1ZI5A

Crystal structure of human n-acetylgalactosaminyltransferase (gta) complexed with h type i trisaccharide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
284
structure length
264
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase (NAGAT) Includes: G
publication title Differential Recognition of the Type I and II H Antigen Acceptors by the Human ABO(H) Blood Group A and B Glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 264
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2005-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zi5A00
3FWWA 5C3AA 4KC2A 1MP5A 1ZJ0A 1H3MA 4AAWA 4Y7UA 3SX5A 2AECA 1FR8A 1ZJ1A 2RJ9A 1H7GA 5C4DA 4GBPA 2V0JA 4IRQA 1G1LA 2JCKA 5FYEA 5EIYA 4Y63A 1V82A 3O3PA 2WVMA 1GQ9A 1LVWA 3RMVA 1OQMB 1ZJPA 4Y7FA 1Z90A 5J49A 1ZIZA 2Y4MA 4Y6NA 2Y4JA 3V0PA 4B4GA 4EEMA 4ARWA 3I0GA 5IFYA 1IINA 1GQCA 3OH2A 1R7VA 3SX8A 3OH0A 2FYAA 2P72A 5BXCA 1WT3A 2CU2A 1KWSA 4G3QA 2ZU7A 2PGVA 1H5SA 1IIMA 1ZCTA 2E3DA 1H4EA 2V0IA 1JV1A 5JQQA 3D98A 4KT7A 3HL3A 1QG8A 3ZLKA 1H7LA 5L6VA 3F1YA 4KRVA 1H7QA 2I5KA 4G87A 3Q80A 2BO7A 4FRBA 4EEAA 1ZJ3A 3K8EA 4JISA 1FGXA 3SXCA 4XWIA 2FYDB 1ZI1A 4B4MA 2OEGA 3GUEA 1W57A 1VZUA 1VGWA 5C8RA 3E25A 1O7OA 3I0FA 2W0WA 1SS9A 1VPAA 3ZGFA 4D11C 1S4OA 3F1CA 2DPWA 4KQLA 4CVHA 4E1KA 1H7EA 1MP3A 1G23A 2PX7A 2WAWA 3Q4SA 4HO6A 2O1HA 5CQOA 4Y7TA 4MNDA 4NAIA 2WE9A 1R80A 2A8WA 4L41C 2GGOA 4NALA 1WT0A 2A8UA 3DUVA 3U2TA 3D8VA 4EE5A 5CQPA 2QGIA 1OMZA 5CQMX 4B42A 4FRPA 3V90A 2AE7A 2WVKA 5CMGX 4FREA 2FYCB 3SXDA 2X5SA 2RJ5A 2RJ7A 3I0DA 2ZU9A 1OMXA 1G95A 1G9RA 1LL0A 4HCQA 4B3UA 2VD4A 3CKQA 1HM8A 2PGYA 1FR9A 1FG5N 4HO3A 2QKXA 2RIZA 4Y64A 2VSIA 1O23B 2YC3A 2D7RA 1FRWA 1H5SD 1INJA 1H4DA 2WVLA 3IOJA 4FRLA 3USRA 2Y4KA 3N9WA 1ZJOA 4NANA 5EJ1A 3CKOA 1V83A 1GX4A 2Z87A 4AYLA 1ZHJA 2O1FA 2RITA 4CJCA 4ECMA 3U0YA 4EE3A 1H5SB 2YQJA 2YESA 1G93A 3JTJA 4M28A 1GA8A 3OGZA 3JUKA 3SX3A 1R7UA 1XZ6A 3V8YA 1INIA 5EJZA 3V0LA 3I0KA 4LW3A 3TQDA 1EZIA 5C49A 4KC4A 3SXAA 3I0CA 4KC1A 1I52A 2BO4A 4MYBA 2BO6A 1YP3A 1NHEB 1R82A 1FGGA 2RJ4A 1ON8A 1YP4A 4EVWA 1ZDFA 1WT2A 3CGXA 4KNRA 1ZCYA 4NAKA 3I0EA 5DDVA 4HO5A 5C47A 1WT1A 3Q7UA 2VS3A 4G3SA 4YS8A 1TW5A 4IRPA 3E26A 2OEFA 3LW6A 3I0IX 1VH1A 1O0RA 1LL2A 3OKRA 2UX8A 3SPTA 2Y4LA 1S4PA 5I1FA 1H4CA 3ZF8A 1JV3A 2D7IA 4D11A 2YCMA 2XMEA 1H5TA 1ZCUA 3V8ZA 1FZWA 4CJ8A 5AJOA 3V91A 5AJNA 4Y7GA 3RSBA 2ICXA 2YQHA 3SXBA 1R81A 3IOIA 1G2VA 1EYRA 1H7TA 2VFZA 5C4EA 3I0JA 4FCUA 1G8OA 3U2WA 4BMAA 4ASYA 4CJBA 2BO8A 2Q4JA 3T7OA 1ZJ2A 4Y62A 2JCOA 5CMIA 1JVDA 1R7XA 4FRHA 5C1LA 1ZI3A 3QVBA 2Y7AA 3PNNA 1O7QA 2X5ZA 3U0XA 3OH4A 2MZBA 4FRQA 2AH9A 1ZI4A 4FRDA 5DDTA 2D0JA 2RJ0A 4DDZA 2FY7A 1H7FA 4Y7VA 2AM5A 1GWWA 5AJPA 1W77A 2RIXA 1GWVA 1S4NA 1HM9A 4FCEA 1XHBA 3CKNA 5C3BA 1G0RA 2AM4A 2VSHA 3DK5A 4FRAA 4P00A 1NQIB 5CQLX 3I0LA 4M2BA 1HJLA 4FROA 4AYJA 3SXGA 4JD0A 3CU0A 2FFUA 1JYKA 3SXEA 4EEOA 1FO9A 4M2AA 1NMMB 2W0VA 1QGSA 3BCVA 1VGUA 2O1GA 1FXJA 1VZTA 2JCLA 3I0HA 4HO4A 4HO0A 2P6WA 4Y9XA 3K8DA 1LZJA 5C4BA 4EEGA 4C2SA 1VM8A 1E5KA 2ICYA 5CMHA 3TZTA 1WSZA 4KPZA 5C48A 1ZDGA 4EE4A 2GGQA 1LL3A 4D0TA 1H5TB 2PA4A 2V0KA 2AM3A 4ZDQA 1YP2A 1VGTA 4DECA 2Z86A 5FTVA 4G3PA 2E8BA 3R3IA 2OI7A 4LW6A 5C1HA 3ZLLA 2RIYA 3U2XA 2WGZA 2NXVA 5FU8A 5CQNX 2JCJA 4Y6UA 5CMFX 1FWYA 3OC9A 1TW1A 4B5BA 1PZYB 3D5NA 3T7NA 1MP4A 2RJ8A 4DE7A 2VXMA 2VS5A 5FV9A 4HO2A 4HG6A 4D48A 2RJ6A 2QH5A 3PKPA 2AESA 4FQWA 3ZGGA 5FU0A 3V0NA 2Y6PA 2APCA 1LZ7A 4K6RA 