1H7LA

Dtdp-magnesium complex of spsa from bacillus subtilis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
239
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITNEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Three-Dimensional Structures of the Mn and Mg Dtdp Complexes of the Family Gt-2 Glycosyltransferase Spsa: A Comparison with Related Ndp-Sugar Glycosyltransferases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 94
structure length 239
sequence length 255
ec nomenclature
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h7lA00
1ZCTA 1VGWA 4M2AA 2RJ6A 1LL0A 4B5BA 3K8EA 1FXJA 2Z86A 3OC9A 4HO6A 2GGOA 4GBPA 5AJOA 4KXOA 4LW6A 5C36A 1VZTA 3V0MA 1H4DA 2P73A 1INIA 1YP2A 4B4BA 1TVYA 2X65A 1QWJA 5J49A 1WVCA 1LZJA 4B4MA 5C4DA 4Y6NA 1JVGA 3N9WA 1NWGB 4G3PA 2JCJA 4EEGA 2V0KA 2I5KA 3IOIA 3Q4SA 2OEFA 5FTSA 4FCUA 5CMIA 5I1FA 1ZI1A 1TZFA 1WT0A 2AESA 2WVKA 5IDSA 4B2XA 1VPAA 1W55A 4HCQA 4NAKA 2WVLA 1GQ9A 2BO6A 4Y64A 3I0CA 1ZJ2A 5AJPA 2FYBA 3T7MA 1GX4A 4BQHA 3DJ4A 5EJZA 4KNRA 3USQA 1VH1A 2Y4JA 4FROA 5C47A 5EIYA 3CU0A 1H4CA 2RJ7A 4Y63A 5DDTA 4Y7VA 3D8VA 4AYLA 5C3DA 1GQCA 3V0QA 1H5TB 3NGWA 1LZ0A 2FYCB 1ZCVA 5C38A 3ZLLA 3FWWA 1ZJ0A 4HO9A 3TQDA 1IIMA 3U2TA 1H5RB 2W0WA 4EE5A 1K4VA 4Y7GA 5CMJA 1PZTA 4B4GA 5EJ1A 4AAWA 3PNNA 1R81A 2Y4KA 1HM9A 4KPZA 1HJLA 1V83A 5IFYA 1FWYA 1R7TA 3RSBA 3I0IX 1JV1A 3USRA 1NQIB 4MNDA 4UEGA 3LW6A 2D7IA 2VXMA 2OI5A 4C2SA 1ZCUA 2OI6A 1WSZA 1R7YA 4DE7A 3SPTA 3SX3A 1FOAA 4J18A 3DK5A 2CU2A 3OKRA 1ZI5A 4B2WA 3I0HA 4DECA 3CKVA 5DDVA 2X60A 3PKQA 2YESA 4Y7FA 1NKHB 3T7OA 1QG8A 4CVHA 1W57A 5AJNA 2ZU8A 3R3IA 3D5NA 1KWSA 3SXDA 3PKPA 2WAWA 1S4NA 1W77A 1ZI4A 2YCMA 4HG6A 5FUHA 2RIZA 1YP4A 2QGIA 4Y7UA 1LL3A 3E25A 2XMHA 2NXVA 2AM5A 1XHBA 2QH5A 1EZIA 1H7EA 5CQMX 4FRHA 1FR8A 1GX0A 1H7FA 1VGZA 3V90A 2VXLA 1G95A 1ZJOA 1S4OA 5FU8A 1H5SA 1ZDGA 5CMHA 4YS8A 3E26A 3BRKX 5CQPA 1WT3A 1H7HA 3ST8A 1V84A 5C3AA 4FQWA 4JISA 1G1LA 1MP4A 5CQOA 1I52A 4AYJA 2RJ4A 4P00A 1FRWA 2O1FA 1GWVA 1OQMB 1O7QA 1O0RA 3SX8A 2FFUA 1H7LA 2V0HA 3POLA 4NANA 3SX5A 1VZXA 1JVDA 2OI7A 1JYLA 2XWNA 1G8OA 3OGZA 1VZUA 4AC3A 5C49A 4HO5A 1ON8A 5BXCA 2WEEA 4KC1A 4ARWA 3SXGA 2XWMA 4KT7A 2BO8A 2VSHA 3I0EA 3EE5A 1LL2A 4MYBA 4KQLA 4B42A 5CQNX 1VGTA 1VM8A 5IDTA 1R82A 3IOHA 4M4KA 3V8YA 4KNXA 2VS3A 1ZCYA 1ZHJA 1HM8A 2V0JA 4B3UA 1ZJPA 3JTJA 2YQJA 1G93A 3Q7UA 4DDZA 2BO7A 5L6SA 2VS5A 4D11A 3F1CA 4CJCA 5C1GA 2PGYA 4IRQA 4FCEA 2WGZA 4NALA 2O1HA 5HS2A 4HO2A 2Y4MA 2DPWA 1G2VA 1H5SD 2ZU7A 4R7PA 1FR9A 2RJ9A 2ZU9A 1FG5N 1YP3A 3CKQA 5C4FA 2Y6PA 2RIXA 2AM3A 4FREA 3JUJA 1R7UA 5C4BA 3CKNA 2XWLA 2FFVA 2QKXA 3V91A 3Q80A 2VSIA 1NMMB 1FGXA 2A8UA 2MZBA 2XMEA 3RMVA 2Y4LA 1JV3A 1NF5B 5C1LA 1IINA 2RJ0A 4HO0A 1LVWA 3U2XA 4ASYA 1H3MA 5FTVA 4KC4A 4CJBA 3BCVA 4IRPA 3R2WA 4M2BA 4XWIA 5JQQA 4ASJA 2RJ1A 2BO4A 4D48A 2Y7AA 2JCLA 2JCOA 4KPXA 2P6WA 3I0FA 5FV9A 1ZIZA 1OMZA 1E5KA 4JD0A 1FO8A 5FYEA 3ZGFA 1FZWA 2YQHA 2RITA 3OH1A 1R7VA 1H5SB 4Y7TA 1G3LA 2V0LA 3V0NA 2RJ8A 4HO3A 2AGDA 2Z87A 4G3QA 3K8DA 3CGXA 3I0JA 2E8BA 4D0ZA 1GA8A 3D98A 3I0KA 1VH3A 2FYAA 2I5EA 4FRMA 1HV9A 1ZJ1A 3I0GA 3OH0A 5C1HA 4E1KA 5CMFX 2A8WA 3SX7A 2D7RA 2RIYA 3F1YA 5CQLX 5FU0A 4ZDQA 1H5SC 4EE4A 1ZDFA 2VFZA 5L6VA 1O23B 3OH3A 3ZLKA 4EE3A 4NAIA 2E3DA 1H7GA 5CMGX 1G23A 3O3PA 3SXBA 2VD4A 3U0XA 2P72A 3GUEA 3V0LA 4KRVA 2YQCA 1H7QA 3OH4A 1VGUA 3JUKA 3V0PA 3U2WA 1V82A 2PX7A 3CKJA 2YQSA 4D0TA 1TW1A 2FYDB 2PA4A 3RMWA 4FRPA 2PGVA 1SS9A 1Z90A 1XZ6A 3SXAA 1G9RA 3HL3A 1LZIA 3QVBA 1YROB 1HJJA 2YC5A 1H5TA 1PZYB 1GWWA 2GGQA 1INJA 2WE9A 3I0DA 