4KXOA

Crystal structure of bbbb at ph 10.0 with mpd as the cryoprotectant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
266
Chain Sequence
PQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 266
sequence length 274
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2013-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4kxoA00
1O23B 3I0FA 2XMHA 4FCEA 1K4VA 5C47A 1ZJ2A 3U2WA 2QGIA 1INJA 2WAWA 2QH5A 4CJCA 5HS2A 2OEGA 2VSHA 1GA8A 2X5SA 3IOHA 1HJJA 1E5KA 3U0YA 4C2SA 2RIYA 4KNRA 4EE5A 2JCLA 2Z86A 2XWNA 3V90A 4LW3A 1ZI4A 1NQIB 1WT2A 3QVBA 2GGQA 2V0LA 4KT7A 1NWGB 2AM5A 1VGZA 3I0CA 1KWSA 2A8UA 3OH3A 3E25A 4HCQA 2X5ZA 4B4GA 1H4DA 1FRWA 4KQLA 3IOJA 1ZIZA 5C48A 3OKRA 2FFVA 4KNXA 1NF5B 4B4BA 5FU0A 4FRDA 3CKNA 1S4NA 4KC1A 1PZYB 2QKXA 1TW5A 2YQHA 1VGTA 3ZGFA 1VGWA 4EVWA 2E8BA 2AESA 4EEOA 3CGXA 3RMVA 2FY7A 1NHEB 4Y64A 4EE3A 1G97A 3SXAA 1G2VA 2Z87A 3USQA 1H7QA 1H5SD 2OI5A 1O7QA 3E26A 2PA4A 4B42A 2ZU7A 5C36A 3PNNA 1H7LA 2CU2A 1G0RA 1VGUA 3O3PA 4Y7FA 1ZJPA 5C3DA 2JCOA 1H7GA 1W57A 4HO6A 5DDTA 1LZIA 1FGGA 1IIMA 1SS9A 1HM9A 4HG6A 3I0JA 2W0WA 3K8DA 2V0HA 5CQOA 5C49A 3SXBA 2VXMA 4BMAA 1VZXA 2Q4JA 1H5TB 4Y7TA 1QGSA 5FUHA 4NAIA 1FG5N 2AE7A 2VXLA 3CKJA 2RITA 2PGVA 1H5RA 3NGWA 4YS8A 4UEGA 5FYEA 1GX4A 1WT0A 3OH4A 2JCJA 4ARWA 3I0IX 3OAMA 4Y7UA 4K6RA 2D0JA 1VZTA 3SX5A 1FXJA 3PKQA 3TZTA 1EYRA 1VPAA 3D98A 5C38A 2BO8A 3V0NA 1LZ7A 2WVMA 4AYLA 1GQ9A 1YROB 5C3AA 2X65A 5AJNA 3SPTA 2D7IA 2OEFA 2YQCA 1H7TA 5FTSA 3V8ZA 5C8RA 3U0XA 1G23A 2YQSA 5CMGX 1VH3A 4KRVA 1H5TA 4EEMA 3T7MA 5CQPA 1ON6A 2RJ6A 2OI6A 5CMHA 3U2VA 1OMXA 1ZDGA 1I52A 2Y4LA 1ZJ3A 4IRQA 1OQMB 5C1GA 4KXOA 4G3QA 2WVLA 2PGYA 2FYCB 1ZI1A 3V0LA 2DPWA 2I7BA 1R7UA 4Y62A 4Y7VA 1HV9A 5EIYA 5FTVA 2ZU9A 5CQLX 5IFYA 1G95A 1FO8A 5I1FA 2YC3A 3CKQA 1G3LA 1LL2A 1G1LA 5JQQA 1GX0A 1FZWA 4JISA 1OMZA 4KC2A 1VH1A 2Y6PA 5DDVA 5CMJA 2O1FA 3U2TA 2BO7A 4KPZA 1ZI3A 1WT1A 2YESA 3I0LA 4NANA 3RMWA 4DECA 3OC9A 2RJ7A 4LW6A 5BXCA 2AGDA 1GWWA 2V0KA 1JV1A 2E3DA 5CMIA 2AH9A 2P73A 3JTJA 4FRMA 1H5RB 1HM0A 4EE4A 3Q4SA 4FCUA 2WEEA 3IOIA 4AAWA 2P72A 4BQHA 3DK5A 5C3BA 2AECA 4FROA 3CKOA 3CU0A 2APCA 5AJOA 3SX3A 2WE9A 3KIAA 5EJ1A 2Y7AA 1R81A 2FYAA 2YQJA 1WT3A 5CQNX 3HL3A 1H5SC 1W55A 2VS3A 5L6SA 4CJ8A 2VS4A 2W0VA 2YCMA 4HOCA 1R80A 1JVDA 4FRLA 1HJLA 1NKHB 2VSIA 5L6VA 1FWYA 3SXEA 1MC3A 2BO4A 2VS5A 4XWIA 3I0KA 3V91A 4CVHA 3SX8A 4FRAA 4ASJA 4HO3A 3SXGA 3F1YA 2RIZA 1R7VA 3ZGGA 3FWWA 1FOAA 5FU8A 1V83A 4KC4A 3I0GA 5CQMX 1V84A 3PKPA 4FRHA 5C1HA 3JUJA 1JV3A 4IRPA 1JYKA 2AM3A 1QGQA 1MP4A 1YP3A 4HO4A 1H5SA 3U2UA 1ZJOA 3OGZA 2P6WA 4KPXA 3V0QA 3CKVA 1GQCA 5C1LA 2D7RA 4Y63A 2RJ1A 1H3MA 3JUKA 1MP5A 2O1HA 4Y6NA 3TQDA 2GGOA 1Z90A 2I5EA 2PX7A 4R7PA 4HO9A 3LW6A 4G3SA 1ZCUA 1FR9A 3R2WA 2XMEA 4B3UA 1EZIA 2RIXA 2Y4JA 2I5KA 4DDZA 1IINA 2V0JA 3OH1A 1YP4A 2VFZA 4M4KA 5CMFX 2UX8A 3R3IA 3T7OA 3V0OA 3I0HA 4MNDA 2XWLA 1H7HA 4E1KA 3F1CA 1H7FA 3POLA 1V82A 4G3PA 1ZHJA 1O7OA 3D8VA 1LZJA 5C4BA 4MYBA 1QG8A 1WSZA 3GUEA 5C4DA 3Q80A 1S4OA 1G93A 4B4MA 1H4CA 2WVKA 1JVGA 2ICYA 3DJ4A 1ZI5A 4D0ZA 4B2WA 4CJBA 4EEGA 4FREA 4D48A 1ZJ1A 1ZCTA 1WVCA 3V8YA 1LZ0A 2YC5A 4P02A 3RSBA 5C4EA 1GWVA 2RJ8A 4ECMA 2BO6A 4Y7GA 4FRPA 2JCKA 1TZFA 4ASYA 3DUVA 3Q7UA 4EEAA 4B5BA 3T7NA 3ZLKA 3D5NA 4AYJA 4Y9XA 1HM8A 3N9WA 5C4CA 1ZCVA 3ZF8A 4HO5A 1JYLA 3BCVA 2ZU8A 1G8OA 3OH2A 2WGZA 3BRKX 1MP3A 3V0PA 1VM8A 1H5SB 4FRBA 4Y6UA 3SXCA 2VD4A 1YP2A 3V0MA 1LVWA 3ST8A 5EJZA 2V0IA 1FGXA 1ZDFA 4G87A 3I0DA 3K8EA 1H7EA 2X60A 4GBPA 3SX7A 1R82A 4ZDQA 2Y4MA 1LL0A 3EE5A 1TW1A 1G9RA 1H4EA 5FV9A 5IDTA 2FYDB 1ZJ0A 1ON8A 1XHBA 5J49A 2FFUA 2FYBA 2XWMA 4JD0A 4HO2A 4L41C 1NMMB 1R7TA 4M2AA 3USRA 2MZBA 1XZ6A 4HO8A 2A8WA 4D11C 4NAKA 1INIA 2NXVA 1VZUA 1LL3A 2RJ4A 1VICA 2Y4KA 1O0RA 1ZCYA 3U2XA 1R7XA 1W77A 4M28A 4FQWA 4DE7A 4M2BA 2AM4A 2OI7A 4J18A 1FR8A 1FO9A 5C4FA 5AJPA 1QWJA 3ZLLA 4NALA 4AC3A 1TVYA 2ICXA 4HO0A 1S4PA 3SXDA 4D0TA 2O1GA 1PZTA 2RJ0A 4FRQA 1FXOA 4D11A 5IDSA 2RJ5A 4P00A 2RJ9A 3OH0A 1R7YA 3FOQA 4B2XA 3I0EA
