A;  1FZW A;  1TVY A;  1VPA A;  1FRW A;  2FYB A;  5J49 A;  2X60 A;  2FFU A;  2O1H A;  5FYE A;  4CJ8 A;  1GA8 A;  4JD0 A;  4E1K A;  4FIY A;  4KC2 A;  4Y7G A;  2E3D A;  3EE5 A;  1NWG B;  2YES A;  4FCU A;  1QGS A;  2VSH A;  2A8W A;  5CQP A;  5L6S A;  1H4C A;  2BO4 A;  1QG8 A;  2RJ6 A;  5C36 A;  2ZU9 A;  1G95 A;  3DK5 A;  2OI5 A;  4J18 A;  2FYC B;  2YCM A;  2P72 A;  3OH2 A;  1LL3 A;  1FGX A;  1VZX A;  2MZB A;  5EIY A;  1KWS A;  1WT2 A;  4Y64 A;  3SXA A;  3OH1 A;  4LW3 A;  2OEF A;  4ASY A;  1I52 A;  4FRQ A;  4NAI A;  4HG6 A;  1HM9 A;  1QWJ A;  5CMG X;  4D11 C;  3U2X A;  3POL A;  2YC5 A;  2JCJ A;  4B42 A;  4IRP A;  1WVC A;  1GQC A;  3CKO A;  1LZJ A;  3D8V A;  2VS4 A;  3DUV A;  2XWN A;  2YQS A;  1H5R A;  1ZJO A;  4P00 A;  5C47 A;  3V0O A;  4CVH A;  4EE5 A;  2V0J A;  1NF5 B;  1WT3 A;  2VS5 A;  1NKH B;  1MP5 A;  5FTV A;  3U2W A;  1H3M A;  1JV1 A;  2AH9 A;  4Y63 A;  2PA4 A;  2I5K A;  4Y7T A;  3I0J A;  4AAW A;  3U2T A;  3V0N A;  2WVM A;  1ZI3 A;  2WAW A;  3SX7 A;  3OGZ A;  1FO9 A;  1W77 A;  1FO8 A;  1VH3 A;  3QVB A;  3GUE A;  2RIZ A;  4M28 A;  5FUH A;  3SXB A;  3SXC A;  2FY7 A;  1VGW A;  2O1G A;  1R7Y A;  2AM5 A;  2ZU8 A;  3O3P A;  5C3A A;  2AEC A;  4FCE A;  3E26 A;  3OKR A;  5JQQ A;  5BXC A;  1R7T A;  3NGW A;  4KNX A;  1HV9 A;  3ST8 A;  4Y7V A;  4ARW A;  3R3I A;  4KRV A;  1G23 A;  2AM4 A;  4G3Q A;  1INJ A;  3K8D A;  3OH0 A;  5CQM X;  1GWW A;  1EZI A;  1JVG A;  4Y6N A;  3U0X A;  2WEE A;  3IOJ A;  1R80 A;  2XWM A;  3I0L A;  1ZCT A;  5L6V A;  2Y4M A;  4D0Z A;  2V0K A;  4DE7 A;  1OMZ A;  2AM3 A;  1H5T A;  2RIT A;  2RJ8 A;  3OAM A;  4EEA A;  2VK9 A;  3PNN A;  4P02 A;  4K6R A;  1HM0 A;  4CJC A;  4HO6 A;  3IOI A;  5C4D A;  1O7O A;  1H4D A;  4KXO A;  4BMA A;  2D7I A;  1R7U A;  4KC4 A;  2RJ0 A;  4HO3 A;  4HO9 A;  1FOA A;  1H5S D;  3KIA A;  1GX4 A;  4Y6U A;  1VZT A;  2A8U A;  5C1H A;  4AC3 A;  2YC3 A;  2PGV A;  2AE7 A;  1FWY A;  1K4V A;  5FU8 A;  1FGG A;  3Q4S A;  4HCQ A;  1O0R A;  2P6W A;  4Y7F A;  1ZJ3 A;  1INI A;  5EJZ A;  3U2U A;  2CU2 A;  4G3S A;  1IIN A;  1JV3 A;  2RJ4 A;  1G3L A;  3T7O A;  4B5B A;  2FYA A;  2V0H A;  1G8O A;  3CKV A;  1S4P A;  3RMW A;  1V84 A;  4B4B A;  4Y9X A;  1H7E A;  1Z90 A;  4JIS A;  3USR A;  3ZLL A;  4ZDQ A;  1G93 A;  1WT0 A;  4UEG A;  4NAL A;  5C4B A;  