3EE5A 3OH1A 4KXOA 1JYLA 1VH3A 2VS4A 1H5RA 3IOHA 2VXLA 3T7MA 1K4VA 1NWGB 3V0OA 1GX0A 1NF5B 3RMWA 1G3LA 4HOCA 1VICA 3CKVA 4R7PA 1W55A 5C1GA 1V84A 2X60A 1VZXA 4P02A 2I5EA 3USQA 4HO9A 3U2VA 4HO8A 4BQHA 2WEEA 2XMHA 3ST8A 1HM0A 1FO8A 2YQCA 1WVCA 3FOQA 3U2UA 3R2WA 5CMJA 4D0ZA 1LZIA 3PKQA 3SX7A 2OI6A 4AC3A 5IDTA 1R7YA 3OAMA 2YC5A 1H5SC 2FFVA 5C3DA 5C4CA 2X65A 1H7HA 1QWJA 4B2WA 2XWMA 1TVYA 1FOAA 2YQSA 1ZCVA 3KIAA 3NGWA 1TZFA 1FXOA 1ZI5A 5C36A 3V0QA 5FTSA 1PZTA 4KPXA 2P73A 3POLA 1LZ0A 2XWLA 4FRMA 5C4FA 2V0LA 4ASJA 1R7TA 4J18A 1HJJA 3OH3A 1MC3A 4B2XA 5C38A 2FYBA 3DJ4A 5IDSA 2OI5A 4KNXA 5HS2A 2ZU8A 1QGQA 2XWNA 1ON6A 1JVGA 5FUHA 4B4BA 5L6SA 1G97A 2RJ1A 1H5RB 3JUJA 2I7BA 4M4KA 4UEGA 1HV9A 3V0MA 2AGDA 1NKHB 1VGZA 3CKJA 2V0HA 1YROB 3BRKX
chains in the Genus database with same CATH superfamily
3FWWA 5C3AA 2J0BA 1MP5A 4KC2A 1ZJ0A 1H3MA 4AAWA 4Y7UA 3SX5A 4FIYA 2AECA 1FR8A 1ZJ1A 2RJ9A 1H7GA 5C4DA 4GBPA 2V0JA 4IRQA 1G1LA 2JCKA 5FYEA 5EIYA 4Y63A 1V82A 3O3PA 2WVMA 1GQ9A 1LVWA 3RMVA 1OQMB 1ZJPA 4Y7FA 1Z90A 5J49A 1ZIZA 2Y4MA 4Y6NA 2Y4JA 3V0PA 4B4GA 4EEMA 4ARWA 3I0GA 5IFYA 1IINA 1GQCA 3OH2A 1R7VA 3SX8A 4Q7CA 3OH0A 2FYAA 2P72A 5BXCA 1WT3A 2CU2A 1KWSA 4G3QA 2ZU7A 2PGVA 1H5SA 1IIMA 4FIXA 4O6NA 1ZCTA 2E3DA 1H4EA 2V0IA 1JV1A 5JQQA 3D98A 4KT7A 3HL3A 1QG8A 3ZLKA 1H7LA 5L6VA 3F1YA 4KRVA 1H7QA 2I5KA 4G87A 3Q80A 2BO7A 4FRBA 4EEAA 1ZJ3A 3K8EA 4JISA 1FGXA 3SXCA 4XWIA 2FYDB 1ZI1A 4B4MA 2OEGA 3GUEA 1W57A 1VZUA 1VGWA 5C8RA 3E25A 1O7OA 3I0FA 2W0WA 1SS9A 1VPAA 3ZGFA 4D11C 1S4OA 3F1CA 2DPWA 4KQLA 4CVHA 4E1KA 1H7EA 1MP3A 1G23A 2PX7A 2WAWA 3Q4SA 4HO6A 2O1HA 5CQOA 4Y7TA 4MNDA 4NAIA 2WE9A 5D91A 2J0AA 1R80A 2A8WA 4L41C 2GGOA 4NALA 1WT0A 2A8UA 3DUVA 3U2TA 3D8VA 4EE5A 5CQPA 2QGIA 1OMZA 5CQMX 4B42A 4FRPA 3V90A 2AE7A 2WVKA 5CMGX 4FREA 2FYCB 3SXDA 2X5SA 2RJ5A 2RJ7A 3I0DA 2ZU9A 1OMXA 1G95A 1G9RA 1LL0A 4HCQA 4B3UA 2VD4A 3CKQA 1HM8A 2PGYA 1FR9A 1FG5N 4HO3A 2QKXA 2RIZA 4Y64A 2VSIA 1O23B 2YC3A 2D7RA 1FRWA 1H5SD 2C0NA 1INJA 1H4DA 2WVLA 3IOJA 4FRLA 3USRA 2Y4KA 3N9WA 1ZJOA 4NANA 5EJ1A 3CKOA 1V83A 1GX4A 2Z87A 4AYLA 1ZHJA 2O1FA 2RITA 4CJCA 4ECMA 3U0YA 4EE3A 1H5SB 2YQJA 2YESA 1G93A 3JTJA 4M28A 1GA8A 3OGZA 3JUKA 3SX3A 1R7UA 1XZ6A 3V8YA 1INIA 5EJZA 3V0LA 3I0KA 4LW3A 3TQDA 1EZIA 5C49A 4KC4A 3SXAA 3I0CA 4KC1A 1I52A 2BO4A 4MYBA 2BO6A 1YP3A 1NHEB 1R82A 1FGGA 2RJ4A 1ON8A 1YP4A 4EVWA 1ZDFA 1WT2A 3CGXA 4KNRA 1ZCYA 4NAKA 3I0EA 5DDVA 4HO5A 5C47A 1WT1A 3Q7UA 2VS3A 4G3SA 4YS8A 1TW5A 4IRPA 3E26A 2OEFA 3LW6A 3I0IX 1VH1A 1O0RA 1LL2A 3OKRA 2UX8A 3SPTA 2Y4LA 1S4PA 5I1FA 1H4CA 3ZF8A 1JV3A 2D7IA 4D11A 2YCMA 2XMEA 1H5TA 1ZCUA 3V8ZA 1FZWA 4CJ8A 5AJOA 3V91A 5AJNA 4Y7GA 3RSBA 2ICXA 2YQHA 3SXBA 1R81A 3IOIA 1G2VA 1EYRA 1H7TA 2VFZA 5C4EA 3I0JA 4FCUA 1G8OA 3U2WA 4BMAA 4ASYA 4CJBA 2BO8A 2Q4JA 3T7OA 1ZJ2A 4Y62A 2JCOA 5CMIA 1JVDA 1R7XA 4FRHA 5C1LA 1ZI3A 3QVBA 2Y7AA 3PNNA 1O7QA 2X5ZA 3U0XA 3OH4A 2MZBA 4FRQA 2AH9A 1ZI4A 4FRDA 5DDTA 2D0JA 4MIXA 2RJ0A 4DDZA 2FY7A 1H7FA 4Y7VA 2AM5A 1GWWA 5AJPA 1W77A 2RIXA 1GWVA 1S4NA 1HM9A 4FCEA 2VK9A 1XHBA 3CKNA 5C3BA 1G0RA 2AM4A 2VSHA 3DK5A 4FRAA 4P00A 1NQIB 5CQLX 3I0LA 4M2BA 1HJLA 4FROA 4AYJA 3SXGA 4JD0A 3CU0A 2FFUA 1JYKA 3SXEA 4EEOA 1FO9A 4M2AA 1NMMB 2W0VA 1QGSA 3BCVA 1VGUA 2O1GA 1FXJA 1VZTA 2JCLA 3I0HA 4HO4A 4HO0A 2P6WA 4Y9XA 3K8DA 1LZJA 5C4BA 4EEGA 4C2SA 1VM8A 1E5KA 2ICYA 5CMHA 3TZTA 1WSZA 4KPZA 4O6MA 5C48A 1ZDGA 4EE4A 2GGQA 1LL3A 4D0TA 1H5TB 2PA4A 2V0KA 2AM3A 4ZDQA 1YP2A 