chains in the Genus database with same CATH superfamily
1O23B 3I0FA 2XMHA 4FCEA 1K4VA 5C47A 1ZJ2A 3U2WA 2QGIA 1INJA 2WAWA 2QH5A 4CJCA 5HS2A 2OEGA 2VSHA 1GA8A 2X5SA 3IOHA 1HJJA 1E5KA 3U0YA 4C2SA 2RIYA 4KNRA 4EE5A 2JCLA 2Z86A 2C0NA 2XWNA 3V90A 4LW3A 1ZI4A 1NQIB 1WT2A 3QVBA 2GGQA 2V0LA 4KT7A 1NWGB 2AM5A 1VGZA 3I0CA 1KWSA 2A8UA 3OH3A 3E25A 4HCQA 2X5ZA 4B4GA 1H4DA 1FRWA 4KQLA 3IOJA 1ZIZA 5C48A 3OKRA 2FFVA 4KNXA 1NF5B 4B4BA 5FU0A 4FRDA 3CKNA 1S4NA 4KC1A 1PZYB 2QKXA 1TW5A 2YQHA 1VGTA 3ZGFA 1VGWA 4EVWA 2E8BA 2AESA 4EEOA 3CGXA 3RMVA 2FY7A 1NHEB 4Y64A 4EE3A 1G97A 3SXAA 1G2VA 2Z87A 3USQA 1H7QA 1H5SD 2OI5A 1O7QA 3E26A 2PA4A 4B42A 2ZU7A 5C36A 3PNNA 1H7LA 2CU2A 1G0RA 1VGUA 3O3PA 4Y7FA 1ZJPA 5C3DA 2JCOA 1H7GA 1W57A 4HO6A 5DDTA 1LZIA 1FGGA 1IIMA 1SS9A 1HM9A 4HG6A 3I0JA 2W0WA 3K8DA 2V0HA 5CQOA 5C49A 3SXBA 2VXMA 4BMAA 1VZXA 2Q4JA 1H5TB 4Y7TA 1QGSA 5FUHA 4NAIA 1FG5N 2AE7A 2VXLA 3CKJA 2RITA 2PGVA 1H5RA 3NGWA 4YS8A 4UEGA 5FYEA 1GX4A 1WT0A 3OH4A 2JCJA 4ARWA 3I0IX 3OAMA 4Y7UA 4K6RA 2D0JA 1VZTA 3SX5A 4O6MA 1FXJA 3PKQA 3TZTA 1EYRA 1VPAA 3D98A 5C38A 2BO8A 3V0NA 1LZ7A 2WVMA 4AYLA 1GQ9A 1YROB 5C3AA 2X65A 5AJNA 3SPTA 2D7IA 2J0AA 2OEFA 2YQCA 1H7TA 5FTSA 3V8ZA 5C8RA 3U0XA 1G23A 2YQSA 5CMGX 1VH3A 4KRVA 1H5TA 4EEMA 3T7MA 5CQPA 1ON6A 2RJ6A 2OI6A 5CMHA 3U2VA 1OMXA 1ZDGA 1I52A 2Y4LA 1ZJ3A 4IRQA 1OQMB 5C1GA 4KXOA 4G3QA 2WVLA 2PGYA 2FYCB 1ZI1A 3V0LA 2DPWA 2I7BA 1R7UA 2VK9A 4Y62A 4Y7VA 1HV9A 5EIYA 5FTVA 2ZU9A 5CQLX 5IFYA 1G95A 1FO8A 5I1FA 2YC3A 3CKQA 1G3LA 1LL2A 1G1LA 5JQQA 1GX0A 1FZWA 4JISA 1OMZA 4KC2A 1VH1A 2Y6PA 5DDVA 5CMJA 2O1FA 3U2TA 2BO7A 4KPZA 1ZI3A 1WT1A 2YESA 3I0LA 4NANA 3RMWA 4DECA 3OC9A 2RJ7A 4LW6A 5BXCA 2AGDA 1GWWA 2V0KA 1JV1A 2E3DA 5CMIA 2AH9A 2P73A 3JTJA 4FRMA 1H5RB 1HM0A 4EE4A 3Q4SA 4FCUA 2WEEA 3IOIA 4AAWA 2P72A 4BQHA 3DK5A 5C3BA 2AECA 4FROA 3CKOA 3CU0A 2APCA 5AJOA 3SX3A 2WE9A 3KIAA 5EJ1A 2Y7AA 1R81A 2FYAA 2YQJA 1WT3A 5D91A 5CQNX 3HL3A 1H5SC 1W55A 2VS3A 5L6SA 4CJ8A 2VS4A 2W0VA 2YCMA 4HOCA 1R80A 1JVDA 4FRLA 1HJLA 1NKHB 2VSIA 4O6NA 5L6VA 1FWYA 3SXEA 1MC3A 2BO4A 4FIXA 2VS5A 4XWIA 3I0KA 3V91A 4CVHA 3SX8A 4FRAA 4ASJA 4HO3A 3SXGA 3F1YA 2RIZA 1R7VA 3ZGGA 3FWWA 1FOAA 5FU8A 1V83A 4KC4A 3I0GA 5CQMX 1V84A 3PKPA 4FRHA 5C1HA 3JUJA 1JV3A 4IRPA 1JYKA 2AM3A 1QGQA 1MP4A 1YP3A 4HO4A 1H5SA 3U2UA 1ZJOA 3OGZA 2P6WA 4KPXA 3V0QA 3CKVA 1GQCA 5C1LA 2D7RA 4Y63A 2RJ1A 1H3MA 3JUKA 1MP5A 2J0BA 2O1HA 4Y6NA 3TQDA 2GGOA 1Z90A 2I5EA 2PX7A 4R7PA 4HO9A 3LW6A 4G3SA 1ZCUA 1FR9A 3R2WA 2XMEA 4B3UA 1EZIA 2RIXA 2Y4JA 2I5KA 4DDZA 1IINA 2V0JA 3OH1A 1YP4A 2VFZA 4M4KA 5CMFX 2UX8A 3R3IA 3T7OA 3V0OA 3I0HA 4MIXA 4MNDA 2XWLA 1H7HA 4E1KA 3F1CA 1H7FA 3POLA 1V82A 4G3PA 1ZHJA 1O7OA 3D8VA 1LZJA 5C4BA 4MYBA 1QG8A 1WSZA 3GUEA 5C4DA 3Q80A 1S4OA 1G93A 4B4MA 1H4CA 2WVKA 1JVGA 2ICYA 3DJ4A 1ZI5A 4D0ZA 4B2WA 4CJBA 4EEGA 4FREA 4D48A 1ZJ1A 1ZCTA 1WVCA 3V8YA 1LZ0A 2YC5A 4P02A 3RSBA 5C4EA 1GWVA 2RJ8A 4ECMA 2BO6A 4Y7GA 4FRPA 2JCKA 1TZFA 4ASYA 4Q7CA 3DUVA 3Q7UA 4EEAA 4B5BA 3T7NA 3ZLKA 3D5NA 4AYJA 4Y9XA 1HM8A 3N9WA 5C4CA 1ZCVA 3ZF8A 4HO5A 1JYLA 3BCVA 2ZU8A 