3FOQ A;  1ZJP A;  4EE4 A;  2O1F A;  4HO5 A;  1H5S A;  3JTJ A;  1H7H A;  3V8Y A;  4KC1 A;  5EJ1 A;  5C1L A;  4MIX A;  5CQO A;  4R7P A;  4B4G A;  1LL0 A;  4KT7 A;  1ON6 A;  3SX3 A;  5CMJ A;  2VSI A;  3K8E A;  3CGX A;  4KQL A;  2J0B A;  1OMX A;  1R7X A;  3I0I X;  2GGO A;  2D7R A;  5C1G A;  4MND A;  1V83 A;  4HOC A;  4ASJ A;  2APC A;  1VM8 A;  1IIM A;  1ZCY A;  1XHB A;  2Y4L A;  2RIX A;  4M2B A;  4Y62 A;  3RSB A;  1GQ9 A;  4GBP A;  1ZDG A;  2WE9 A;  3OH4 A;  1V82 A;  5CMF X;  3D5N A;  4NAN A;  2Q4J A;  2Y4K A;  5C3D A;  2BO8 A;  4FRB A;  2Y6P A;  1TW1 A;  1VGU A;  1YP3 A;  2OI6 A;  1ZCV A;  3V91 A;  3ZF8 A;  1H5S C;  3PKQ A;  2XWL A;  3V90 A;  1G0R A;  4B4M A;  4HO8 A;  3Q80 A;  4B2X A;  1NHE B;  2VFZ A;  1JYK A;  4IRQ A;  2BO6 A;  1H7F A;  3CKQ A;  1LVW A;  1ZI5 A;  4YS8 A;  3SXE A;  1YRO B;  4FRD A;  1G2V A;  1LZ0 A;  1H5R B;  2FFV A;  2DPW A;  4D48 A;  2X65 A;  3I0F A;  3N9W A;  4NAK A;  1XZ6 A;  1MP4 A;  3OC9 A;  1O7Q A;  2W0V A;  1PZT A;  2W0W A;  2Y7A A;  3OH3 A;  4AYL A;  4MYB A;  2VD4 A;  2UX8 A;  4B3U A;  1R81 A;  2WVK A;  3V0L A;  2RJ9 A;  4EEO A;  5C4E A;  3T7N A;  5CMI A;  2VS3 A;  3CKN A;  1VH1 A;  3ZLK A;  4B2W A;  5C4C A;  1PZY B;  4FIX A;  1G9R A;  3CU0 A;  5FU0 A;  2Z87 A;  4KPX A;  4FRM A; 
#chains in the Genus database with same CATH homology
 1G97 A;  2D0J A;  1HM8 A;  1H7G A;  1SS9 A;  5AJN A;  2AGD A;  3D98 A;  3E25 A;  4EEM A;  3V0M A;  3SX8 A;  1E5K A;  2ICX A;  2V0I A;  5IDS A;  1ZCU A;  1VGZ A;  5AJP A;  1EYR A;  1QGQ A;  4Q7C A;  4D11 A;  1ZI4 A;  2C0N A;  3I0C A;  4FQW A;  1VGT A;  1YP2 A;  1MC3 A;  5FV9 A;  2QKX A;  5I1F A;  1WSZ A;  1ZDF A;  5FTS A;  4O6M A;  2ICY A;  2WVL A;  5D92 A;  5D91 A;  4FRP A;  1FR8 A;  2J0A A;  1H5T B;  2PGY A;  2YQC A;  4XWI A;  4ECM A;  4L41 C;  4DDZ A;  1HJJ A;  3JUJ A;  2JCL A;  1FXJ A;  1ZHJ A;  3V0Q A;  2RJ5 A;  2VXL A;  2QGI A;  2P73 A;  3SX5 A;  4HO2 A;  2XME A;  5CMH A;  1JVD A;  3BCV A;  3IOH A;  1G1L A;  2XMH A;  3I0E A;  4C2S A;  5C38 A;  1GWV A;  2RIY A;  4FRO A;  3TQD A;  3I0H A;  1GX0 A;  5C8R A;  5DDT A;  5IDT A;  3V8Z A;  2YQJ A;  1S4O A;  2GGQ A;  1ON8 A;  2QH5 A;  1H7L A;  1ZJ1 A;  2WGZ A;  2ZU7 A;  4BQH A;  3SXD A;  2E8B A;  3JUK A;  2OI7 A;  1S4N A;  2RJ7 A;  5HS2 A;  1LZI A;  4DEC A;  