3ZF8A 4HO8A 1H7TA 4Y62A 1G97A 1R80A 2X5ZA 2V0IA 4FRBA 3SXEA 2Q4JA 4FRQA 1H5RA 4Y9XA 2RJ5A 2I7BA 4M28A 4G3SA 4Y6UA 4BMAA 3OH2A 2VS4A 3KIAA 3DUVA 1R7XA 1QGSA 4EVWA 2D0JA 1ZI3A 4EEMA 1NHEB 4FRAA 4K6RA 1FO9A 2WVMA 1O7OA 5C48A 1HM0A 4EEOA 1H4EA 4CJ8A 4D11C 4G87A 5C4EA 2OEGA 1FXOA 2UX8A 3ZGGA 4EEAA 1JYKA 1WT1A 2JCKA 4ECMA 3U2VA 3OAMA 1MP3A 2ICYA 1WT2A 1MC3A 4P02A 3CKOA 3TZTA 3SXCA 2AECA 1LZ7A 2O1GA 2X5SA 4KC2A 1FGGA 1MP5A 3IOJA 4FRDA 1TW5A 1OMXA 1VICA 2AE7A 2AH9A 5C3BA 3U0YA 3V8ZA 3I0LA 1G0RA 3U2UA 1EYRA 3FOQA 5C4CA 1S4PA 4L41C 2APCA 4HO4A 3V0OA 2W0VA 4FRLA 2FY7A 4HOCA 1ZJ3A 4LW3A 1ON6A 2AM4A 3T7NA 2ICXA 2YC3A 1QGQA 5C8RA
chains in the Genus database with same CATH superfamily
1ZCTA 1VGWA 5D91A 4M2AA 2RJ6A 1LL0A 4B5BA 3K8EA 1FXJA 2Z86A 3OC9A 4HO6A 2GGOA 4GBPA 5AJOA 4KXOA 4LW6A 5C36A 1VZTA 3V0MA 1H4DA 2P73A 2J0AA 1INIA 1YP2A 4B4BA 1TVYA 2X65A 1QWJA 5J49A 1WVCA 1LZJA 4B4MA 5C4DA 4Y6NA 1JVGA 3N9WA 1NWGB 4G3PA 2JCJA 4EEGA 2V0KA 2I5KA 3IOIA 3Q4SA 2OEFA 5FTSA 4FCUA 5CMIA 5I1FA 1ZI1A 1TZFA 1WT0A 2AESA 2WVKA 5IDSA 4B2XA 1VPAA 1W55A 4HCQA 4NAKA 2WVLA 1GQ9A 2BO6A 4Y64A 3I0CA 1ZJ2A 5AJPA 2FYBA 3T7MA 1GX4A 4BQHA 3DJ4A 5EJZA 4KNRA 3USQA 1VH1A 2Y4JA 4FROA 5C47A 5EIYA 4MIXA 3CU0A 1H4CA 2RJ7A 4Y63A 5DDTA 4Y7VA 3D8VA 4AYLA 5C3DA 1GQCA 3V0QA 1H5TB 3NGWA 1LZ0A 2FYCB 1ZCVA 5C38A 3ZLLA 3FWWA 1ZJ0A 4HO9A 3TQDA 1IIMA 3U2TA 1H5RB 2W0WA 4EE5A 1K4VA 4Y7GA 5CMJA 1PZTA 4B4GA 5EJ1A 4AAWA 3PNNA 1R81A 2Y4KA 1HM9A 4KPZA 1HJLA 1V83A 5IFYA 1FWYA 1R7TA 3RSBA 3I0IX 1JV1A 3USRA 1NQIB 4MNDA 4UEGA 3LW6A 2D7IA 2VXMA 2OI5A 4C2SA 1ZCUA 2OI6A 1WSZA 1R7YA 4DE7A 3SPTA 3SX3A 1FOAA 4J18A 3DK5A 2CU2A 3OKRA 1ZI5A 4B2WA 3I0HA 4DECA 3CKVA 5DDVA 2X60A 3PKQA 2YESA 4Y7FA 1NKHB 3T7OA 1QG8A 4CVHA 1W57A 5AJNA 2ZU8A 3R3IA 3D5NA 1KWSA 3SXDA 3PKPA 2WAWA 1S4NA 1W77A 1ZI4A 2YCMA 4HG6A 5FUHA 2RIZA 1YP4A 2QGIA 4Y7UA 1LL3A 3E25A 2XMHA 2NXVA 2AM5A 1XHBA 2QH5A 1EZIA 1H7EA 5CQMX 4FRHA 1FR8A 1GX0A 1H7FA 1VGZA 3V90A 2VXLA 1G95A 1ZJOA 1S4OA 5FU8A 1H5SA 1ZDGA 5CMHA 4YS8A 3E26A 3BRKX 5CQPA 1WT3A 1H7HA 3ST8A 1V84A 5C3AA 4FQWA 4JISA 1G1LA 1MP4A 5CQOA 1I52A 4O6MA 4AYJA 2RJ4A 4P00A 1FRWA 2O1FA 1GWVA 2J0BA 1OQMB 1O7QA 1O0RA 3SX8A 2FFUA 1H7LA 2V0HA 3POLA 4NANA 3SX5A 1VZXA 1JVDA 2OI7A 1JYLA 2XWNA 1G8OA 3OGZA 1VZUA 4AC3A 5C49A 4HO5A 1ON8A 5BXCA 2WEEA 4KC1A 4ARWA 3SXGA 2XWMA 4KT7A 2BO8A 2VSHA 3I0EA 4Q7CA 3EE5A 1LL2A 4MYBA 4KQLA 4B42A 5CQNX 1VGTA 1VM8A 5IDTA 1R82A 3IOHA 4M4KA 3V8YA 4KNXA 2VS3A 1ZCYA 1ZHJA 1HM8A 2V0JA 4B3UA 1ZJPA 3JTJA 2YQJA 1G93A 3Q7UA 4DDZA 2BO7A 5L6SA 2VS5A 4D11A 3F1CA 4CJCA 5C1GA 2PGYA 4IRQA 4FCEA 2WGZA 5D92A 4NALA 2O1HA 5HS2A 4HO2A 2Y4MA 2DPWA 4FIYA 1G2VA 1H5SD 2ZU7A 4R7PA 1FR9A 2RJ9A 2ZU9A 1FG5N 1YP3A 3CKQA 5C4FA 2Y6PA 2RIXA 2AM3A 4FREA 3JUJA 1R7UA 5C4BA 3CKNA 2XWLA 2FFVA 2QKXA 3V91A 3Q80A 4O6NA 2VSIA 1NMMB 1FGXA 2A8UA 2MZBA 2XMEA 3RMVA 2Y4LA 1JV3A 1NF5B 5C1LA 1IINA 2RJ0A 4HO0A 1LVWA 3U2XA 4ASYA 1H3MA 5FTVA 4KC4A 4CJBA 3BCVA 4IRPA 3R2WA 4M2BA 4XWIA 5JQQA 4ASJA 2RJ1A 2BO4A 4D48A 2Y7AA 2JCLA 2JCOA 4KPXA 2P6WA 3I0FA 5FV9A 1ZIZA 1OMZA 1E5KA 4JD0A 1FO8A 5FYEA 3ZGFA 1FZWA 2YQHA 2RITA 3OH1A 1R7VA 1H5SB 4Y7TA 1G3LA 2V0LA 3V0NA 2RJ8A 4HO3A 2AGDA 2Z87A 4G3QA 3K8DA 3CGXA 3I0JA 2E8BA 4D0ZA 1GA8A 3D98A 3I0KA 1VH3A 2FYAA 2I5EA 4FRMA 1HV9A 1ZJ1A 3I0GA 3OH0A 5C1HA 4E1KA 5CMFX 2A8WA 3SX7A 2D7RA 2RIYA 3F1YA 5CQLX 5FU0A 4ZDQA 1H5SC 4EE4A 1ZDFA 2VFZA 5L6VA 1O23B 3OH3A 3ZLKA 4EE3A 4NAIA 2E3DA 1H7GA 5CMGX 1G23A 3O3PA 3SXBA 2VD4A 3U0XA 4FIXA 2P72A 3GUEA 3V0LA 4KRVA 2YQCA 1H7QA 3OH4A 1VGUA 3JUKA 3V0PA 3U2WA 