1G8OA 3OH2A 2WGZA 3BRKX 1MP3A 3V0PA 5D92A 1VM8A 1H5SB 4FRBA 4Y6UA 3SXCA 2VD4A 1YP2A 3V0MA 1LVWA 3ST8A 5EJZA 2V0IA 1FGXA 1ZDFA 4G87A 3I0DA 3K8EA 1H7EA 2X60A 4GBPA 3SX7A 1R82A 4ZDQA 2Y4MA 1LL0A 3EE5A 1TW1A 1G9RA 1H4EA 5FV9A 5IDTA 2FYDB 1ZJ0A 1ON8A 1XHBA 5J49A 2FFUA 2FYBA 2XWMA 4JD0A 4HO2A 4L41C 1NMMB 1R7TA 4M2AA 3USRA 2MZBA 1XZ6A 4HO8A 2A8WA 4D11C 4NAKA 1INIA 2NXVA 1VZUA 1LL3A 2RJ4A 1VICA 2Y4KA 1O0RA 1ZCYA 3U2XA 1R7XA 1W77A 4M28A 4FQWA 4DE7A 4M2BA 2AM4A 2OI7A 4J18A 4FIYA 1FR8A 1FO9A 5C4FA 5AJPA 1QWJA 3ZLLA 4NALA 4AC3A 1TVYA 2ICXA 4HO0A 1S4PA 3SXDA 4D0TA 2O1GA 1PZTA 2RJ0A 4FRQA 1FXOA 4D11A 5IDSA 2RJ5A 4P00A 2RJ9A 3OH0A 1R7YA 3FOQA 4B2XA 3I0EA
chains in the Genus database with same CATH topology
1O23B 3I0FA 2XMHA 4FCEA 1K4VA 5C47A 1ZJ2A 3U2WA 2QGIA 1INJA 2WAWA 2QH5A 4CJCA 5HS2A 2OEGA 2VSHA 1GA8A 2X5SA 3IOHA 1HJJA 1E5KA 3U0YA 4C2SA 2RIYA 4KNRA 4EE5A 2JCLA 2Z86A 2C0NA 2XWNA 3V90A 4LW3A 1ZI4A 1NQIB 1WT2A 3QVBA 2GGQA 2V0LA 4KT7A 1NWGB 2AM5A 1VGZA 3I0CA 1KWSA 2A8UA 3OH3A 3E25A 4HCQA 2X5ZA 4B4GA 1H4DA 1FRWA 4KQLA 3IOJA 1ZIZA 5C48A 3OKRA 2FFVA 4KNXA 1NF5B 4B4BA 5FU0A 4FRDA 3CKNA 1S4NA 4KC1A 1PZYB 2QKXA 1TW5A 2YQHA 1VGTA 3ZGFA 1VGWA 4EVWA 2E8BA 2AESA 4EEOA 3CGXA 3RMVA 2FY7A 1NHEB 4Y64A 4EE3A 1G97A 3SXAA 1G2VA 2Z87A 3USQA 1H7QA 1H5SD 2OI5A 1O7QA 3E26A 2PA4A 4B42A 2ZU7A 5C36A 3PNNA 1H7LA 2CU2A 1G0RA 1VGUA 3O3PA 4Y7FA 1ZJPA 5C3DA 2JCOA 1H7GA 1W57A 4HO6A 5DDTA 1LZIA 1FGGA 1IIMA 1SS9A 1HM9A 4HG6A 3I0JA 2W0WA 3K8DA 2V0HA 5CQOA 5C49A 3SXBA 2VXMA 4BMAA 1VZXA 2Q4JA 1H5TB 4Y7TA 1QGSA 5FUHA 4NAIA 1FG5N 2AE7A 2VXLA 3CKJA 2RITA 2PGVA 1H5RA 3NGWA 4YS8A 4UEGA 5FYEA 1GX4A 1WT0A 3OH4A 2JCJA 4ARWA 3I0IX 3OAMA 4Y7UA 4K6RA 2D0JA 1VZTA 3SX5A 4O6MA 1FXJA 3PKQA 3TZTA 1EYRA 1VPAA 3D98A 5C38A 2BO8A 3V0NA 1LZ7A 2WVMA 4AYLA 1GQ9A 1YROB 5C3AA 2X65A 5AJNA 3SPTA 2D7IA 2J0AA 2OEFA 2YQCA 1H7TA 5FTSA 3V8ZA 5C8RA 3U0XA 1G23A 2YQSA 5CMGX 1VH3A 4KRVA 1H5TA 4EEMA 3T7MA 5CQPA 1ON6A 2RJ6A 2OI6A 5CMHA 3U2VA 1OMXA 1ZDGA 1I52A 2Y4LA 1ZJ3A 4IRQA 1OQMB 5C1GA 4KXOA 4G3QA 2WVLA 2PGYA 2FYCB 1ZI1A 3V0LA 2DPWA 2I7BA 1R7UA 2VK9A 4Y62A 4Y7VA 1HV9A 5EIYA 5FTVA 2ZU9A 5CQLX 5IFYA 1G95A 1FO8A 5I1FA 2YC3A 3CKQA 1G3LA 1LL2A 1G1LA 5JQQA 1GX0A 1FZWA 4JISA 1OMZA 4KC2A 1VH1A 2Y6PA 5DDVA 5CMJA 2O1FA 3U2TA 2BO7A 4KPZA 1ZI3A 1WT1A 2YESA 3I0LA 4NANA 3RMWA 4DECA 3OC9A 2RJ7A 4LW6A 5BXCA 2AGDA 1GWWA 2V0KA 1JV1A 2E3DA 5CMIA 2AH9A 2P73A 3JTJA 4FRMA 1H5RB 1HM0A 4EE4A 3Q4SA 4FCUA 2WEEA 3IOIA 4AAWA 2P72A 4BQHA 3DK5A 5C3BA 2AECA 4FROA 3CKOA 3CU0A 2APCA 5AJOA 3SX3A 2WE9A 3KIAA 5EJ1A 2Y7AA 1R81A 2FYAA 2YQJA 1WT3A 5D91A 5CQNX 3HL3A 1H5SC 1W55A 2VS3A 5L6SA 4CJ8A 2VS4A 2W0VA 2YCMA 4HOCA 1R80A 1JVDA 4FRLA 1HJLA 1NKHB 2VSIA 4O6NA 5L6VA 1FWYA 3SXEA 1MC3A 2BO4A 4FIXA 2VS5A 4XWIA 3I0KA 3V91A 4CVHA 3SX8A 4FRAA 4ASJA 4HO3A 3SXGA 3F1YA 2RIZA 1R7VA 3ZGGA 3FWWA 1FOAA 5FU8A 1V83A 4KC4A 3I0GA 5CQMX 1V84A 3PKPA 4FRHA 5C1HA 3JUJA 1JV3A 4IRPA 1JYKA 2AM3A 1QGQA 1MP4A 1YP3A 4HO4A 1H5SA 3U2UA 1ZJOA 3OGZA 2P6WA 4KPXA 3V0QA 3CKVA 1GQCA 5C1LA 2D7RA 4Y63A 2RJ1A 1H3MA 3JUKA 1MP5A 2J0BA 2O1HA 4Y6NA 3TQDA 2GGOA 1Z90A 2I5EA 2PX7A 4R7PA 4HO9A 3LW6A 4G3SA 1ZCUA 1FR9A 3R2WA 2XMEA 4B3UA 1EZIA 2RIXA 2Y4JA 2I5KA 4DDZA 1IINA 2V0JA 3OH1A 1YP4A 2VFZA 4M4KA 5CMFX 2UX8A 3R3IA 3T7OA 3V0OA 3I0HA 4MIXA 4MNDA 2XWLA 1H7HA 4E1KA 3F1CA 1H7FA 3POLA 1V82A 4G3PA 1ZHJA 1O7OA 3D8VA 1LZJA 5C4BA 4MYBA 1QG8A 1WSZA 3GUEA 5C4DA 3Q80A 1S4OA 1G93A 4B4MA 1H4CA 2WVKA 1JVGA 2ICYA 3DJ4A 1ZI5A 4D0ZA 4B2WA 4CJBA 4EEGA 4FREA 4D48A 1ZJ1A 1ZCTA 