5D92A 1VGTA 4DECA 2Z86A 5FTVA 4G3PA 2E8BA 3R3IA 2OI7A 4LW6A 5C1HA 3ZLLA 2RIYA 3U2XA 2WGZA 2NXVA 5FU8A 5CQNX 2JCJA 4Y6UA 5CMFX 1FWYA 3OC9A 1TW1A 4B5BA 1PZYB 3D5NA 3T7NA 1MP4A 2RJ8A 4DE7A 2VXMA 2VS5A 5FV9A 4HO2A 4HG6A 4D48A 2RJ6A 2QH5A 3PKPA 2AESA 4FQWA 3ZGGA 5FU0A 3V0NA 2Y6PA 2APCA 1LZ7A 4K6RA 3EE5A 3OH1A 4KXOA 1JYLA 1VH3A 2VS4A 1H5RA 3IOHA 2VXLA 3T7MA 1K4VA 1NWGB 3V0OA 1GX0A 1NF5B 3RMWA 1G3LA 4HOCA 1VICA 3CKVA 4R7PA 1W55A 5C1GA 1V84A 2X60A 1VZXA 4P02A 2I5EA 3USQA 4HO9A 3U2VA 4HO8A 4BQHA 2WEEA 2XMHA 3ST8A 1HM0A 1FO8A 2YQCA 1WVCA 3FOQA 3U2UA 3R2WA 5CMJA 4D0ZA 1LZIA 3PKQA 3SX7A 2OI6A 4AC3A 5IDTA 1R7YA 3OAMA 2YC5A 1H5SC 2FFVA 5C3DA 5C4CA 2X65A 1H7HA 1QWJA 4B2WA 2XWMA 1TVYA 1FOAA 2YQSA 1ZCVA 3KIAA 3NGWA 1TZFA 1FXOA 1ZI5A 5C36A 3V0QA 5FTSA 1PZTA 4KPXA 2P73A 3POLA 1LZ0A 2XWLA 4FRMA 5C4FA 2V0LA 4ASJA 1R7TA 4J18A 1HJJA 3OH3A 1MC3A 4B2XA 5C38A 2FYBA 3DJ4A 5IDSA 2OI5A 4KNXA 5HS2A 2ZU8A 1QGQA 2XWNA 1ON6A 1JVGA 5FUHA 4B4BA 5L6SA 1G97A 2RJ1A 1H5RB 3JUJA 2I7BA 4M4KA 4UEGA 1HV9A 3V0MA 2AGDA 1NKHB 1VGZA 3CKJA 2V0HA 1YROB 3BRKX
chains in the Genus database with same CATH topology
3FWWA 5C3AA 2J0BA 1MP5A 4KC2A 1ZJ0A 1H3MA 4AAWA 4Y7UA 3SX5A 4FIYA 2AECA 1FR8A 1ZJ1A 2RJ9A 1H7GA 5C4DA 4GBPA 2V0JA 4IRQA 1G1LA 2JCKA 5FYEA 5EIYA 4Y63A 1V82A 3O3PA 2WVMA 1GQ9A 1LVWA 3RMVA 1OQMB 1ZJPA 4Y7FA 1Z90A 5J49A 1ZIZA 2Y4MA 4Y6NA 2Y4JA 3V0PA 4B4GA 4EEMA 4ARWA 3I0GA 5IFYA 1IINA 1GQCA 3OH2A 1R7VA 3SX8A 4Q7CA 3OH0A 2FYAA 2P72A 5BXCA 1WT3A 2CU2A 1KWSA 4G3QA 2ZU7A 2PGVA 1H5SA 1IIMA 4FIXA 4O6NA 1ZCTA 2E3DA 1H4EA 2V0IA 1JV1A 5JQQA 3D98A 4KT7A 3HL3A 1QG8A 3ZLKA 1H7LA 5L6VA 3F1YA 4KRVA 1H7QA 2I5KA 4G87A 3Q80A 2BO7A 4FRBA 4EEAA 1ZJ3A 3K8EA 4JISA 1FGXA 3SXCA 4XWIA 2FYDB 1ZI1A 4B4MA 2OEGA 3GUEA 1W57A 1VZUA 1VGWA 5C8RA 3E25A 1O7OA 3I0FA 2W0WA 1SS9A 1VPAA 3ZGFA 4D11C 1S4OA 3F1CA 2DPWA 4KQLA 4CVHA 4E1KA 1H7EA 1MP3A 1G23A 2PX7A 2WAWA 3Q4SA 4HO6A 2O1HA 5CQOA 4Y7TA 4MNDA 4NAIA 2WE9A 5D91A 2J0AA 1R80A 2A8WA 4L41C 2GGOA 4NALA 1WT0A 2A8UA 3DUVA 3U2TA 3D8VA 4EE5A 5CQPA 2QGIA 1OMZA 5CQMX 4B42A 4FRPA 3V90A 2AE7A 2WVKA 5CMGX 4FREA 2FYCB 3SXDA 2X5SA 2RJ5A 2RJ7A 3I0DA 2ZU9A 1OMXA 1G95A 1G9RA 1LL0A 4HCQA 4B3UA 2VD4A 3CKQA 1HM8A 2PGYA 1FR9A 1FG5N 4HO3A 2QKXA 2RIZA 4Y64A 2VSIA 1O23B 2YC3A 2D7RA 1FRWA 1H5SD 2C0NA 1INJA 1H4DA 2WVLA 3IOJA 4FRLA 3USRA 2Y4KA 3N9WA 1ZJOA 4NANA 5EJ1A 3CKOA 1V83A 1GX4A 2Z87A 4AYLA 1ZHJA 2O1FA 2RITA 4CJCA 4ECMA 3U0YA 4EE3A 1H5SB 2YQJA 2YESA 1G93A 3JTJA 4M28A 1GA8A 3OGZA 3JUKA 3SX3A 1R7UA 1XZ6A 3V8YA 1INIA 5EJZA 3V0LA 3I0KA 4LW3A 3TQDA 1EZIA 5C49A 4KC4A 3SXAA 3I0CA 4KC1A 1I52A 2BO4A 4MYBA 2BO6A 1YP3A 1NHEB 1R82A 1FGGA 2RJ4A 1ON8A 1YP4A 4EVWA 1ZDFA 1WT2A 3CGXA 4KNRA 1ZCYA 4NAKA 3I0EA 5DDVA 4HO5A 5C47A 1WT1A 3Q7UA 2VS3A 4G3SA 4YS8A 1TW5A 4IRPA 3E26A 2OEFA 3LW6A 3I0IX 1VH1A 1O0RA 1LL2A 3OKRA 2UX8A 3SPTA 2Y4LA 1S4PA 5I1FA 1H4CA 3ZF8A 1JV3A 2D7IA 4D11A 2YCMA 2XMEA 1H5TA 1ZCUA 3V8ZA 1FZWA 4CJ8A 5AJOA 3V91A 5AJNA 4Y7GA 3RSBA 2ICXA 2YQHA 3SXBA 1R81A 3IOIA 1G2VA 1EYRA 1H7TA 2VFZA 5C4EA 3I0JA 4FCUA 1G8OA 3U2WA 4BMAA 4ASYA 4CJBA 2BO8A 2Q4JA 3T7OA 1ZJ2A 4Y62A 2JCOA 5CMIA 1JVDA 1R7XA 4FRHA 5C1LA 1ZI3A 3QVBA 2Y7AA 3PNNA 1O7QA 2X5ZA 3U0XA 3OH4A 2MZBA 4FRQA 2AH9A 1ZI4A 4FRDA 5DDTA 2D0JA 4MIXA 2RJ0A 4DDZA 2FY7A 1H7FA 4Y7VA 2AM5A 1GWWA 5AJPA 1W77A 2RIXA 1GWVA 1S4NA 1HM9A 4FCEA 2VK9A 1XHBA 3CKNA 5C3BA 1G0RA 2AM4A 2VSHA 3DK5A 4FRAA 4P00A 1NQIB 5CQLX 3I0LA 4M2BA 1HJLA 4FROA 