1V82A 2PX7A 3CKJA 2YQSA 4D0TA 1TW1A 2FYDB 2PA4A 3RMWA 4FRPA 2PGVA 1SS9A 1Z90A 1XZ6A 3SXAA 1G9RA 3HL3A 1LZIA 2VK9A 3QVBA 1YROB 1HJJA 2YC5A 1H5TA 1PZYB 1GWWA 2GGQA 1INJA 2WE9A 3I0DA 3ZF8A 4HO8A 1H7TA 4Y62A 1G97A 1R80A 2X5ZA 2V0IA 4FRBA 3SXEA 2Q4JA 4FRQA 1H5RA 4Y9XA 2RJ5A 2I7BA 4M28A 4G3SA 4Y6UA 4BMAA 3OH2A 2VS4A 3KIAA 3DUVA 1R7XA 1QGSA 4EVWA 2D0JA 1ZI3A 4EEMA 1NHEB 4FRAA 4K6RA 1FO9A 2WVMA 1O7OA 5C48A 1HM0A 4EEOA 1H4EA 4CJ8A 4D11C 4G87A 5C4EA 2OEGA 1FXOA 2UX8A 3ZGGA 4EEAA 1JYKA 1WT1A 2JCKA 4ECMA 3U2VA 3OAMA 1MP3A 2ICYA 1WT2A 1MC3A 4P02A 3CKOA 2C0NA 3TZTA 3SXCA 2AECA 1LZ7A 2O1GA 2X5SA 4KC2A 1FGGA 1MP5A 3IOJA 4FRDA 1TW5A 1OMXA 1VICA 2AE7A 2AH9A 5C3BA 3U0YA 3V8ZA 3I0LA 1G0RA 3U2UA 1EYRA 3FOQA 5C4CA 1S4PA 4L41C 2APCA 4HO4A 3V0OA 2W0VA 4FRLA 2FY7A 4HOCA 1ZJ3A 4LW3A 1ON6A 2AM4A 3T7NA 2ICXA 2YC3A 1QGQA 5C8RA
chains in the Genus database with same CATH topology
1ZCTA 1VGWA 5D91A 4M2AA 2RJ6A 1LL0A 4B5BA 3K8EA 1FXJA 2Z86A 3OC9A 4HO6A 2GGOA 4GBPA 5AJOA 4KXOA 4LW6A 5C36A 1VZTA 3V0MA 1H4DA 2P73A 2J0AA 1INIA 1YP2A 4B4BA 1TVYA 2X65A 1QWJA 5J49A 1WVCA 1LZJA 4B4MA 5C4DA 4Y6NA 1JVGA 3N9WA 1NWGB 4G3PA 2JCJA 4EEGA 2V0KA 2I5KA 3IOIA 3Q4SA 2OEFA 5FTSA 4FCUA 5CMIA 5I1FA 1ZI1A 1TZFA 1WT0A 2AESA 2WVKA 5IDSA 4B2XA 1VPAA 1W55A 4HCQA 4NAKA 2WVLA 1GQ9A 2BO6A 4Y64A 3I0CA 1ZJ2A 5AJPA 2FYBA 3T7MA 1GX4A 4BQHA 3DJ4A 5EJZA 4KNRA 3USQA 1VH1A 2Y4JA 4FROA 5C47A 5EIYA 4MIXA 3CU0A 1H4CA 2RJ7A 4Y63A 5DDTA 4Y7VA 3D8VA 4AYLA 5C3DA 1GQCA 3V0QA 1H5TB 3NGWA 1LZ0A 2FYCB 1ZCVA 5C38A 3ZLLA 3FWWA 1ZJ0A 4HO9A 3TQDA 1IIMA 3U2TA 1H5RB 2W0WA 4EE5A 1K4VA 4Y7GA 5CMJA 1PZTA 4B4GA 5EJ1A 4AAWA 3PNNA 1R81A 2Y4KA 1HM9A 4KPZA 1HJLA 1V83A 5IFYA 1FWYA 1R7TA 3RSBA 3I0IX 1JV1A 3USRA 1NQIB 4MNDA 4UEGA 3LW6A 2D7IA 2VXMA 2OI5A 4C2SA 1ZCUA 2OI6A 1WSZA 1R7YA 4DE7A 3SPTA 3SX3A 1FOAA 4J18A 3DK5A 2CU2A 3OKRA 1ZI5A 4B2WA 3I0HA 4DECA 3CKVA 5DDVA 2X60A 3PKQA 2YESA 4Y7FA 1NKHB 3T7OA 1QG8A 4CVHA 1W57A 5AJNA 2ZU8A 3R3IA 3D5NA 1KWSA 3SXDA 3PKPA 2WAWA 1S4NA 1W77A 1ZI4A 2YCMA 4HG6A 5FUHA 2RIZA 1YP4A 2QGIA 4Y7UA 1LL3A 3E25A 2XMHA 2NXVA 2AM5A 1XHBA 2QH5A 1EZIA 1H7EA 5CQMX 4FRHA 1FR8A 1GX0A 1H7FA 1VGZA 3V90A 2VXLA 1G95A 1ZJOA 1S4OA 5FU8A 1H5SA 1ZDGA 5CMHA 4YS8A 3E26A 3BRKX 5CQPA 1WT3A 1H7HA 3ST8A 1V84A 5C3AA 4FQWA 4JISA 1G1LA 1MP4A 5CQOA 1I52A 4O6MA 4AYJA 2RJ4A 4P00A 1FRWA 2O1FA 1GWVA 2J0BA 1OQMB 1O7QA 1O0RA 3SX8A 2FFUA 1H7LA 2V0HA 3POLA 4NANA 3SX5A 1VZXA 1JVDA 2OI7A 1JYLA 2XWNA 1G8OA 3OGZA 1VZUA 4AC3A 5C49A 4HO5A 1ON8A 5BXCA 2WEEA 4KC1A 4ARWA 3SXGA 2XWMA 4KT7A 2BO8A 2VSHA 3I0EA 4Q7CA 3EE5A 1LL2A 4MYBA 4KQLA 4B42A 5CQNX 1VGTA 1VM8A 5IDTA 1R82A 3IOHA 4M4KA 3V8YA 4KNXA 2VS3A 1ZCYA 1ZHJA 1HM8A 2V0JA 4B3UA 1ZJPA 3JTJA 2YQJA 1G93A 3Q7UA 4DDZA 2BO7A 5L6SA 2VS5A 4D11A 3F1CA 4CJCA 5C1GA 2PGYA 4IRQA 4FCEA 2WGZA 5D92A 4NALA 2O1HA 5HS2A 4HO2A 2Y4MA 2DPWA 4FIYA 1G2VA 1H5SD 2ZU7A 4R7PA 1FR9A 2RJ9A 2ZU9A 1FG5N 1YP3A 3CKQA 5C4FA 2Y6PA 2RIXA 2AM3A 4FREA 3JUJA 1R7UA 5C4BA 3CKNA 2XWLA 2FFVA 2QKXA 3V91A 3Q80A 4O6NA 2VSIA 1NMMB 1FGXA 2A8UA 2MZBA 2XMEA 3RMVA 2Y4LA 1JV3A 1NF5B 5C1LA 1IINA 2RJ0A 4HO0A 1LVWA 3U2XA 4ASYA 1H3MA 5FTVA 4KC4A 4CJBA 3BCVA 4IRPA 3R2WA 4M2BA 4XWIA 5JQQA 4ASJA 2RJ1A 2BO4A 4D48A 2Y7AA 2JCLA 2JCOA 4KPXA 2P6WA 3I0FA 5FV9A 1ZIZA 1OMZA 1E5KA 4JD0A 1FO8A 5FYEA 3ZGFA 1FZWA 2YQHA 2RITA 3OH1A 1R7VA 1H5SB 4Y7TA 1G3LA 2V0LA 3V0NA 2RJ8A 4HO3A 2AGDA 2Z87A 4G3QA 3K8DA 3CGXA 3I0JA 2E8BA 4D0ZA 1GA8A 3D98A 3I0KA 1VH3A 2FYAA 2I5EA 4FRMA 1HV9A 1ZJ1A 3I0GA 3OH0A 5C1HA 4E1KA 5CMFX 2A8WA 3SX7A 2D7RA 2RIYA 3F1YA 5CQLX 5FU0A 