1WVCA 3V8YA 1LZ0A 2YC5A 4P02A 3RSBA 5C4EA 1GWVA 2RJ8A 4ECMA 2BO6A 4Y7GA 4FRPA 2JCKA 1TZFA 4ASYA 4Q7CA 3DUVA 3Q7UA 4EEAA 4B5BA 3T7NA 3ZLKA 3D5NA 4AYJA 4Y9XA 1HM8A 3N9WA 5C4CA 1ZCVA 3ZF8A 4HO5A 1JYLA 3BCVA 2ZU8A 1G8OA 3OH2A 2WGZA 3BRKX 1MP3A 3V0PA 5D92A 1VM8A 1H5SB 4FRBA 4Y6UA 3SXCA 2VD4A 1YP2A 3V0MA 1LVWA 3ST8A 5EJZA 2V0IA 1FGXA 1ZDFA 4G87A 3I0DA 3K8EA 1H7EA 2X60A 4GBPA 3SX7A 1R82A 4ZDQA 2Y4MA 1LL0A 3EE5A 1TW1A 1G9RA 1H4EA 5FV9A 5IDTA 2FYDB 1ZJ0A 1ON8A 1XHBA 5J49A 2FFUA 2FYBA 2XWMA 4JD0A 4HO2A 4L41C 1NMMB 1R7TA 4M2AA 3USRA 2MZBA 1XZ6A 4HO8A 2A8WA 4D11C 4NAKA 1INIA 2NXVA 1VZUA 1LL3A 2RJ4A 1VICA 2Y4KA 1O0RA 1ZCYA 3U2XA 1R7XA 1W77A 4M28A 4FQWA 4DE7A 4M2BA 2AM4A 2OI7A 4J18A 4FIYA 1FR8A 1FO9A 5C4FA 5AJPA 1QWJA 3ZLLA 4NALA 4AC3A 1TVYA 2ICXA 4HO0A 1S4PA 3SXDA 4D0TA 2O1GA 1PZTA 2RJ0A 4FRQA 1FXOA 4D11A 5IDSA 2RJ5A 4P00A 2RJ9A 3OH0A 1R7YA 3FOQA 4B2XA 3I0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O23 B;  3I0F A;  2XMH A;  4FCE A;  1K4V A;  5C47 A;  1ZJ2 A;  3U2W A;  2QGI A;  1INJ A;  2WAW A;  2QH5 A;  4CJC A;  5HS2 A;  2OEG A;  2VSH A;  1GA8 A;  2X5S A;  3IOH A;  1HJJ A;  1E5K A;  3U0Y A;  4C2S A;  2RIY A;  4KNR A;  4EE5 A;  2JCL A;  2Z86 A;  2XWN A;  3V90 A;  4LW3 A;  1ZI4 A;  1NQI B;  1WT2 A;  3QVB A;  2GGQ A;  2V0L A;  4KT7 A;  1NWG B;  2AM5 A;  1VGZ A;  3I0C A;  1KWS A;  2A8U A;  3OH3 A;  3E25 A;  4HCQ A;  2X5Z A;  4B4G A;  1H4D A;  1FRW A;  4KQL A;  3IOJ A;  1ZIZ A;  5C48 A;  3OKR A;  2FFV A;  4KNX A;  1NF5 B;  4B4B A;  5FU0 A;  4FRD A;  3CKN A;  1S4N A;  4KC1 A;  1PZY B;  2QKX A;  1TW5 A;  2YQH A;  1VGT A;  3ZGF A;  1VGW A;  4EVW A;  2E8B A;  2AES A;  4EEO A;  3CGX A;  3RMV A;  2FY7 A;  1NHE B;  4Y64 A;  4EE3 A;  1G97 A;  3SXA A;  1G2V A;  2Z87 A;  3USQ A;  1H7Q A;  1H5S D;  2OI5 A;  1O7Q A;  3E26 A;  2PA4 A;  4B42 A;  2ZU7 A;  5C36 A;  3PNN A;  1H7L A;  2CU2 A;  1G0R A;  1VGU A;  3O3P A;  4Y7F A;  1ZJP A;  5C3D A;  2JCO A;  1H7G A;  1W57 A;  4HO6 A;  5DDT A;  1LZI A;  1FGG A;  1IIM A;  1SS9 A;  1HM9 A;  4HG6 A;  3I0J A;  2W0W A;  3K8D A;  2V0H A;  5CQO A;  5C49 A;  3SXB A;  2VXM A;  4BMA A;  1VZX A;  2Q4J A;  1H5T B;  4Y7T A;  1QGS A;  5FUH A;  4NAI A;  1FG5 N;  2AE7 A;  2VXL A;  3CKJ A;  2RIT A;  2PGV A;  1H5R A;  3NGW A;  4YS8 A;  4UEG A;  5FYE A;  1GX4 A;  1WT0 A;  3OH4 A;  2JCJ A;  4ARW A;  3I0I X;  3OAM A;  4Y7U A;  4K6R A;  2D0J A;  1VZT A;  3SX5 A;  1FXJ A;  3PKQ A;  3TZT A;  1EYR A;  1VPA A;  3D98 A;  5C38 A;  2BO8 A;  3V0N A;  1LZ7 A;  2WVM A;  4AYL A;  1GQ9 A;  1YRO B;  5C3A A;  2X65 A;  5AJN A;  3SPT A;  2D7I A;  2OEF A;  2YQC A;  1H7T A;  5FTS A;  3V8Z A;  5C8R A;  3U0X A;  1G23 A;  2YQS A;  5CMG X;  1VH3 A;  4KRV A;  1H5T A;  4EEM A;  3T7M A;  5CQP A;  1ON6 A;  2RJ6 A;  2OI6 A;  5CMH A;  3U2V A;  1OMX A;  1ZDG A;  1I52 A;  2Y4L A;  1ZJ3 A;  4IRQ A;  1OQM B;  5C1G A;  4KXO A;  4G3Q A;  2WVL A;  2PGY A;  2FYC B;  1ZI1 A;  3V0L A;  2DPW A;  2I7B A;  1R7U A;  4Y62 A;  4Y7V A;  1HV9 A;  5EIY A;  5FTV A;  2ZU9 A;  5CQL X;  5IFY A;  1G95 A;  1FO8 A;  5I1F A;  2YC3 A;  3CKQ A;  1G3L A;  1LL2 A;  1G1L A;  5JQQ A;  1GX0 A;  1FZW A;  4JIS A;  1OMZ A;  4KC2 A;  1VH1 A;  2Y6P A;  5DDV A;  5CMJ A;  2O1F A;  3U2T A;  2BO7 A;  4KPZ A;  1ZI3 A;  1WT1 A;  2YES A;  3I0L A;  4NAN A;  3RMW A;  4DEC A;  3OC9 A;  2RJ7 A;  4LW6 A;  5BXC A;  2AGD A;  1GWW A;  2V0K A;  1JV1 A;  2E3D A;  5CMI A;  2AH9 A;  2P73 A;  3JTJ A;  4FRM A;  1H5R B;  1HM0 A;  4EE4 A;  3Q4S A;  4FCU A;  2WEE A;  3IOI A;  4AAW