4AYJA 3SXGA 4JD0A 3CU0A 2FFUA 1JYKA 3SXEA 4EEOA 1FO9A 4M2AA 1NMMB 2W0VA 1QGSA 3BCVA 1VGUA 2O1GA 1FXJA 1VZTA 2JCLA 3I0HA 4HO4A 4HO0A 2P6WA 4Y9XA 3K8DA 1LZJA 5C4BA 4EEGA 4C2SA 1VM8A 1E5KA 2ICYA 5CMHA 3TZTA 1WSZA 4KPZA 4O6MA 5C48A 1ZDGA 4EE4A 2GGQA 1LL3A 4D0TA 1H5TB 2PA4A 2V0KA 2AM3A 4ZDQA 1YP2A 5D92A 1VGTA 4DECA 2Z86A 5FTVA 4G3PA 2E8BA 3R3IA 2OI7A 4LW6A 5C1HA 3ZLLA 2RIYA 3U2XA 2WGZA 2NXVA 5FU8A 5CQNX 2JCJA 4Y6UA 5CMFX 1FWYA 3OC9A 1TW1A 4B5BA 1PZYB 3D5NA 3T7NA 1MP4A 2RJ8A 4DE7A 2VXMA 2VS5A 5FV9A 4HO2A 4HG6A 4D48A 2RJ6A 2QH5A 3PKPA 2AESA 4FQWA 3ZGGA 5FU0A 3V0NA 2Y6PA 2APCA 1LZ7A 4K6RA 3EE5A 3OH1A 4KXOA 1JYLA 1VH3A 2VS4A 1H5RA 3IOHA 2VXLA 3T7MA 1K4VA 1NWGB 3V0OA 1GX0A 1NF5B 3RMWA 1G3LA 4HOCA 1VICA 3CKVA 4R7PA 1W55A 5C1GA 1V84A 2X60A 1VZXA 4P02A 2I5EA 3USQA 4HO9A 3U2VA 4HO8A 4BQHA 2WEEA 2XMHA 3ST8A 1HM0A 1FO8A 2YQCA 1WVCA 3FOQA 3U2UA 3R2WA 5CMJA 4D0ZA 1LZIA 3PKQA 3SX7A 2OI6A 4AC3A 5IDTA 1R7YA 3OAMA 2YC5A 1H5SC 2FFVA 5C3DA 5C4CA 2X65A 1H7HA 1QWJA 4B2WA 2XWMA 1TVYA 1FOAA 2YQSA 1ZCVA 3KIAA 3NGWA 1TZFA 1FXOA 1ZI5A 5C36A 3V0QA 5FTSA 1PZTA 4KPXA 2P73A 3POLA 1LZ0A 2XWLA 4FRMA 5C4FA 2V0LA 4ASJA 1R7TA 4J18A 1HJJA 3OH3A 1MC3A 4B2XA 5C38A 2FYBA 3DJ4A 5IDSA 2OI5A 4KNXA 5HS2A 2ZU8A 1QGQA 2XWNA 1ON6A 1JVGA 5FUHA 4B4BA 5L6SA 1G97A 2RJ1A 1H5RB 3JUJA 2I7BA 4M4KA 4UEGA 1HV9A 3V0MA 2AGDA 1NKHB 1VGZA 3CKJA 2V0HA 1YROB 3BRKX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWW A;  5C3A A;  4KC2 A;  1MP5 A;  1ZJ0 A;  1H3M A;  4AAW A;  4Y7U A;  3SX5 A;  2AEC A;  1FR8 A;  1ZJ1 A;  2RJ9 A;  1H7G A;  5C4D A;  4GBP A;  2V0J A;  4IRQ A;  1G1L A;  2JCK A;  5FYE A;  5EIY A;  4Y63 A;  1V82 A;  3O3P A;  2WVM A;  1GQ9 A;  1LVW A;  3RMV A;  1OQM B;  1ZJP A;  4Y7F A;  1Z90 A;  5J49 A;  1ZIZ A;  2Y4M A;  4Y6N A;  2Y4J A;  3V0P A;  4B4G A;  4EEM A;  4ARW A;  3I0G A;  5IFY A;  1IIN A;  1GQC A;  3OH2 A;  1R7V A;  3SX8 A;  3OH0 A;  2FYA A;  2P72 A;  5BXC A;  1WT3 A;  2CU2 A;  1KWS A;  4G3Q A;  2ZU7 A;  2PGV A;  1H5S A;  1IIM A;  1ZCT A;  2E3D A;  1H4E A;  2V0I A;  1JV1 A;  5JQQ A;  3D98 A;  4KT7 A;  3HL3 A;  1QG8 A;  3ZLK A;  1H7L A;  5L6V A;  3F1Y A;  4KRV A;  1H7Q A;  2I5K A;  4G87 A;  3Q80 A;  2BO7 A;  4FRB A;  4EEA A;  1ZJ3 A;  3K8E A;  4JIS A;  1FGX A;  3SXC A;  4XWI A;  2FYD B;  1ZI1 A;  4B4M A;  2OEG A;  3GUE A;  1W57 A;  1VZU A;  1VGW A;  5C8R A;  3E25 A;  1O7O A;  3I0F A;  2W0W A;  1SS9 A;  1VPA A;  3ZGF A;  4D11 C;  1S4O A;  3F1C A;  2DPW A;  4KQL A;  4CVH A;  4E1K A;  1H7E A;  1MP3 A;  1G23 A;  2PX7 A;  2WAW A;  3Q4S A;  4HO6 A;  2O1H A;  5CQO A;  4Y7T A;  4MND A;  4NAI A;  2WE9 A;  1R80 A;  2A8W A;  4L41 C;  2GGO A;  4NAL A;  1WT0 A;  2A8U A;  3DUV A;  3U2T A;  3D8V A;  4EE5 A;  5CQP A;  2QGI A;  1OMZ A;  5CQM X;  4B42 A;  4FRP A;  3V90 A;  2AE7 A;  2WVK A;  5CMG X;  4FRE A;  2FYC B;  3SXD A;  2X5S A;  2RJ5 A;  2RJ7 A;  3I0D A;  2ZU9 A;  1OMX A;  1G95 A;  1G9R A;  1LL0 A;  4HCQ A;  4B3U A;  2VD4 A;  3CKQ A;  1HM8 A;  2PGY A;  1FR9 A;  1FG5 N;  4HO3 A;  2QKX A;  2RIZ A;  4Y64 A;  2VSI A;  1O23 B;  2YC3 A;  2D7R A;  1FRW A;  1H5S D;  1INJ A;  1H4D A;  2WVL A;  3IOJ A;  4FRL A;  3USR A;  2Y4K A;  3N9W A;  1ZJO A;  4NAN A;  5EJ1 A;  3CKO A;  1V83 A;  1GX4 A;  2Z87 A;  4AYL A;  1ZHJ A;  2O1F A;  2RIT A;  4CJC A;  4ECM A;  3U0Y A;  4EE3 A;  1H5S B;  2YQJ A;  2YES A;  1G93 A;  3JTJ A;  4M28 A;  1GA8 A;  3OGZ A;  3JUK A;  3SX3 A;  1R7U A;  1XZ6 A;  3V8Y