4ZDQA 1H5SC 4EE4A 1ZDFA 2VFZA 5L6VA 1O23B 3OH3A 3ZLKA 4EE3A 4NAIA 2E3DA 1H7GA 5CMGX 1G23A 3O3PA 3SXBA 2VD4A 3U0XA 4FIXA 2P72A 3GUEA 3V0LA 4KRVA 2YQCA 1H7QA 3OH4A 1VGUA 3JUKA 3V0PA 3U2WA 1V82A 2PX7A 3CKJA 2YQSA 4D0TA 1TW1A 2FYDB 2PA4A 3RMWA 4FRPA 2PGVA 1SS9A 1Z90A 1XZ6A 3SXAA 1G9RA 3HL3A 1LZIA 2VK9A 3QVBA 1YROB 1HJJA 2YC5A 1H5TA 1PZYB 1GWWA 2GGQA 1INJA 2WE9A 3I0DA 3ZF8A 4HO8A 1H7TA 4Y62A 1G97A 1R80A 2X5ZA 2V0IA 4FRBA 3SXEA 2Q4JA 4FRQA 1H5RA 4Y9XA 2RJ5A 2I7BA 4M28A 4G3SA 4Y6UA 4BMAA 3OH2A 2VS4A 3KIAA 3DUVA 1R7XA 1QGSA 4EVWA 2D0JA 1ZI3A 4EEMA 1NHEB 4FRAA 4K6RA 1FO9A 2WVMA 1O7OA 5C48A 1HM0A 4EEOA 1H4EA 4CJ8A 4D11C 4G87A 5C4EA 2OEGA 1FXOA 2UX8A 3ZGGA 4EEAA 1JYKA 1WT1A 2JCKA 4ECMA 3U2VA 3OAMA 1MP3A 2ICYA 1WT2A 1MC3A 4P02A 3CKOA 2C0NA 3TZTA 3SXCA 2AECA 1LZ7A 2O1GA 2X5SA 4KC2A 1FGGA 1MP5A 3IOJA 4FRDA 1TW5A 1OMXA 1VICA 2AE7A 2AH9A 5C3BA 3U0YA 3V8ZA 3I0LA 1G0RA 3U2UA 1EYRA 3FOQA 5C4CA 1S4PA 4L41C 2APCA 4HO4A 3V0OA 2W0VA 4FRLA 2FY7A 4HOCA 1ZJ3A 4LW3A 1ON6A 2AM4A 3T7NA 2ICXA 2YC3A 1QGQA 5C8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCT A;  1VGW A;  4M2A A;  2RJ6 A;  1LL0 A;  4B5B A;  3K8E A;  1FXJ A;  2Z86 A;  3OC9 A;  4HO6 A;  2GGO A;  4GBP A;  5AJO A;  4KXO A;  4LW6 A;  5C36 A;  1VZT A;  3V0M A;  1H4D A;  2P73 A;  1INI A;  1YP2 A;  4B4B A;  1TVY A;  2X65 A;  1QWJ A;  5J49 A;  1WVC A;  1LZJ A;  4B4M A;  5C4D A;  4Y6N A;  1JVG A;  3N9W A;  1NWG B;  4G3P A;  2JCJ A;  4EEG A;  2V0K A;  2I5K A;  3IOI A;  3Q4S A;  2OEF A;  5FTS A;  4FCU A;  5CMI A;  5I1F A;  1ZI1 A;  1TZF A;  1WT0 A;  2AES A;  2WVK A;  5IDS A;  4B2X A;  1VPA A;  1W55 A;  4HCQ A;  4NAK A;  2WVL A;  1GQ9 A;  2BO6 A;  4Y64 A;  3I0C A;  1ZJ2 A;  5AJP A;  2FYB A;  3T7M A;  1GX4 A;  4BQH A;  3DJ4 A;  5EJZ A;  4KNR A;  3USQ A;  1VH1 A;  2Y4J A;  4FRO A;  5C47 A;  5EIY A;  3CU0 A;  1H4C A;  2RJ7 A;  4Y63 A;  5DDT A;  4Y7V A;  3D8V A;  4AYL A;  5C3D A;  1GQC A;  3V0Q A;  1H5T B;  3NGW A;  1LZ0 A;  2FYC B;  1ZCV A;  5C38 A;  3ZLL A;  3FWW A;  1ZJ0 A;  4HO9 A;  3TQD A;  1IIM A;  3U2T A;  1H5R B;  2W0W A;  4EE5 A;  1K4V A;  4Y7G A;  5CMJ A;  1PZT A;  4B4G A;  5EJ1 A;  4AAW A;  3PNN A;  1R81 A;  2Y4K A;  1HM9 A;  4KPZ A;  1HJL A;  1V83 A;  5IFY A;  1FWY A;  1R7T A;  3RSB A;  3I0I X;  1JV1 A;  3USR A;  1NQI B;  4MND A;  4UEG A;  3LW6 A;  2D7I A;  2VXM A;  2OI5 A;  4C2S A;  1ZCU A;  2OI6 A;  1WSZ A;  1R7Y A;  4DE7 A;  3SPT A;  3SX3 A;  1FOA A;  4J18 A;  3DK5 A;  2CU2 A;  3OKR A;  1ZI5 A;  4B2W A;  3I0H A;  4DEC A;  3CKV A;  5DDV A;  2X60 A;  3PKQ A;  2YES A;  4Y7F A;  1NKH B;  3T7O A;  1QG8 A;  4CVH A;  1W57 A;  5AJN A;  2ZU8 A;  3R3I A;  3D5N A;  1KWS A;  3SXD A;  3PKP A;  2WAW A;  1S4N A;  1W77 A;  1ZI4 A;  2YCM A;  4HG6 A;  5FUH A;  2RIZ A;  1YP4 A;  2QGI A;  4Y7U A;  1LL3 A;  3E25 A;  2XMH A;  2NXV A;  2AM5 A;  1XHB A;  2QH5 A;  1EZI A;  1H7E A;  5CQM X;  4FRH A;  1FR8 A;  1GX0 A;  1H7F A;  1VGZ A;  3V90 A;  2VXL A;  1G95 A;  1ZJO A;  1S4O A;  5FU8 A;  1H5S A;  1ZDG A;  5CMH A;  4YS8 A;  3E26 A;  3BRK X;  5CQP A;  1WT3 A;  1H7H A;  3ST8 A;  1V84 A;  5C3A A;  4FQW A;  4JIS A;  1G1L A;  1MP4 A;  5CQO A;  1I52 A;  4AYJ A;  2RJ4 A;  4P00 A;  1FRW A;  2O1F A;  1GWV A;  1OQM B;  1O7Q A;  1O0R A;  3SX8 A;  2FFU A;  1H7L A;  2V0H A;  3POL A;  4NAN A;  3SX5 A;  1VZX A;  1JVD A;  2OI7 A;  1JYL A;  2XWN A;  1G8O A;  3OGZ A;  1VZU A;  4AC3 A;  5C49 A;  4HO5 A;  1ON8 A;  5BXC A;  2WEE A;  4KC1 A;  4ARW A;  3SXG A;  2XWM A;  4KT7 A;  2BO8 A;  2VSH A;  3I0E A;  3EE5 A;  1LL2 A;  4MYB