A;  2P72 A;  4BQH A;  3DK5 A;  5C3B A;  2AEC A;  4FRO A;  3CKO A;  3CU0 A;  2APC A;  5AJO A;  3SX3 A;  2WE9 A;  3KIA A;  5EJ1 A;  2Y7A A;  1R81 A;  2FYA A;  2YQJ A;  1WT3 A;  5CQN X;  3HL3 A;  1H5S C;  1W55 A;  2VS3 A;  5L6S A;  4CJ8 A;  2VS4 A;  2W0V A;  2YCM A;  4HOC A;  1R80 A;  1JVD A;  4FRL A;  1HJL A;  1NKH B;  2VSI A;  5L6V A;  1FWY A;  3SXE A;  1MC3 A;  2BO4 A;  2VS5 A;  4XWI A;  3I0K A;  3V91 A;  4CVH A;  3SX8 A;  4FRA A;  4ASJ A;  4HO3 A;  3SXG A;  3F1Y A;  2RIZ A;  1R7V A;  3ZGG A;  3FWW A;  1FOA A;  5FU8 A;  1V83 A;  4KC4 A;  3I0G A;  5CQM X;  1V84 A;  3PKP A;  4FRH A;  5C1H A;  3JUJ A;  1JV3 A;  4IRP A;  1JYK A;  2AM3 A;  1QGQ A;  1MP4 A;  1YP3 A;  4HO4 A;  1H5S A;  3U2U A;  1ZJO A;  3OGZ A;  2P6W A;  4KPX A;  3V0Q A;  3CKV A;  1GQC A;  5C1L A;  2D7R A;  4Y63 A;  2RJ1 A;  1H3M A;  3JUK A;  1MP5 A;  2O1H A;  4Y6N A;  3TQD A;  2GGO A;  1Z90 A;  2I5E A;  2PX7 A;  4R7P A;  4HO9 A;  3LW6 A;  4G3S A;  1ZCU A;  1FR9 A;  3R2W A;  2XME A;  4B3U A;  1EZI A;  2RIX A;  2Y4J A;  2I5K A;  4DDZ A;  1IIN A;  2V0J A;  3OH1 A;  1YP4 A;  2VFZ A;  4M4K A;  5CMF X;  2UX8 A;  3R3I A;  3T7O A;  3V0O A;  3I0H A;  4MND A;  2XWL A;  1H7H A;  4E1K A;  3F1C A;  1H7F A;  3POL A;  1V82 A;  4G3P A;  1ZHJ A;  1O7O A;  3D8V A;  1LZJ A;  5C4B A;  4MYB A;  1QG8 A;  1WSZ A;  3GUE A;  5C4D A;  3Q80 A;  1S4O A;  1G93 A;  4B4M A;  1H4C A;  2WVK A;  1JVG A;  2ICY A;  3DJ4 A;  1ZI5 A;  4D0Z A;  4B2W A;  4CJB A;  4EEG A;  4FRE A;  4D48 A;  1ZJ1 A;  1ZCT A;  1WVC A;  3V8Y A;  1LZ0 A;  2YC5 A;  4P02 A;  3RSB A;  5C4E A;  1GWV A;  2RJ8 A;  4ECM A;  2BO6 A;  4Y7G A;  4FRP A;  2JCK A;  1TZF A;  4ASY A;  3DUV A;  3Q7U A;  4EEA A;  4B5B A;  3T7N A;  3ZLK A;  3D5N A;  4AYJ A;  4Y9X A;  1HM8 A;  3N9W A;  5C4C A;  1ZCV A;  3ZF8 A;  4HO5 A;  1JYL A;  3BCV A;  2ZU8 A;  1G8O A;  3OH2 A;  2WGZ A;  3BRK X;  1MP3 A;  3V0P A;  1VM8 A;  1H5S B;  4FRB A;  4Y6U A;  3SXC A;  2VD4 A;  1YP2 A;  3V0M A;  1LVW A;  3ST8 A;  5EJZ A;  2V0I A;  1FGX A;  1ZDF A;  4G87 A;  3I0D A;  3K8E A;  1H7E A;  2X60 A;  4GBP A;  3SX7 A;  1R82 A;  4ZDQ A;  2Y4M A;  1LL0 A;  3EE5 A;  1TW1 A;  1G9R A;  1H4E A;  5FV9 A;  5IDT A;  2FYD B;  1ZJ0 A;  1ON8 A;  1XHB A;  5J49 A;  2FFU A;  2FYB A;  2XWM A;  4JD0 A;  4HO2 A;  4L41 C;  1NMM B;  1R7T A;  4M2A A;  3USR A;  2MZB A;  1XZ6 A;  4HO8 A;  2A8W A;  4D11 C;  4NAK A;  1INI A;  2NXV A;  1VZU A;  1LL3 A;  2RJ4 A;  1VIC A;  2Y4K A;  1O0R A;  1ZCY A;  3U2X A;  1R7X A;  1W77 A;  4M28 A;  4FQW A;  4DE7 A;  4M2B A;  2AM4 A;  2OI7 A;  4J18 A;  1FR8 A;  1FO9 A;  5C4F A;  5AJP A;  1QWJ A;  3ZLL A;  4NAL A;  4AC3 A;  1TVY A;  2ICX A;  4HO0 A;  1S4P A;  3SXD A;  4D0T A;  2O1G A;  1PZT A;  2RJ0 A;  4FRQ A;  1FXO A;  4D11 A;  5IDS A;  2RJ5 A;  4P00 A;  2RJ9 A;  3OH0 A;  1R7Y A;  3FOQ A;  4B2X A;  3I0E A; 
#chains in the Genus database with same CATH topology
 1O23 B;  3I0F A;  2XMH A;  4FCE A;  1K4V A;  5C47 A;  1ZJ2 A;  3U2W A;  2QGI A;  1INJ A;  2WAW A;  2QH5 A;  4CJC A;  5HS2 A;  2OEG A;  2VSH A;  1GA8 A;  2X5S A;  3IOH A;  1HJJ A;  1E5K A;  3U0Y A;  4C2S A;  2RIY A;  4KNR A;  4EE5 A;  2JCL A;  2Z86 A;  2C0N A;  2XWN A;  3V90 A;  4LW3 A;  1ZI4 A;  1NQI B;  1WT2 A;  3QVB A;  2GGQ A;  2V0L A;  4KT7 A;  1NWG B;  2AM5 A;  1VGZ A;  3I0C A;  1KWS A;  2A8U A;  3OH3 A;  3E25 A;  4HCQ A;  2X5Z A;  4B4G A;  1H4D A;  1FRW A;  4KQL A;  3IOJ A;  1ZIZ A;  5C48 A;  3OKR A;  2FFV A;  4KNX A;  1NF5 B;  4B4B A;  5FU0 A;  4FRD A;  3CKN A;  1S4N