A;  1INI A;  5EJZ A;  3V0L A;  3I0K A;  4LW3 A;  3TQD A;  1EZI A;  5C49 A;  4KC4 A;  3SXA A;  3I0C A;  4KC1 A;  1I52 A;  2BO4 A;  4MYB A;  2BO6 A;  1YP3 A;  1NHE B;  1R82 A;  1FGG A;  2RJ4 A;  1ON8 A;  1YP4 A;  4EVW A;  1ZDF A;  1WT2 A;  3CGX A;  4KNR A;  1ZCY A;  4NAK A;  3I0E A;  5DDV A;  4HO5 A;  5C47 A;  1WT1 A;  3Q7U A;  2VS3 A;  4G3S A;  4YS8 A;  1TW5 A;  4IRP A;  3E26 A;  2OEF A;  3LW6 A;  3I0I X;  1VH1 A;  1O0R A;  1LL2 A;  3OKR A;  2UX8 A;  3SPT A;  2Y4L A;  1S4P A;  5I1F A;  1H4C A;  3ZF8 A;  1JV3 A;  2D7I A;  4D11 A;  2YCM A;  2XME A;  1H5T A;  1ZCU A;  3V8Z A;  1FZW A;  4CJ8 A;  5AJO A;  3V91 A;  5AJN A;  4Y7G A;  3RSB A;  2ICX A;  2YQH A;  3SXB A;  1R81 A;  3IOI A;  1G2V A;  1EYR A;  1H7T A;  2VFZ A;  5C4E A;  3I0J A;  4FCU A;  1G8O A;  3U2W A;  4BMA A;  4ASY A;  4CJB A;  2BO8 A;  2Q4J A;  3T7O A;  1ZJ2 A;  4Y62 A;  2JCO A;  5CMI A;  1JVD A;  1R7X A;  4FRH A;  5C1L A;  1ZI3 A;  3QVB A;  2Y7A A;  3PNN A;  1O7Q A;  2X5Z A;  3U0X A;  3OH4 A;  2MZB A;  4FRQ A;  2AH9 A;  1ZI4 A;  4FRD A;  5DDT A;  2D0J A;  2RJ0 A;  4DDZ A;  2FY7 A;  1H7F A;  4Y7V A;  2AM5 A;  1GWW A;  5AJP A;  1W77 A;  2RIX A;  1GWV A;  1S4N A;  1HM9 A;  4FCE A;  1XHB A;  3CKN A;  5C3B A;  1G0R A;  2AM4 A;  2VSH A;  3DK5 A;  4FRA A;  4P00 A;  1NQI B;  5CQL X;  3I0L A;  4M2B A;  1HJL A;  4FRO A;  4AYJ A;  3SXG A;  4JD0 A;  3CU0 A;  2FFU A;  1JYK A;  3SXE A;  4EEO A;  1FO9 A;  4M2A A;  1NMM B;  2W0V A;  1QGS A;  3BCV A;  1VGU A;  2O1G A;  1FXJ A;  1VZT A;  2JCL A;  3I0H A;  4HO4 A;  4HO0 A;  2P6W A;  4Y9X A;  3K8D A;  1LZJ A;  5C4B A;  4EEG A;  4C2S A;  1VM8 A;  1E5K A;  2ICY A;  5CMH A;  3TZT A;  1WSZ A;  4KPZ A;  5C48 A;  1ZDG A;  4EE4 A;  2GGQ A;  1LL3 A;  4D0T A;  1H5T B;  2PA4 A;  2V0K A;  2AM3 A;  4ZDQ A;  1YP2 A;  1VGT A;  4DEC A;  2Z86 A;  5FTV A;  4G3P A;  2E8B A;  3R3I A;  2OI7 A;  4LW6 A;  5C1H A;  3ZLL A;  2RIY A;  3U2X A;  2WGZ A;  2NXV A;  5FU8 A;  5CQN X;  2JCJ A;  4Y6U A;  5CMF X;  1FWY A;  3OC9 A;  1TW1 A;  4B5B A;  1PZY B;  3D5N A;  3T7N A;  1MP4 A;  2RJ8 A;  4DE7 A;  2VXM A;  2VS5 A;  5FV9 A;  4HO2 A;  4HG6 A;  4D48 A;  2RJ6 A;  2QH5 A;  3PKP A;  2AES A;  4FQW A;  3ZGG A;  5FU0 A;  3V0N A;  2Y6P A;  2APC A;  1LZ7 A;  4K6R A;  3EE5 A;  3OH1 A;  4KXO A;  1JYL A;  1VH3 A;  2VS4 A;  1H5R A;  3IOH A;  2VXL A;  3T7M A;  1K4V A;  1NWG B;  3V0O A;  1GX0 A;  1NF5 B;  3RMW A;  1G3L A;  4HOC A;  1VIC A;  3CKV A;  4R7P A;  1W55 A;  5C1G A;  1V84 A;  2X60 A;  1VZX A;  4P02 A;  2I5E A;  3USQ A;  4HO9 A;  3U2V A;  4HO8 A;  4BQH A;  2WEE A;  2XMH A;  3ST8 A;  1HM0 A;  1FO8 A;  2YQC A;  1WVC A;  3FOQ A;  3U2U A;  3R2W A;  5CMJ A;  4D0Z A;  1LZI A;  3PKQ A;  3SX7 A;  2OI6 A;  4AC3 A;  5IDT A;  1R7Y A;  3OAM A;  2YC5 A;  1H5S C;  2FFV A;  5C3D A;  5C4C A;  2X65 A;  1H7H A;  1QWJ A;  4B2W A;  2XWM A;  1TVY A;  1FOA A;  2YQS A;  1ZCV A;  3KIA A;  3NGW A;  1TZF A;  1FXO A;  1ZI5 A;  5C36 A;  3V0Q A;  5FTS A;  1PZT A;  4KPX A;  2P73 A;  3POL A;  1LZ0 A;  2XWL A;  4FRM A;  5C4F A;  2V0L A;  4ASJ A;  1R7T A;  4J18 A;  1HJJ A;  3OH3 A;  1MC3 A;  4B2X A;  5C38 A;  2FYB A;  3DJ4 A;  5IDS A;  2OI5 A;  4KNX A;  5HS2 A;  2ZU8 A;  1QGQ A;  2XWN A;  1ON6 A;  1JVG A;  5FUH A;  4B4B A;  5L6S A;  1G97 A;  2RJ1 A;  1H5R B;  3JUJ A;  2I7B A;  4M4K A;  4UEG A;  1HV9 A;  3V0M A;  2AGD A;  1NKH B;  1VGZ A;  3CKJ A;  2V0H A;  1YRO B;  3BRK X; 