4AYJ A;  3SXG A;  5CQN X;  5C4F A;  4KNR A;  2FYD B;  1LL2 A;  2X5S A;  1H7Q A;  3I0G A;  1YP4 A;  3I0K A;  1TZF A;  3F1C A;  3U2V A;  3U0Y A;  4HO4 A;  1WT1 A;  1ZJ2 A;  3R2W A;  3RMV A;  3ZGG A;  2V0L A;  5CQL X;  4FRL A;  4M2A A;  4D0T A;  1H5S B;  4O6N A;  1H4E A;  2VXM A;  2AES A;  4FRE A;  2JCO A;  1O23 B;  3V0P A;  1R7V A;  1OQM B;  2Y4J A;  3DJ4 A;  3Q7U A;  4FRH A;  4EEG A;  1VIC A;  3ZGF A;  1TW5 A;  2OEG A;  1FXO A;  3BRK X;  5DDV A;  1VZU A;  3SPT A;  1W55 A;  3LW6 A;  5C3B A;  1ZJ0 A;  4HO0 A;  3FWW A;  1H7T A;  3USQ A;  1LZ7 A;  1ZIZ A;  3I0D A;  2I5E A;  5C48 A;  5C49 A;  1FR9 A;  1HJL A;  2RJ1 A;  4KPZ A;  2Z86 A;  3HL3 A;  4EE3 A;  4FRA A;  4EVW A;  3CKJ A;  1ZI1 A;  2YQH A;  4Y7U A;  2NXV A;  5IFY A;  1JYL A;  1MP3 A;  2I7B A;  4M4K A;  3F1Y A;  2JCK A;  4G3P A;  1FG5 N;  1NQI B;  4G87 A;  4CJB A;  5AJO A;  1W57 A;  2BO7 A;  4LW6 A;  3TZT A;  3T7M A;  1R82 A;  1NMM B;  2PX7 A;  3PKP A;  2X5Z A;  1FZW A;  1TVY A;  1VPA A;  1FRW A;  2FYB A;  5J49 A;  2X60 A;  2FFU A;  2O1H A;  5FYE A;  4CJ8 A;  1GA8 A;  4JD0 A;  4E1K A;  4FIY A;  4KC2 A;  4Y7G A;  2E3D A;  3EE5 A;  1NWG B;  2YES A;  4FCU A;  1QGS A;  2VSH A;  2A8W A;  5CQP A;  5L6S A;  1H4C A;  2BO4 A;  1QG8 A;  2RJ6 A;  5C36 A;  2ZU9 A;  1G95 A;  3DK5 A;  2OI5 A;  4J18 A;  2FYC B;  2YCM A;  2P72 A;  3OH2 A;  1LL3 A;  1FGX A;  1VZX A;  2MZB A;  5EIY A;  1KWS A;  1WT2 A;  4Y64 A;  3SXA A;  3OH1 A;  4LW3 A;  2OEF A;  4ASY A;  1I52 A;  4FRQ A;  4NAI A;  4HG6 A;  1HM9 A;  1QWJ A;  5CMG X;  4D11 C;  3U2X A;  3POL A;  2YC5 A;  2JCJ A;  4B42 A;  4IRP A;  1WVC A;  1GQC A;  3CKO A;  1LZJ A;  3D8V A;  2VS4 A;  3DUV A;  2XWN A;  2YQS A;  1H5R A;  1ZJO A;  4P00 A;  5C47 A;  3V0O A;  4CVH A;  4EE5 A;  2V0J A;  1NF5 B;  1WT3 A;  2VS5 A;  1NKH B;  1MP5 A;  5FTV A;  3U2W A;  1H3M A;  1JV1 A;  2AH9 A;  4Y63 A;  2PA4 A;  2I5K A;  4Y7T A;  3I0J A;  4AAW A;  3U2T A;  3V0N A;  2WVM A;  1ZI3 A;  2WAW A;  3SX7 A;  3OGZ A;  1FO9 A;  1W77 A;  1FO8 A;  1VH3 A;  3QVB A;  3GUE A;  2RIZ A;  4M28 A;  5FUH A;  3SXB A;  3SXC A;  2FY7 A;  1VGW A;  2O1G A;  1R7Y A;  2AM5 A;  2ZU8 A;  3O3P A;  5C3A A;  2AEC A;  4FCE A;  3E26 A;  3OKR A;  5JQQ A;  5BXC A;  1R7T A;  3NGW A;  4KNX A;  1HV9 A;  3ST8 A;  4Y7V A;  4ARW A;  3R3I A;  