A;  4KC1 A;  1PZY B;  2QKX A;  1TW5 A;  2YQH A;  1VGT A;  3ZGF A;  1VGW A;  4EVW A;  2E8B A;  2AES A;  4EEO A;  3CGX A;  3RMV A;  2FY7 A;  1NHE B;  4Y64 A;  4EE3 A;  1G97 A;  3SXA A;  1G2V A;  2Z87 A;  3USQ A;  1H7Q A;  1H5S D;  2OI5 A;  1O7Q A;  3E26 A;  2PA4 A;  4B42 A;  2ZU7 A;  5C36 A;  3PNN A;  1H7L A;  2CU2 A;  1G0R A;  1VGU A;  3O3P A;  4Y7F A;  1ZJP A;  5C3D A;  2JCO A;  1H7G A;  1W57 A;  4HO6 A;  5DDT A;  1LZI A;  1FGG A;  1IIM A;  1SS9 A;  1HM9 A;  4HG6 A;  3I0J A;  2W0W A;  3K8D A;  2V0H A;  5CQO A;  5C49 A;  3SXB A;  2VXM A;  4BMA A;  1VZX A;  2Q4J A;  1H5T B;  4Y7T A;  1QGS A;  5FUH A;  4NAI A;  1FG5 N;  2AE7 A;  2VXL A;  3CKJ A;  2RIT A;  2PGV A;  1H5R A;  3NGW A;  4YS8 A;  4UEG A;  5FYE A;  1GX4 A;  1WT0 A;  3OH4 A;  2JCJ A;  4ARW A;  3I0I X;  3OAM A;  4Y7U A;  4K6R A;  2D0J A;  1VZT A;  3SX5 A;  4O6M A;  1FXJ A;  3PKQ A;  3TZT A;  1EYR A;  1VPA A;  3D98 A;  5C38 A;  2BO8 A;  3V0N A;  1LZ7 A;  2WVM A;  4AYL A;  1GQ9 A;  1YRO B;  5C3A A;  2X65 A;  5AJN A;  3SPT A;  2D7I A;  2J0A A;  2OEF A;  2YQC A;  1H7T A;  5FTS A;  3V8Z A;  5C8R A;  3U0X A;  1G23 A;  2YQS A;  5CMG X;  1VH3 A;  4KRV A;  1H5T A;  4EEM A;  3T7M A;  5CQP A;  1ON6 A;  2RJ6 A;  2OI6 A;  5CMH A;  3U2V A;  1OMX A;  1ZDG A;  1I52 A;  2Y4L A;  1ZJ3 A;  4IRQ A;  1OQM B;  5C1G A;  4KXO A;  4G3Q A;  2WVL A;  2PGY A;  2FYC B;  1ZI1 A;  3V0L A;  2DPW A;  2I7B A;  1R7U A;  2VK9 A;  4Y62 A;  4Y7V A;  1HV9 A;  5EIY A;  5FTV A;  2ZU9 A;  5CQL X;  5IFY A;  1G95 A;  1FO8 A;  5I1F A;  2YC3 A;  3CKQ A;  1G3L A;  1LL2 A;  1G1L A;  5JQQ A;  1GX0 A;  1FZW A;  4JIS A;  1OMZ A;  4KC2 A;  1VH1 A;  2Y6P A;  5DDV A;  5CMJ A;  2O1F A;  3U2T A;  2BO7 A;  4KPZ A;  1ZI3 A;  1WT1 A;  2YES A;  3I0L A;  4NAN A;  3RMW A;  4DEC A;  3OC9 A;  2RJ7 A;  4LW6 A;  5BXC A;  2AGD A;  1GWW A;  2V0K A;  1JV1 A;  2E3D A;  5CMI A;  2AH9 A;  2P73 A;  3JTJ A;  4FRM A;  1H5R B;  1HM0 A;  4EE4 A;  3Q4S A;  4FCU A;  2WEE A;  3IOI A;  4AAW A;  2P72 A;  4BQH A;  3DK5 A;  5C3B A;  2AEC A;  4FRO A;  3CKO A;  3CU0 A;  2APC A;  5AJO A;  3SX3 A;  2WE9 A;  3KIA A;  5EJ1 A;  2Y7A A;  1R81 A;  2FYA A;  2YQJ A;  1WT3 A;  5D91 A;  5CQN X;  3HL3 A;  1H5S C;  1W55 A;  2VS3 A;  5L6S A;  4CJ8 A;  2VS4 A;  2W0V A;  2YCM A;  4HOC A;  1R80 A;  1JVD A;  4FRL A;  1HJL A;  1NKH B;  2VSI A;  4O6N A;  5L6V A;  1FWY A;  3SXE A;  1MC3 A;  2BO4 A;  4FIX A;  2VS5 A;  4XWI A;  3I0K A;  3V91 A;  4CVH A;  3SX8 A;  4FRA A;  4ASJ A;  4HO3 A;  3SXG A;  3F1Y A;  2RIZ A;  1R7V A;  3ZGG A;  3FWW A;  1FOA A;  5FU8 A;  1V83 A;  4KC4 A;  3I0G A;  5CQM X;  1V84 A;  3PKP A;  4FRH A;  5C1H A;  3JUJ A;  1JV3 A;  4IRP A;  1JYK A;  2AM3 A;  1QGQ A;  1MP4 A;  1YP3 A;  4HO4 A;  1H5S A;  3U2U A;  1ZJO A;  3OGZ A;  2P6W A;  4KPX A;  3V0Q A;  3CKV A;  1GQC A;  5C1L A;  2D7R A;  4Y63 A;  2RJ1 A;  1H3M A;  3JUK A;  1MP5 A;  2J0B A;  2O1H A;  4Y6N A;  3TQD A;  2GGO A;  1Z90 A;  2I5E A;  2PX7 A;  4R7P A;  4HO9 A;  3LW6 A;  4G3S A;  1ZCU A;  1FR9 A;  3R2W A;  2XME A;  4B3U A;  1EZI A;  2RIX A;  2Y4J A;  2I5K A;  4DDZ A;  1IIN A;  2V0J A;  3OH1 A;  1YP4 A;  2VFZ A;  4M4K A;  5CMF X;  2UX8 A;  3R3I A;  3T7O A;  3V0O A;  3I0H A;  4MIX A;  4MND A;  2XWL A;  1H7H A;  4E1K A;  3F1C A;  1H7F A;  3POL A;  1V82 A;  4G3P A;  1ZHJ A;  1O7O A;  3D8V A;  1LZJ A;  5C4B A;  4MYB A;  1QG8 A;  1WSZ A;  3GUE A;  5C4D A;  3Q80 A;  1S4O A;  1G93 A;  4B4M A;  1H4C A;  2WVK A;  1JVG A;  2ICY A;  3DJ4 A;  1ZI5 A;  4D0Z A;  4B2W A;  4CJB A;  