#chains in the Genus database with same CATH topology
 3FWW A;  5C3A A;  2J0B A;  1MP5 A;  4KC2 A;  1ZJ0 A;  1H3M A;  4AAW A;  4Y7U A;  3SX5 A;  4FIY A;  2AEC A;  1FR8 A;  1ZJ1 A;  2RJ9 A;  1H7G A;  5C4D A;  4GBP A;  2V0J A;  4IRQ A;  1G1L A;  2JCK A;  5FYE A;  5EIY A;  4Y63 A;  1V82 A;  3O3P A;  2WVM A;  1GQ9 A;  1LVW A;  3RMV A;  1OQM B;  1ZJP A;  4Y7F A;  1Z90 A;  5J49 A;  1ZIZ A;  2Y4M A;  4Y6N A;  2Y4J A;  3V0P A;  4B4G A;  4EEM A;  4ARW A;  3I0G A;  5IFY A;  1IIN A;  1GQC A;  3OH2 A;  1R7V A;  3SX8 A;  4Q7C A;  3OH0 A;  2FYA A;  2P72 A;  5BXC A;  1WT3 A;  2CU2 A;  1KWS A;  4G3Q A;  2ZU7 A;  2PGV A;  1H5S A;  1IIM A;  4FIX A;  4O6N A;  1ZCT A;  2E3D A;  1H4E A;  2V0I A;  1JV1 A;  5JQQ A;  3D98 A;  4KT7 A;  3HL3 A;  1QG8 A;  3ZLK A;  1H7L A;  5L6V A;  3F1Y A;  4KRV A;  1H7Q A;  2I5K A;  4G87 A;  3Q80 A;  2BO7 A;  4FRB A;  4EEA A;  1ZJ3 A;  3K8E A;  4JIS A;  1FGX A;  3SXC A;  4XWI A;  2FYD B;  1ZI1 A;  4B4M A;  2OEG A;  3GUE A;  1W57 A;  1VZU A;  1VGW A;  5C8R A;  3E25 A;  1O7O A;  3I0F A;  2W0W A;  1SS9 A;  1VPA A;  3ZGF A;  4D11 C;  1S4O A;  3F1C A;  2DPW A;  4KQL A;  4CVH A;  4E1K A;  1H7E A;  1MP3 A;  1G23 A;  2PX7 A;  2WAW A;  3Q4S A;  4HO6 A;  2O1H A;  5CQO A;  4Y7T A;  4MND A;  4NAI A;  2WE9 A;  5D91 A;  2J0A A;  1R80 A;  2A8W A;  4L41 C;  2GGO A;  4NAL A;  1WT0 A;  2A8U A;  3DUV A;  3U2T A;  3D8V A;  4EE5 A;  5CQP A;  2QGI A;  1OMZ A;  5CQM X;  4B42 A;  4FRP A;  3V90 A;  2AE7 A;  2WVK A;  5CMG X;  4FRE A;  2FYC B;  3SXD A;  2X5S A;  2RJ5 A;  2RJ7 A;  3I0D A;  2ZU9 A;  1OMX A;  1G95 A;  1G9R A;  1LL0 A;  4HCQ A;  4B3U A;  2VD4 A;  3CKQ A;  1HM8 A;  2PGY A;  1FR9 A;  1FG5 N;  4HO3 A;  2QKX A;  2RIZ A;  4Y64 A;  2VSI A;  1O23 B;  2YC3 A;  2D7R A;  1FRW A;  1H5S D;  2C0N A;  1INJ A;  1H4D A;  2WVL A;  3IOJ A;  4FRL A;  3USR A;  2Y4K A;  3N9W A;  1ZJO A;  4NAN A;  5EJ1 A;  3CKO A;  1V83 A;  1GX4 A;  2Z87 A;  4AYL A;  1ZHJ A;  2O1F A;  2RIT A;  4CJC A;  4ECM A;  3U0Y A;  4EE3 A;  1H5S B;  2YQJ A;  2YES A;  1G93 A;  3JTJ A;  4M28 A;  1GA8 A;  3OGZ A;  3JUK A;  3SX3 A;  1R7U A;  1XZ6 A;  3V8Y A;  1INI A;  5EJZ A;  3V0L A;  3I0K A;  4LW3 A;  3TQD A;  1EZI A;  5C49 A;  4KC4 A;  3SXA A;  3I0C A;  4KC1 A;  1I52 A;  2BO4 A;  4MYB A;  2BO6 A;  1YP3 A;  1NHE B;  1R82 A;  1FGG A;  2RJ4 A;  1ON8 A;  1YP4 A;  4EVW A;  1ZDF A;  1WT2 A;  3CGX A;  4KNR A;  1ZCY A;  4NAK A;  3I0E A;  5DDV A;  4HO5 A;  5C47 A;  1WT1 A;  3Q7U A;  2VS3 A;  4G3S A;  4YS8 A;  1TW5 A;  4IRP A;  3E26 A;  2OEF A;  3LW6 A;  3I0I X;  1VH1 A;  1O0R A;  1LL2 A;  3OKR A;  2UX8 A;  3SPT A;  2Y4L A;  1S4P A;  5I1F A;  1H4C A;  3ZF8 A;  1JV3 A;  2D7I A;  4D11 A;  2YCM A;  2XME A;  1H5T A;  1ZCU A;  3V8Z A;  1FZW A;  4CJ8 A;  5AJO A;  3V91 A;  5AJN A;  4Y7G A;  3RSB A;  2ICX A;  2YQH A;  3SXB A;  1R81 A;  3IOI A;  1G2V A;  1EYR A;  1H7T A;  2VFZ A;  5C4E A;  3I0J A;  4FCU A;  1G8O A;  3U2W A;  4BMA A;  4ASY A;  4CJB A;  2BO8 A;  2Q4J A;  3T7O A;  1ZJ2 A;  4Y62 A;  2JCO A;  5CMI A;  1JVD A;  1R7X A;  4FRH A;  5C1L A;  1ZI3 A;  3QVB A;  2Y7A A;  3PNN A;  1O7Q A;  2X5Z A;  3U0X A;  3OH4 A;  2MZB A;  4FRQ A;  2AH9 A;  1ZI4 A;  4FRD A;  5DDT A;  2D0J A;  4MIX A;  2RJ0 A;  4DDZ A;  2FY7 A;  1H7F A;  4Y7V A;  2AM5 A;  1GWW A;  5AJP A;  1W77 A;  2RIX A;  1GWV A;  1S4N A;  1HM9 A;  4FCE A;  2VK9 A;  1XHB A;  3CKN A;  5C3B A;  1G0R A;  2AM4 A;  2VSH A;  3DK5 A;  4FRA A;  4P00 A;  1NQI