A;  4KQL A;  4B42 A;  5CQN X;  1VGT A;  1VM8 A;  5IDT A;  1R82 A;  3IOH A;  4M4K A;  3V8Y A;  4KNX A;  2VS3 A;  1ZCY A;  1ZHJ A;  1HM8 A;  2V0J A;  4B3U A;  1ZJP A;  3JTJ A;  2YQJ A;  1G93 A;  3Q7U A;  4DDZ A;  2BO7 A;  5L6S A;  2VS5 A;  4D11 A;  3F1C A;  4CJC A;  5C1G A;  2PGY A;  4IRQ A;  4FCE A;  2WGZ A;  4NAL A;  2O1H A;  5HS2 A;  4HO2 A;  2Y4M A;  2DPW A;  1G2V A;  1H5S D;  2ZU7 A;  4R7P A;  1FR9 A;  2RJ9 A;  2ZU9 A;  1FG5 N;  1YP3 A;  3CKQ A;  5C4F A;  2Y6P A;  2RIX A;  2AM3 A;  4FRE A;  3JUJ A;  1R7U A;  5C4B A;  3CKN A;  2XWL A;  2FFV A;  2QKX A;  3V91 A;  3Q80 A;  2VSI A;  1NMM B;  1FGX A;  2A8U A;  2MZB A;  2XME A;  3RMV A;  2Y4L A;  1JV3 A;  1NF5 B;  5C1L A;  1IIN A;  2RJ0 A;  4HO0 A;  1LVW A;  3U2X A;  4ASY A;  1H3M A;  5FTV A;  4KC4 A;  4CJB A;  3BCV A;  4IRP A;  3R2W A;  4M2B A;  4XWI A;  5JQQ A;  4ASJ A;  2RJ1 A;  2BO4 A;  4D48 A;  2Y7A A;  2JCL A;  2JCO A;  4KPX A;  2P6W A;  3I0F A;  5FV9 A;  1ZIZ A;  1OMZ A;  1E5K A;  4JD0 A;  1FO8 A;  5FYE A;  3ZGF A;  1FZW A;  2YQH A;  2RIT A;  3OH1 A;  1R7V A;  1H5S B;  4Y7T A;  1G3L A;  2V0L A;  3V0N A;  2RJ8 A;  4HO3 A;  2AGD A;  2Z87 A;  4G3Q A;  3K8D A;  3CGX A;  3I0J A;  2E8B A;  4D0Z A;  1GA8 A;  3D98 A;  3I0K A;  1VH3 A;  2FYA A;  2I5E A;  4FRM A;  1HV9 A;  1ZJ1 A;  3I0G A;  3OH0 A;  5C1H A;  4E1K A;  5CMF X;  2A8W A;  3SX7 A;  2D7R A;  2RIY A;  3F1Y A;  5CQL X;  5FU0 A;  4ZDQ A;  1H5S C;  4EE4 A;  1ZDF A;  2VFZ A;  5L6V A;  1O23 B;  3OH3 A;  3ZLK A;  4EE3 A;  4NAI A;  2E3D A;  1H7G A;  5CMG X;  1G23 A;  3O3P A;  3SXB A;  2VD4 A;  3U0X A;  2P72 A;  3GUE A;  3V0L A;  4KRV A;  2YQC A;  1H7Q A;  3OH4 A;  1VGU A;  3JUK A;  3V0P A;  3U2W A;  1V82 A;  2PX7 A;  3CKJ A;  2YQS A;  4D0T A;  1TW1 A;  2FYD B;  2PA4 A;  3RMW A;  4FRP A;  2PGV A;  1SS9 A;  1Z90 A;  1XZ6 A;  3SXA A;  1G9R A;  3HL3 A;  1LZI A;  3QVB A;  1YRO B;  1HJJ A;  2YC5 A;  1H5T A;  1PZY B;  1GWW A;  2GGQ A;  1INJ A;  2WE9 A;  3I0D A;  3ZF8 A;  4HO8 A;  1H7T A;  4Y62 A;  1G97 A;  1R80 A;  2X5Z A;  2V0I A;  4FRB A;  3SXE A;  2Q4J A;  4FRQ A;  1H5R A;  4Y9X A;  2RJ5 A;  2I7B A;  4M28 A;  4G3S A;  4Y6U A;  4BMA A;  3OH2 A;  2VS4 A;  3KIA A;  3DUV A;  1R7X A;  1QGS A;  4EVW A;  2D0J A;  1ZI3 A;  4EEM A;  1NHE B;  4FRA A;  4K6R A;  1FO9 A;  2WVM A;  1O7O A;  5C48 A;  1HM0 A;  4EEO A;  1H4E A;  4CJ8 A;  4D11 C;  4G87 A;  5C4E A;  2OEG A;  1FXO A;  2UX8 A;  3ZGG A;  4EEA A;  1JYK A;  1WT1 A;  2JCK A;  4ECM A;  3U2V A;  3OAM A;  1MP3 A;  2ICY A;  1WT2 A;  1MC3 A;  4P02 A;  3CKO A;  3TZT A;  3SXC A;  2AEC A;  1LZ7 A;  2O1G A;  2X5S A;  4KC2 A;  1FGG A;  1MP5 A;  3IOJ A;  4FRD A;  1TW5 A;  1OMX A;  1VIC A;  2AE7 A;  2AH9 A;  5C3B A;  3U0Y A;  3V8Z A;  3I0L A;  1G0R A;  3U2U A;  1EYR A;  3FOQ A;  5C4C A;  1S4P A;  4L41 C;  2APC A;  4HO4 A;  3V0O A;  2W0V A;  4FRL A;  2FY7 A;  4HOC A;  1ZJ3 A;  4LW3 A;  1ON6 A;  2AM4 A;  3T7N A;  2ICX A;  2YC3 A;  1QGQ A;  5C8R A; 
#chains in the Genus database with same CATH topology