4EEG A;  4FRE A;  4D48 A;  1ZJ1 A;  1ZCT A;  1WVC A;  3V8Y A;  1LZ0 A;  2YC5 A;  4P02 A;  3RSB A;  5C4E A;  1GWV A;  2RJ8 A;  4ECM A;  2BO6 A;  4Y7G A;  4FRP A;  2JCK A;  1TZF A;  4ASY A;  4Q7C A;  3DUV A;  3Q7U A;  4EEA A;  4B5B A;  3T7N A;  3ZLK A;  3D5N A;  4AYJ A;  4Y9X A;  1HM8 A;  3N9W A;  5C4C A;  1ZCV A;  3ZF8 A;  4HO5 A;  1JYL A;  3BCV A;  2ZU8 A;  1G8O A;  3OH2 A;  2WGZ A;  3BRK X;  1MP3 A;  3V0P A;  5D92 A;  1VM8 A;  1H5S B;  4FRB A;  4Y6U A;  3SXC A;  2VD4 A;  1YP2 A;  3V0M A;  1LVW A;  3ST8 A;  5EJZ A;  2V0I A;  1FGX A;  1ZDF A;  4G87 A;  3I0D A;  3K8E A;  1H7E A;  2X60 A;  4GBP A;  3SX7 A;  1R82 A;  4ZDQ A;  2Y4M A;  1LL0 A;  3EE5 A;  1TW1 A;  1G9R A;  1H4E A;  5FV9 A;  5IDT A;  2FYD B;  1ZJ0 A;  1ON8 A;  1XHB A;  5J49 A;  2FFU A;  2FYB A;  2XWM A;  4JD0 A;  4HO2 A;  4L41 C;  1NMM B;  1R7T A;  4M2A A;  3USR A;  2MZB A;  1XZ6 A;  4HO8 A;  2A8W A;  4D11 C;  4NAK A;  1INI A;  2NXV A;  1VZU A;  1LL3 A;  2RJ4 A;  1VIC A;  2Y4K A;  1O0R A;  1ZCY A;  3U2X A;  1R7X A;  1W77 A;  4M28 A;  4FQW A;  4DE7 A;  4M2B A;  2AM4 A;  2OI7 A;  4J18 A;  4FIY A;  1FR8 A;  1FO9 A;  5C4F A;  5AJP A;  1QWJ A;  3ZLL A;  4NAL A;  4AC3 A;  1TVY A;  2ICX A;  4HO0 A;  1S4P A;  3SXD A;  4D0T A;  2O1G A;  1PZT A;  2RJ0 A;  4FRQ A;  1FXO A;  4D11 A;  5IDS A;  2RJ5 A;  4P00 A;  2RJ9 A;  3OH0 A;  1R7Y A;  3FOQ A;  4B2X A;  3I0E A; 
#chains in the Genus database with same CATH homology
 1O23 B;  3I0F A;  2XMH A;  4FCE A;  1K4V A;  5C47 A;  1ZJ2 A;  3U2W A;  2QGI A;  1INJ A;  2WAW A;  2QH5 A;  4CJC A;  5HS2 A;  2OEG A;  2VSH A;  1GA8 A;  2X5S A;  3IOH A;  1HJJ A;  1E5K A;  3U0Y A;  4C2S A;  2RIY A;  4KNR A;  4EE5 A;  2JCL A;  2Z86 A;  2C0N A;  2XWN A;  3V90 A;  4LW3 A;  1ZI4 A;  1NQI B;  1WT2 A;  3QVB A;  2GGQ A;  2V0L A;  4KT7 A;  1NWG B;  2AM5 A;  1VGZ A;  3I0C A;  1KWS A;  2A8U A;  3OH3 A;  3E25 A;  4HCQ A;  2X5Z A;  4B4G A;  1H4D A;  1FRW A;  4KQL A;  3IOJ A;  1ZIZ A;  5C48 A;  3OKR A;  2FFV A;  4KNX A;  1NF5 B;  4B4B A;  5FU0 A;  4FRD A;  3CKN A;  1S4N A;  4KC1 A;  1PZY B;  2QKX A;  1TW5 A;  2YQH A;  1VGT A;  3ZGF A;  1VGW A;  4EVW A;  2E8B A;  2AES A;  4EEO A;  3CGX A;  3RMV A;  2FY7 A;  1NHE B;  4Y64 A;  4EE3 A;  1G97 A;  3SXA A;  1G2V A;  2Z87 A;  3USQ A;  1H7Q A;  1H5S D;  2OI5 A;  1O7Q A;  3E26 A;  2PA4 A;  4B42 A;  2ZU7 A;  5C36 A;  3PNN A;  1H7L A;  2CU2 A;  1G0R A;  1VGU A;  3O3P A;  4Y7F A;  1ZJP A;  5C3D A;  2JCO A;  1H7G A;  1W57 A;  4HO6 A;  5DDT A;  1LZI A;  1FGG A;  1IIM A;  1SS9 A;  1HM9 A;  4HG6 A;  3I0J A;  2W0W A;  3K8D A;  2V0H A;  5CQO A;  5C49 A;  3SXB A;  2VXM A;  4BMA A;  1VZX A;  2Q4J A;  1H5T B;  4Y7T A;  1QGS A;  5FUH A;  4NAI A;  1FG5 N;  2AE7 A;  2VXL A;  3CKJ A;  2RIT A;  2PGV A;  1H5R A;  3NGW A;  4YS8 A;  4UEG A;  5FYE A;  1GX4 A;  1WT0 A;  3OH4 A;  2JCJ A;  4ARW A;  3I0I X;  3OAM A;  4Y7U A;  4K6R A;  2D0J A;  1VZT A;  3SX5 A;  4O6M A;  1FXJ A;  3PKQ A;  3TZT A;  1EYR A;  1VPA A;  3D98 A;  5C38 A;  2BO8 A;  3V0N A;  1LZ7 A;  2WVM A;  4AYL A;  1GQ9 A;  1YRO B;  5C3A A;  2X65 A;  5AJN A;  3SPT A;  2D7I A;  2J0A A;  2OEF A;  2YQC A;  1H7T A;  5FTS A;  3V8Z A;  5C8R A;  3U0X A;  1G23 A;  2YQS A;  5CMG X;  1VH3 A;  4KRV A;  1H5T A;  4EEM A;  3T7M A;  5CQP A;  1ON6 A;  2RJ6 A;  2OI6 A;  5CMH A;  3U2V A;  1OMX A;  1ZDG A;  1I52 A;  2Y4L A;  1ZJ3 A;  4IRQ A;  1OQM B;  5C1G A;  4KXO A;  4G3Q A;  2WVL A;  2PGY A;  2FYC B;  1ZI1 A;  3V0L A;  2DPW A;  2I7B A;  1R7U A;  2VK9 A;  4Y62 A;  