B;  5CQL X;  3I0L A;  4M2B A;  1HJL A;  4FRO A;  4AYJ A;  3SXG A;  4JD0 A;  3CU0 A;  2FFU A;  1JYK A;  3SXE A;  4EEO A;  1FO9 A;  4M2A A;  1NMM B;  2W0V A;  1QGS A;  3BCV A;  1VGU A;  2O1G A;  1FXJ A;  1VZT A;  2JCL A;  3I0H A;  4HO4 A;  4HO0 A;  2P6W A;  4Y9X A;  3K8D A;  1LZJ A;  5C4B A;  4EEG A;  4C2S A;  1VM8 A;  1E5K A;  2ICY A;  5CMH A;  3TZT A;  1WSZ A;  4KPZ A;  4O6M A;  5C48 A;  1ZDG A;  4EE4 A;  2GGQ A;  1LL3 A;  4D0T A;  1H5T B;  2PA4 A;  2V0K A;  2AM3 A;  4ZDQ A;  1YP2 A;  5D92 A;  1VGT A;  4DEC A;  2Z86 A;  5FTV A;  4G3P A;  2E8B A;  3R3I A;  2OI7 A;  4LW6 A;  5C1H A;  3ZLL A;  2RIY A;  3U2X A;  2WGZ A;  2NXV A;  5FU8 A;  5CQN X;  2JCJ A;  4Y6U A;  5CMF X;  1FWY A;  3OC9 A;  1TW1 A;  4B5B A;  1PZY B;  3D5N A;  3T7N A;  1MP4 A;  2RJ8 A;  4DE7 A;  2VXM A;  2VS5 A;  5FV9 A;  4HO2 A;  4HG6 A;  4D48 A;  2RJ6 A;  2QH5 A;  3PKP A;  2AES A;  4FQW A;  3ZGG A;  5FU0 A;  3V0N A;  2Y6P A;  2APC A;  1LZ7 A;  4K6R A;  3EE5 A;  3OH1 A;  4KXO A;  1JYL A;  1VH3 A;  2VS4 A;  1H5R A;  3IOH A;  2VXL A;  3T7M A;  1K4V A;  1NWG B;  3V0O A;  1GX0 A;  1NF5 B;  3RMW A;  1G3L A;  4HOC A;  1VIC A;  3CKV A;  4R7P A;  1W55 A;  5C1G A;  1V84 A;  2X60 A;  1VZX A;  4P02 A;  2I5E A;  3USQ A;  4HO9 A;  3U2V A;  4HO8 A;  4BQH A;  2WEE A;  2XMH A;  3ST8 A;  1HM0 A;  1FO8 A;  2YQC A;  1WVC A;  3FOQ A;  3U2U A;  3R2W A;  5CMJ A;  4D0Z A;  1LZI A;  3PKQ A;  3SX7 A;  2OI6 A;  4AC3 A;  5IDT A;  1R7Y A;  3OAM A;  2YC5 A;  1H5S C;  2FFV A;  5C3D A;  5C4C A;  2X65 A;  1H7H A;  1QWJ A;  4B2W A;  2XWM A;  1TVY A;  1FOA A;  2YQS A;  1ZCV A;  3KIA A;  3NGW A;  1TZF A;  1FXO A;  1ZI5 A;  5C36 A;  3V0Q A;  5FTS A;  1PZT A;  4KPX A;  2P73 A;  3POL A;  1LZ0 A;  2XWL A;  4FRM A;  5C4F A;  2V0L A;  4ASJ A;  1R7T A;  4J18 A;  1HJJ A;  3OH3 A;  1MC3 A;  4B2X A;  5C38 A;  2FYB A;  3DJ4 A;  5IDS A;  2OI5 A;  4KNX A;  5HS2 A;  2ZU8 A;  1QGQ A;  2XWN A;  1ON6 A;  1JVG A;  5FUH A;  4B4B A;  5L6S A;  1G97 A;  2RJ1 A;  1H5R B;  3JUJ A;  2I7B A;  4M4K A;  4UEG A;  1HV9 A;  3V0M A;  2AGD A;  1NKH B;  1VGZ A;  3CKJ A;  2V0H A;  1YRO B;  3BRK X; 
#chains in the Genus database with same CATH homology
 3FWW A;  5C3A A;  2J0B A;  1MP5 A;  4KC2 A;  1ZJ0 A;  1H3M A;  4AAW A;  4Y7U A;  3SX5 A;  4FIY A;  2AEC A;  1FR8 A;  1ZJ1 A;  2RJ9 A;  1H7G A;  5C4D A;  4GBP A;  2V0J A;  4IRQ A;  1G1L A;  2JCK A;  5FYE A;  5EIY A;  4Y63 A;  1V82 A;  3O3P A;  2WVM A;  1GQ9 A;  1LVW A;  3RMV A;  1OQM B;  1ZJP A;  4Y7F A;  1Z90 A;  5J49 A;  1ZIZ A;  2Y4M A;  4Y6N A;  2Y4J A;  3V0P A;  4B4G A;  4EEM A;  4ARW A;  3I0G A;  5IFY A;  1IIN A;  1GQC A;  3OH2 A;  1R7V A;  3SX8 A;  4Q7C A;  3OH0 A;  2FYA A;  2P72 A;  5BXC A;  1WT3 A;  2CU2 A;  1KWS A;  4G3Q A;  2ZU7 A;  2PGV A;  1H5S A;  1IIM A;  4FIX A;  4O6N A;  1ZCT A;  2E3D A;  1H4E A;  2V0I A;  1JV1 A;  5JQQ A;  3D98 A;  4KT7 A;  3HL3 A;  1QG8 A;  3ZLK A;  1H7L A;  5L6V A;  3F1Y A;  4KRV A;  1H7Q A;  2I5K A;  4G87 A;  3Q80 A;  2BO7 A;  4FRB A;  4EEA A;  1ZJ3 A;  3K8E A;  4JIS A;  1FGX A;  3SXC A;  4XWI A;  2FYD B;  1ZI1 A;  4B4M A;  2OEG A;  3GUE A;  1W57 A;  1VZU A;  1VGW A;  5C8R A;  3E25 A;  1O7O A;  3I0F A;  2W0W A;  1SS9 A;  1VPA A;  3ZGF A;  4D11 C;  1S4O A;  3F1C A;  2DPW A;  4KQL A;  4CVH A;  4E1K A;  1H7E A;  1MP3 A;  1G23 A;  2PX7 A;  2WAW A;  3Q4S A;  4HO6 A;  2O1H A;  5CQO A;  4Y7T A;  4MND A;  4NAI A;  2WE9 A;  5D91 A;  2J0A A;  