 1ZCT A;  1VGW A;  5D91 A;  4M2A A;  2RJ6 A;  1LL0 A;  4B5B A;  3K8E A;  1FXJ A;  2Z86 A;  3OC9 A;  4HO6 A;  2GGO A;  4GBP A;  5AJO A;  4KXO A;  4LW6 A;  5C36 A;  1VZT A;  3V0M A;  1H4D A;  2P73 A;  2J0A A;  1INI A;  1YP2 A;  4B4B A;  1TVY A;  2X65 A;  1QWJ A;  5J49 A;  1WVC A;  1LZJ A;  4B4M A;  5C4D A;  4Y6N A;  1JVG A;  3N9W A;  1NWG B;  4G3P A;  2JCJ A;  4EEG A;  2V0K A;  2I5K A;  3IOI A;  3Q4S A;  2OEF A;  5FTS A;  4FCU A;  5CMI A;  5I1F A;  1ZI1 A;  1TZF A;  1WT0 A;  2AES A;  2WVK A;  5IDS A;  4B2X A;  1VPA A;  1W55 A;  4HCQ A;  4NAK A;  2WVL A;  1GQ9 A;  2BO6 A;  4Y64 A;  3I0C A;  1ZJ2 A;  5AJP A;  2FYB A;  3T7M A;  1GX4 A;  4BQH A;  3DJ4 A;  5EJZ A;  4KNR A;  3USQ A;  1VH1 A;  2Y4J A;  4FRO A;  5C47 A;  5EIY A;  4MIX A;  3CU0 A;  1H4C A;  2RJ7 A;  4Y63 A;  5DDT A;  4Y7V A;  3D8V A;  4AYL A;  5C3D A;  1GQC A;  3V0Q A;  1H5T B;  3NGW A;  1LZ0 A;  2FYC B;  1ZCV A;  5C38 A;  3ZLL A;  3FWW A;  1ZJ0 A;  4HO9 A;  3TQD A;  1IIM A;  3U2T A;  1H5R B;  2W0W A;  4EE5 A;  1K4V A;  4Y7G A;  5CMJ A;  1PZT A;  4B4G A;  5EJ1 A;  4AAW A;  3PNN A;  1R81 A;  2Y4K A;  1HM9 A;  4KPZ A;  1HJL A;  1V83 A;  5IFY A;  1FWY A;  1R7T A;  3RSB A;  3I0I X;  1JV1 A;  3USR A;  1NQI B;  4MND A;  4UEG A;  3LW6 A;  2D7I A;  2VXM A;  2OI5 A;  4C2S A;  1ZCU A;  2OI6 A;  1WSZ A;  1R7Y A;  4DE7 A;  3SPT A;  3SX3 A;  1FOA A;  4J18 A;  3DK5 A;  2CU2 A;  3OKR A;  1ZI5 A;  4B2W A;  3I0H A;  4DEC A;  3CKV A;  5DDV A;  2X60 A;  3PKQ A;  2YES A;  4Y7F A;  1NKH B;  3T7O A;  1QG8 A;  4CVH A;  1W57 A;  5AJN A;  2ZU8 A;  3R3I A;  3D5N A;  1KWS A;  3SXD A;  3PKP A;  2WAW A;  1S4N A;  1W77 A;  1ZI4 A;  2YCM A;  4HG6 A;  5FUH A;  2RIZ A;  1YP4 A;  2QGI A;  4Y7U A;  1LL3 A;  3E25 A;  2XMH A;  2NXV A;  2AM5 A;  1XHB A;  2QH5 A;  1EZI A;  1H7E A;  5CQM X;  4FRH A;  1FR8 A;  1GX0 A;  1H7F A;  1VGZ A;  3V90 A;  2VXL A;  1G95 A;  1ZJO A;  1S4O A;  5FU8 A;  1H5S A;  1ZDG A;  5CMH A;  4YS8 A;  3E26 A;  3BRK X;  5CQP A;  1WT3 A;  1H7H A;  3ST8 A;  1V84 A;  5C3A A;  4FQW A;  4JIS A;  1G1L A;  1MP4 A;  5CQO A;  1I52 A;  4O6M A;  4AYJ A;  2RJ4 A;  4P00 A;  1FRW A;  2O1F A;  1GWV A;  2J0B A;  1OQM B;  1O7Q A;  1O0R A;  3SX8 A;  2FFU A;  1H7L A;  2V0H A;  3POL A;  4NAN A;  3SX5 A;  1VZX A;  1JVD A;  2OI7 A;  1JYL A;  2XWN A;  1G8O A;  3OGZ A;  1VZU A;  4AC3 A;  5C49 A;  4HO5 A;  1ON8 A;  5BXC A;  2WEE A;  4KC1 A;  4ARW A;  3SXG A;  2XWM A;  4KT7 A;  2BO8 A;  2VSH A;  3I0E A;  4Q7C A;  3EE5 A;  1LL2 A;  4MYB A;  4KQL A;  4B42 A;  5CQN X;  1VGT A;  1VM8 A;  5IDT A;  1R82 A;  3IOH A;  4M4K A;  3V8Y A;  4KNX A;  2VS3 A;  1ZCY A;  1ZHJ A;  1HM8 A;  2V0J A;  4B3U A;  1ZJP A;  3JTJ A;  2YQJ A;  1G93 A;  3Q7U A;  4DDZ A;  2BO7 A;  5L6S A;  2VS5 A;  4D11 A;  3F1C A;  4CJC A;  5C1G A;  2PGY A;  4IRQ A;  4FCE A;  2WGZ A;  5D92 A;  4NAL A;  2O1H A;  5HS2 A;  4HO2 A;  2Y4M A;  2DPW A;  4FIY A;  1G2V A;  1H5S D;  2ZU7 A;  4R7P A;  1FR9 A;  2RJ9 A;  2ZU9 A;  1FG5 N;  1YP3 A;  3CKQ A;  5C4F A;  2Y6P A;  2RIX A;  2AM3 A;  4FRE A;  3JUJ A;  1R7U A;  5C4B A;  3CKN A;  2XWL A;  2FFV A;  2QKX A;  3V91 A;  3Q80 A;  4O6N A;  2VSI A;  1NMM B;  1FGX A;  2A8U A;  2MZB A;  2XME A;  3RMV A;  2Y4L A;  1JV3 A;  1NF5 B;  5C1L A;  1IIN A;  2RJ0 A;  4HO0 A;  1LVW A;  3U2X A;  4ASY A;  1H3M A;  5FTV A;  4KC4 A;  4CJB A;  3BCV A;  4IRP A;  3R2W A;  4M2B A;  4XWI A;  5JQQ A;  4ASJ A;  2RJ1 A;  2BO4 A;  4D48 A;  2Y7A A;  2JCL A;  2JCO A;  4KPX A;  2P6W A;  3I0F A;  5FV9 A;  1ZIZ A;  1OMZ A;  1E5K A;  4JD0 A;  1FO8 A;  5FYE A;  3ZGF A;  1FZW A;  2YQH A;  2RIT A;  3OH1 A;  1R7V A;  1H5S B;  4Y7T A;  1G3L A;  2V0L A;  3V0N A;  2RJ8 A;  4HO3 A;  2AGD A;  2Z87 A;  4G3Q A;  3K8D A;  3CGX A;  3I0J A;  2E8B A;  4D0Z A;  1GA8 A;  3D98 A;  3I0K A;  1VH3 A;  2FYA A;  2I5E A;  4FRM A;  1HV9 A;  1ZJ1 A;  3I0G A;  3OH0 A;  5C1H A;  4E1K A;  5CMF X;  2A8W A;  3SX7 A;  2D7R A;  2RIY A;  3F1Y A;  5CQL X;  5FU0 A;  4ZDQ A;  1H5S C;  4EE4 A;  1ZDF A;  2VFZ A;  5L6V A;  1O23 B;  3OH3 A;  3ZLK A;  4EE3 A;  4NAI A;  2E3D A;  