4Y7V A;  1HV9 A;  5EIY A;  5FTV A;  2ZU9 A;  5CQL X;  5IFY A;  1G95 A;  1FO8 A;  5I1F A;  2YC3 A;  3CKQ A;  1G3L A;  1LL2 A;  1G1L A;  5JQQ A;  1GX0 A;  1FZW A;  4JIS A;  1OMZ A;  4KC2 A;  1VH1 A;  2Y6P A;  5DDV A;  5CMJ A;  2O1F A;  3U2T A;  2BO7 A;  4KPZ A;  1ZI3 A;  1WT1 A;  2YES A;  3I0L A;  4NAN A;  3RMW A;  4DEC A;  3OC9 A;  2RJ7 A;  4LW6 A;  5BXC A;  2AGD A;  1GWW A;  2V0K A;  1JV1 A;  2E3D A;  5CMI A;  2AH9 A;  2P73 A;  3JTJ A;  4FRM A;  1H5R B;  1HM0 A;  4EE4 A;  3Q4S A;  4FCU A;  2WEE A;  3IOI A;  4AAW A;  2P72 A;  4BQH A;  3DK5 A;  5C3B A;  2AEC A;  4FRO A;  3CKO A;  3CU0 A;  2APC A;  5AJO A;  3SX3 A;  2WE9 A;  3KIA A;  5EJ1 A;  2Y7A A;  1R81 A;  2FYA A;  2YQJ A;  1WT3 A;  5D91 A;  5CQN X;  3HL3 A;  1H5S C;  1W55 A;  2VS3 A;  5L6S A;  4CJ8 A;  2VS4 A;  2W0V A;  2YCM A;  4HOC A;  1R80 A;  1JVD A;  4FRL A;  1HJL A;  1NKH B;  2VSI A;  4O6N A;  5L6V A;  1FWY A;  3SXE A;  1MC3 A;  2BO4 A;  4FIX A;  2VS5 A;  4XWI A;  3I0K A;  3V91 A;  4CVH A;  3SX8 A;  4FRA A;  4ASJ A;  4HO3 A;  3SXG A;  3F1Y A;  2RIZ A;  1R7V A;  3ZGG A;  3FWW A;  1FOA A;  5FU8 A;  1V83 A;  4KC4 A;  3I0G A;  5CQM X;  1V84 A;  3PKP A;  4FRH A;  5C1H A;  3JUJ A;  1JV3 A;  4IRP A;  1JYK A;  2AM3 A;  1QGQ A;  1MP4 A;  1YP3 A;  4HO4 A;  1H5S A;  3U2U A;  1ZJO A;  3OGZ A;  2P6W A;  4KPX A;  3V0Q A;  3CKV A;  1GQC A;  5C1L A;  2D7R A;  4Y63 A;  2RJ1 A;  1H3M A;  3JUK A;  1MP5 A;  2J0B A;  2O1H A;  4Y6N A;  3TQD A;  2GGO A;  1Z90 A;  2I5E A;  2PX7 A;  4R7P A;  4HO9 A;  3LW6 A;  4G3S A;  1ZCU A;  1FR9 A;  3R2W A;  2XME A;  4B3U A;  1EZI A;  2RIX A;  2Y4J A;  2I5K A;  4DDZ A;  1IIN A;  2V0J A;  3OH1 A;  1YP4 A;  2VFZ A;  4M4K A;  5CMF X;  2UX8 A;  3R3I A;  3T7O A;  3V0O A;  3I0H A;  4MIX A;  4MND A;  2XWL A;  1H7H A;  4E1K A;  3F1C A;  1H7F A;  3POL A;  1V82 A;  4G3P A;  1ZHJ A;  1O7O A;  3D8V A;  1LZJ A;  5C4B A;  4MYB A;  1QG8 A;  1WSZ A;  3GUE A;  5C4D A;  3Q80 A;  1S4O A;  1G93 A;  4B4M A;  1H4C A;  2WVK A;  1JVG A;  2ICY A;  3DJ4 A;  1ZI5 A;  4D0Z A;  4B2W A;  4CJB A;  4EEG A;  4FRE A;  4D48 A;  1ZJ1 A;  1ZCT A;  1WVC A;  3V8Y A;  1LZ0 A;  2YC5 A;  4P02 A;  3RSB A;  5C4E A;  1GWV A;  2RJ8 A;  4ECM A;  2BO6 A;  4Y7G A;  4FRP A;  2JCK A;  1TZF A;  4ASY A;  4Q7C A;  3DUV A;  3Q7U A;  4EEA A;  4B5B A;  3T7N A;  3ZLK A;  3D5N A;  4AYJ A;  4Y9X A;  1HM8 A;  3N9W A;  5C4C A;  1ZCV A;  3ZF8 A;  4HO5 A;  1JYL A;  3BCV A;  2ZU8 A;  1G8O A;  3OH2 A;  2WGZ A;  3BRK X;  1MP3 A;  3V0P A;  5D92 A;  1VM8 A;  1H5S B;  4FRB A;  4Y6U A;  3SXC A;  2VD4 A;  1YP2 A;  3V0M A;  1LVW A;  3ST8 A;  5EJZ A;  2V0I A;  1FGX A;  1ZDF A;  4G87 A;  3I0D A;  3K8E A;  1H7E A;  2X60 A;  4GBP A;  3SX7 A;  1R82 A;  4ZDQ A;  2Y4M A;  1LL0 A;  3EE5 A;  1TW1 A;  1G9R A;  1H4E A;  5FV9 A;  5IDT A;  2FYD B;  1ZJ0 A;  1ON8 A;  1XHB A;  5J49 A;  2FFU A;  2FYB A;  2XWM A;  4JD0 A;  4HO2 A;  4L41 C;  1NMM B;  1R7T A;  4M2A A;  3USR A;  2MZB A;  1XZ6 A;  4HO8 A;  2A8W A;  4D11 C;  4NAK A;  1INI A;  2NXV A;  1VZU A;  1LL3 A;  2RJ4 A;  1VIC A;  2Y4K A;  1O0R A;  1ZCY A;  3U2X A;  1R7X A;  1W77 A;  4M28 A;  4FQW A;  4DE7 A;  4M2B A;  2AM4 A;  2OI7 A;  4J18 A;  4FIY A;  1FR8 A;  1FO9 A;  5C4F A;  5AJP A;  1QWJ A;  3ZLL A;  4NAL A;  4AC3 A;  1TVY A;  2ICX A;  4HO0 A;  1S4P A;  3SXD A;  4D0T A;  2O1G A;  1PZT A;  2RJ0 A;  4FRQ A;  1FXO A;  4D11 A;  5IDS A;  2RJ5 A;  4P00 A;  2RJ9 A;  3OH0 A;  1R7Y A;  3FOQ A;  4B2X A;  3I0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...