4KRV A;  1G23 A;  2AM4 A;  4G3Q A;  1INJ A;  3K8D A;  3OH0 A;  5CQM X;  1GWW A;  1EZI A;  1JVG A;  4Y6N A;  3U0X A;  2WEE A;  3IOJ A;  1R80 A;  2XWM A;  3I0L A;  1ZCT A;  5L6V A;  2Y4M A;  4D0Z A;  2V0K A;  4DE7 A;  1OMZ A;  2AM3 A;  1H5T A;  2RIT A;  2RJ8 A;  3OAM A;  4EEA A;  2VK9 A;  3PNN A;  4P02 A;  4K6R A;  1HM0 A;  4CJC A;  4HO6 A;  3IOI A;  5C4D A;  1O7O A;  1H4D A;  4KXO A;  4BMA A;  2D7I A;  1R7U A;  4KC4 A;  2RJ0 A;  4HO3 A;  4HO9 A;  1FOA A;  1H5S D;  3KIA A;  1GX4 A;  4Y6U A;  1VZT A;  2A8U A;  5C1H A;  4AC3 A;  2YC3 A;  2PGV A;  2AE7 A;  1FWY A;  1K4V A;  5FU8 A;  1FGG A;  3Q4S A;  4HCQ A;  1O0R A;  2P6W A;  4Y7F A;  1ZJ3 A;  1INI A;  5EJZ A;  3U2U A;  2CU2 A;  4G3S A;  1IIN A;  1JV3 A;  2RJ4 A;  1G3L A;  3T7O A;  4B5B A;  2FYA A;  2V0H A;  1G8O A;  3CKV A;  1S4P A;  3RMW A;  1V84 A;  4B4B A;  4Y9X A;  1H7E A;  1Z90 A;  4JIS A;  3USR A;  3ZLL A;  4ZDQ A;  1G93 A;  1WT0 A;  4UEG A;  4NAL A;  5C4B A;  3FOQ A;  1ZJP A;  4EE4 A;  2O1F A;  4HO5 A;  1H5S A;  3JTJ A;  1H7H A;  3V8Y A;  4KC1 A;  5EJ1 A;  5C1L A;  4MIX A;  5CQO A;  4R7P A;  4B4G A;  1LL0 A;  4KT7 A;  1ON6 A;  3SX3 A;  5CMJ A;  2VSI A;  3K8E A;  3CGX A;  4KQL A;  2J0B A;  1OMX A;  1R7X A;  3I0I X;  2GGO A;  2D7R A;  5C1G A;  4MND A;  1V83 A;  4HOC A;  4ASJ A;  2APC A;  1VM8 A;  1IIM A;  1ZCY A;  1XHB A;  2Y4L A;  2RIX A;  4M2B A;  4Y62 A;  3RSB A;  1GQ9 A;  4GBP A;  1ZDG A;  2WE9 A;  3OH4 A;  1V82 A;  5CMF X;  3D5N A;  4NAN A;  2Q4J A;  2Y4K A;  5C3D A;  2BO8 A;  4FRB A;  2Y6P A;  1TW1 A;  1VGU A;  1YP3 A;  2OI6 A;  1ZCV A;  3V91 A;  3ZF8 A;  1H5S C;  3PKQ A;  2XWL A;  3V90 A;  1G0R A;  4B4M A;  4HO8 A;  3Q80 A;  4B2X A;  1NHE B;  2VFZ A;  1JYK A;  4IRQ A;  2BO6 A;  1H7F A;  3CKQ A;  1LVW A;  1ZI5 A;  4YS8 A;  3SXE A;  1YRO B;  4FRD A;  1G2V A;  1LZ0 A;  1H5R B;  2FFV A;  2DPW A;  4D48 A;  2X65 A;  3I0F A;  3N9W A;  4NAK A;  1XZ6 A;  1MP4 A;  3OC9 A;  1O7Q A;  2W0V A;  1PZT A;  2W0W A;  2Y7A A;  3OH3 A;  4AYL A;  4MYB A;  2VD4 A;  2UX8 A;  4B3U A;  1R81 A;  2WVK A;  3V0L A;  2RJ9 A;  4EEO A;  5C4E A;  3T7N A;  5CMI A;  2VS3 A;  3CKN A;  1VH1 A;  3ZLK A;  4B2W A;  5C4C A;  1PZY B;  4FIX A;  1G9R A;  3CU0 A;  5FU0 A;  2Z87 A;  4KPX A;  4FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...