1H7G A;  5CMG X;  1G23 A;  3O3P A;  3SXB A;  2VD4 A;  3U0X A;  4FIX A;  2P72 A;  3GUE A;  3V0L A;  4KRV A;  2YQC A;  1H7Q A;  3OH4 A;  1VGU A;  3JUK A;  3V0P A;  3U2W A;  1V82 A;  2PX7 A;  3CKJ A;  2YQS A;  4D0T A;  1TW1 A;  2FYD B;  2PA4 A;  3RMW A;  4FRP A;  2PGV A;  1SS9 A;  1Z90 A;  1XZ6 A;  3SXA A;  1G9R A;  3HL3 A;  1LZI A;  2VK9 A;  3QVB A;  1YRO B;  1HJJ A;  2YC5 A;  1H5T A;  1PZY B;  1GWW A;  2GGQ A;  1INJ A;  2WE9 A;  3I0D A;  3ZF8 A;  4HO8 A;  1H7T A;  4Y62 A;  1G97 A;  1R80 A;  2X5Z A;  2V0I A;  4FRB A;  3SXE A;  2Q4J A;  4FRQ A;  1H5R A;  4Y9X A;  2RJ5 A;  2I7B A;  4M28 A;  4G3S A;  4Y6U A;  4BMA A;  3OH2 A;  2VS4 A;  3KIA A;  3DUV A;  1R7X A;  1QGS A;  4EVW A;  2D0J A;  1ZI3 A;  4EEM A;  1NHE B;  4FRA A;  4K6R A;  1FO9 A;  2WVM A;  1O7O A;  5C48 A;  1HM0 A;  4EEO A;  1H4E A;  4CJ8 A;  4D11 C;  4G87 A;  5C4E A;  2OEG A;  1FXO A;  2UX8 A;  3ZGG A;  4EEA A;  1JYK A;  1WT1 A;  2JCK A;  4ECM A;  3U2V A;  3OAM A;  1MP3 A;  2ICY A;  1WT2 A;  1MC3 A;  4P02 A;  3CKO A;  2C0N A;  3TZT A;  3SXC A;  2AEC A;  1LZ7 A;  2O1G A;  2X5S A;  4KC2 A;  1FGG A;  1MP5 A;  3IOJ A;  4FRD A;  1TW5 A;  1OMX A;  1VIC A;  2AE7 A;  2AH9 A;  5C3B A;  3U0Y A;  3V8Z A;  3I0L A;  1G0R A;  3U2U A;  1EYR A;  3FOQ A;  5C4C A;  1S4P A;  4L41 C;  2APC A;  4HO4 A;  3V0O A;  2W0V A;  4FRL A;  2FY7 A;  4HOC A;  1ZJ3 A;  4LW3 A;  1ON6 A;  2AM4 A;  3T7N A;  2ICX A;  2YC3 A;  1QGQ A;  5C8R A; 
#chains in the Genus database with same CATH homology
 1ZCT A;  1VGW A;  5D91 A;  4M2A A;  2RJ6 A;  1LL0 A;  4B5B A;  3K8E A;  1FXJ A;  2Z86 A;  3OC9 A;  4HO6 A;  2GGO A;  4GBP A;  5AJO A;  4KXO A;  4LW6 A;  5C36 A;  1VZT A;  3V0M A;  1H4D A;  2P73 A;  2J0A A;  1INI A;  1YP2 A;  4B4B A;  1TVY A;  2X65 A;  1QWJ A;  5J49 A;  1WVC A;  1LZJ A;  4B4M A;  5C4D A;  4Y6N A;  1JVG A;  3N9W A;  1NWG B;  4G3P A;  2JCJ A;  4EEG A;  2V0K A;  2I5K A;  3IOI A;  3Q4S A;  2OEF A;  5FTS A;  4FCU A;  5CMI A;  5I1F A;  1ZI1 A;  1TZF A;  1WT0 A;  2AES A;  2WVK A;  5IDS A;  4B2X A;  1VPA A;  1W55 A;  4HCQ A;  4NAK A;  2WVL A;  1GQ9 A;  2BO6 A;  4Y64 A;  3I0C A;  1ZJ2 A;  5AJP A;  2FYB A;  3T7M A;  1GX4 A;  4BQH A;  3DJ4 A;  5EJZ A;  4KNR A;  3USQ A;  1VH1 A;  2Y4J A;  4FRO A;  5C47 A;  5EIY A;  4MIX A;  3CU0 A;  1H4C A;  2RJ7 A;  4Y63 A;  5DDT A;  4Y7V A;  3D8V A;  4AYL A;  5C3D A;  1GQC A;  3V0Q A;  1H5T B;  3NGW A;  1LZ0 A;  2FYC B;  1ZCV A;  5C38 A;  3ZLL A;  3FWW A;  1ZJ0 A;  4HO9 A;  3TQD A;  1IIM A;  3U2T A;  1H5R B;  2W0W A;  4EE5 A;  1K4V A;  4Y7G A;  5CMJ A;  1PZT A;  4B4G A;  5EJ1 A;  4AAW A;  3PNN A;  1R81 A;  2Y4K A;  1HM9 A;  4KPZ A;  1HJL A;  1V83 A;  5IFY A;  1FWY A;  1R7T A;  3RSB A;  3I0I X;  1JV1 A;  3USR A;  1NQI B;  4MND A;  4UEG A;  3LW6 A;  2D7I A;  2VXM A;  2OI5 A;  4C2S A;  1ZCU A;  2OI6 A;  1WSZ A;  1R7Y A;  4DE7 A;  3SPT A;  3SX3 A;  1FOA A;  4J18 A;  3DK5 A;  2CU2 A;  3OKR A;  1ZI5 A;  4B2W A;  3I0H A;  4DEC A;  3CKV A;  5DDV A;  2X60 A;  3PKQ A;  2YES A;  4Y7F A;  1NKH B;  3T7O A;  1QG8 A;  4CVH A;  1W57 A;  5AJN A;  2ZU8 A;  3R3I A;  3D5N A;  1KWS A;  3SXD A;  3PKP A;  2WAW A;  1S4N A;  1W77 A;  1ZI4 A;  2YCM A;  4HG6 A;  5FUH A;  2RIZ A;  1YP4 A;  2QGI A;  4Y7U A;  1LL3 A;  3E25 A;  2XMH A;  2NXV A;  2AM5 A;  1XHB A;  2QH5 A;  1EZI A;  1H7E A;  5CQM X;  4FRH A;  1FR8 A;  1GX0 A;  1H7F A;  1VGZ A;  3V90 A;  2VXL A;  1G95 A;  1ZJO A;  1S4O A;  5FU8 A;  1H5S A;  1ZDG A;  5CMH A;  4YS8 A;  3E26 A;  3BRK X;  5CQP A;  1WT3 A;  1H7H A;  3ST8 A;  1V84 A;  5C3A A;  4FQW A;  4JIS A;  1G1L A;  1MP4 A;  5CQO A;  1I52 A;  4O6M A;  4AYJ A;  2RJ4 A;  4P00 A;  1FRW A;  2O1F A;  1GWV A;  2J0B A;  1OQM B;  1O7Q A;  1O0R A;  3SX8 A;  2FFU A;  1H7L A;  2V0H A;  3POL A;  4NAN A;  3SX5 A;  1VZX A;  1JVD A;  2OI7 A;  1JYL A;  2XWN A;  1G8O A;  3OGZ A;  1VZU A;  4AC3 A;  5C49 A;  4HO5 A;  1ON8 A;  5BXC A;  2WEE A;  4KC1 A;  4ARW A;  3SXG A;  2XWM A;  4KT7 A;  2BO8 A;  2VSH A;  3I0E A;  4Q7C A;  3EE5 A;  1LL2 A;  4MYB A;  4KQL A;  4B42 A;  5CQN X;  1VGT A;  1VM8 A;  5IDT A;  1R82 A;  3IOH A;  4M4K A;  3V8Y A;  4KNX A;  2VS3 A;  1ZCY A;  1ZHJ A;  1HM8 A;  2V0J A;  4B3U A;  1ZJP A;  3JTJ A;  2YQJ A;  1G93 A;  3Q7U A;  4DDZ A;  2BO7 A;  5L6S A;  2VS5 A;  4D11 A;  3F1C A;  4CJC A;  5C1G A;  2PGY A;  4IRQ A;  4FCE A;  2WGZ A;  5D92 A;  4NAL A;  2O1H A;  5HS2 A;  4HO2 A;  2Y4M A;  2DPW A;  4FIY A;  1G2V A;  1H5S D;  2ZU7 A;  4R7P A;  1FR9 A;  2RJ9 A;  2ZU9 A;  1FG5 N;  1YP3 A;  3CKQ A;  5C4F A;  2Y6P A;  2RIX A;  2AM3 A;  4FRE A;  3JUJ A;  1R7U A;  5C4B A;  3CKN A;  2XWL A;  2FFV A;  2QKX A;  3V91 A;  3Q80 A;  4O6N A;  2VSI A;  1NMM B;  1FGX A;  2A8U A;  2MZB A;  2XME A;  3RMV A;  2Y4L A;  1JV3 A;  1NF5 B;  5C1L A;  1IIN A;  2RJ0 A;  4HO0 A;  1LVW A;  3U2X A;  4ASY A;  1H3M A;  5FTV A;  4KC4 A;  4CJB A;  3BCV A;  4IRP A;  3R2W A;  4M2B A;  4XWI A;  5JQQ A;  4ASJ A;  2RJ1 A;  2BO4 A;  4D48 A;  2Y7A A;  2JCL A;  2JCO A;  4KPX A;  2P6W A;  3I0F A;  5FV9 A;  1ZIZ A;  1OMZ A;  1E5K A;  4JD0 A;  1FO8 A;  5FYE A;  3ZGF A;  1FZW A;  2YQH A;  2RIT A;  3OH1 A;  1R7V A;  1H5S B;  4Y7T A;  1G3L A;  2V0L A;  3V0N A;  2RJ8 A;  4HO3 A;  2AGD A;  2Z87 A;  4G3Q A;  3K8D A;  3CGX A;  3I0J A;  2E8B A;  4D0Z A;  1GA8 A;  3D98 A;  3I0K A;  1VH3 A;  2FYA A;  2I5E A;  4FRM A;  1HV9 A;  1ZJ1 A;  3I0G A;  3OH0 A;  5C1H A;  4E1K A;  5CMF X;  2A8W A;  3SX7 A;  2D7R A;  2RIY A;  3F1Y A;  5CQL X;  5FU0 A;  4ZDQ A;  1H5S C;  4EE4 A;  1ZDF A;  2VFZ A;  5L6V A;  1O23 B;  3OH3 A;  3ZLK A;  4EE3 A;  4NAI A;  2E3D A;  1H7G A;  5CMG X;  1G23 A;  3O3P A;  3SXB A;  2VD4 A;  3U0X A;  4FIX A;  2P72 A;  3GUE A;  3V0L A;  4KRV A;  2YQC A;  1H7Q A;  3OH4 A;  1VGU A;  3JUK A;  3V0P A;  3U2W A;  1V82 A;  2PX7 A;  3CKJ A;  2YQS A;  4D0T A;  1TW1 A;  2FYD B;  2PA4 A;  3RMW A;  4FRP A;  2PGV A;  1SS9 A;  1Z90 A;  1XZ6 A;  3SXA A;  1G9R A;  3HL3 A;  1LZI A;  2VK9 A;  3QVB A;  1YRO B;  1HJJ A;  2YC5 A;  1H5T A;  1PZY B;  1GWW A;  2GGQ A;  1INJ A;  2WE9 A;  3I0D A;  3ZF8 A;  4HO8 A;  1H7T A;  4Y62 A;  1G97 A;  1R80 A;  2X5Z A;  2V0I A;  4FRB A;  3SXE A;  2Q4J A;  4FRQ A;  1H5R A;  4Y9X A;  2RJ5 A;  2I7B A;  4M28 A;  4G3S A;  4Y6U A;  4BMA A;  3OH2 A;  2VS4 A;  3KIA A;  3DUV A;  1R7X A;  1QGS A;  4EVW A;  2D0J A;  1ZI3 A;  4EEM A;  1NHE B;  4FRA A;  4K6R A;  1FO9 A;  2WVM A;  1O7O A;  5C48 A;  1HM0 A;  4EEO A;  1H4E A;  4CJ8 A;  4D11 C;  4G87 A;  5C4E A;  2OEG A;  1FXO A;  2UX8 A;  3ZGG A;  4EEA A;  1JYK A;  1WT1 A;  2JCK A;  4ECM A;  3U2V A;  3OAM A;  1MP3 A;  2ICY A;  1WT2 A;  1MC3 A;  4P02 A;  3CKO A;  2C0N A;  3TZT A;  3SXC A;  2AEC A;  1LZ7 A;  2O1G A;  2X5S A;  4KC2 A;  1FGG A;  1MP5 A;  3IOJ A;  4FRD A;  1TW5 A;  1OMX A;  1VIC A;  2AE7 A;  2AH9 A;  5C3B A;  3U0Y A;  3V8Z A;  3I0L A;  1G0R A;  3U2U A;  1EYR A;  3FOQ A;  5C4C A;  1S4P A;  4L41 C;  2APC A;  4HO4 A;  3V0O A;  2W0V A;  4FRL A;  2FY7 A;  4HOC A;  1ZJ3 A;  4LW3 A;  1ON6 A;  2AM4 A;  3T7N A;  2ICX A;  2YC3 A;  1QGQ A;  5C8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...