1R80 A;  2A8W A;  4L41 C;  2GGO A;  4NAL A;  1WT0 A;  2A8U A;  3DUV A;  3U2T A;  3D8V A;  4EE5 A;  5CQP A;  2QGI A;  1OMZ A;  5CQM X;  4B42 A;  4FRP A;  3V90 A;  2AE7 A;  2WVK A;  5CMG X;  4FRE A;  2FYC B;  3SXD A;  2X5S A;  2RJ5 A;  2RJ7 A;  3I0D A;  2ZU9 A;  1OMX A;  1G95 A;  1G9R A;  1LL0 A;  4HCQ A;  4B3U A;  2VD4 A;  3CKQ A;  1HM8 A;  2PGY A;  1FR9 A;  1FG5 N;  4HO3 A;  2QKX A;  2RIZ A;  4Y64 A;  2VSI A;  1O23 B;  2YC3 A;  2D7R A;  1FRW A;  1H5S D;  2C0N A;  1INJ A;  1H4D A;  2WVL A;  3IOJ A;  4FRL A;  3USR A;  2Y4K A;  3N9W A;  1ZJO A;  4NAN A;  5EJ1 A;  3CKO A;  1V83 A;  1GX4 A;  2Z87 A;  4AYL A;  1ZHJ A;  2O1F A;  2RIT A;  4CJC A;  4ECM A;  3U0Y A;  4EE3 A;  1H5S B;  2YQJ A;  2YES A;  1G93 A;  3JTJ A;  4M28 A;  1GA8 A;  3OGZ A;  3JUK A;  3SX3 A;  1R7U A;  1XZ6 A;  3V8Y A;  1INI A;  5EJZ A;  3V0L A;  3I0K A;  4LW3 A;  3TQD A;  1EZI A;  5C49 A;  4KC4 A;  3SXA A;  3I0C A;  4KC1 A;  1I52 A;  2BO4 A;  4MYB A;  2BO6 A;  1YP3 A;  1NHE B;  1R82 A;  1FGG A;  2RJ4 A;  1ON8 A;  1YP4 A;  4EVW A;  1ZDF A;  1WT2 A;  3CGX A;  4KNR A;  1ZCY A;  4NAK A;  3I0E A;  5DDV A;  4HO5 A;  5C47 A;  1WT1 A;  3Q7U A;  2VS3 A;  4G3S A;  4YS8 A;  1TW5 A;  4IRP A;  3E26 A;  2OEF A;  3LW6 A;  3I0I X;  1VH1 A;  1O0R A;  1LL2 A;  3OKR A;  2UX8 A;  3SPT A;  2Y4L A;  1S4P A;  5I1F A;  1H4C A;  3ZF8 A;  1JV3 A;  2D7I A;  4D11 A;  2YCM A;  2XME A;  1H5T A;  1ZCU A;  3V8Z A;  1FZW A;  4CJ8 A;  5AJO A;  3V91 A;  5AJN A;  4Y7G A;  3RSB A;  2ICX A;  2YQH A;  3SXB A;  1R81 A;  3IOI A;  1G2V A;  1EYR A;  1H7T A;  2VFZ A;  5C4E A;  3I0J A;  4FCU A;  1G8O A;  3U2W A;  4BMA A;  4ASY A;  4CJB A;  2BO8 A;  2Q4J A;  3T7O A;  1ZJ2 A;  4Y62 A;  2JCO A;  5CMI A;  1JVD A;  1R7X A;  4FRH A;  5C1L A;  1ZI3 A;  3QVB A;  2Y7A A;  3PNN A;  1O7Q A;  2X5Z A;  3U0X A;  3OH4 A;  2MZB A;  4FRQ A;  2AH9 A;  1ZI4 A;  4FRD A;  5DDT A;  2D0J A;  4MIX A;  2RJ0 A;  4DDZ A;  2FY7 A;  1H7F A;  4Y7V A;  2AM5 A;  1GWW A;  5AJP A;  1W77 A;  2RIX A;  1GWV A;  1S4N A;  1HM9 A;  4FCE A;  2VK9 A;  1XHB A;  3CKN A;  5C3B A;  1G0R A;  2AM4 A;  2VSH A;  3DK5 A;  4FRA A;  4P00 A;  1NQI B;  5CQL X;  3I0L A;  4M2B A;  1HJL A;  4FRO A;  4AYJ A;  3SXG A;  4JD0 A;  3CU0 A;  2FFU A;  1JYK A;  3SXE A;  4EEO A;  1FO9 A;  4M2A A;  1NMM B;  2W0V A;  1QGS A;  3BCV A;  1VGU A;  2O1G A;  1FXJ A;  1VZT A;  2JCL A;  3I0H A;  4HO4 A;  4HO0 A;  2P6W A;  4Y9X A;  3K8D A;  1LZJ A;  5C4B A;  4EEG A;  4C2S A;  1VM8 A;  1E5K A;  2ICY A;  5CMH A;  3TZT A;  1WSZ A;  4KPZ A;  4O6M A;  5C48 A;  1ZDG A;  4EE4 A;  2GGQ A;  1LL3 A;  4D0T A;  1H5T B;  2PA4 A;  2V0K A;  2AM3 A;  4ZDQ A;  1YP2 A;  5D92 A;  1VGT A;  4DEC A;  2Z86 A;  5FTV A;  4G3P A;  2E8B A;  3R3I A;  2OI7 A;  4LW6 A;  5C1H A;  3ZLL A;  2RIY A;  3U2X A;  2WGZ A;  2NXV A;  5FU8 A;  5CQN X;  2JCJ A;  4Y6U A;  5CMF X;  1FWY A;  3OC9 A;  1TW1 A;  4B5B A;  1PZY B;  3D5N A;  3T7N A;  1MP4 A;  2RJ8 A;  4DE7 A;  2VXM A;  2VS5 A;  5FV9 A;  4HO2 A;  4HG6 A;  4D48 A;  2RJ6 A;  2QH5 A;  3PKP A;  2AES A;  4FQW A;  3ZGG A;  5FU0 A;  3V0N A;  2Y6P A;  2APC A;  1LZ7 A;  4K6R A;  3EE5 A;  3OH1 A;  4KXO A;  1JYL A;  1VH3 A;  2VS4 A;  1H5R A;  3IOH A;  2VXL A;  3T7M A;  1K4V A;  1NWG B;  3V0O A;  1GX0 A;  1NF5 B;  3RMW A;  1G3L A;  4HOC A;  1VIC A;  3CKV A;  4R7P A;  1W55 A;  5C1G A;  1V84 A;  2X60 A;  1VZX A;  4P02 A;  2I5E A;  3USQ A;  4HO9 A;  3U2V A;  4HO8 A;  4BQH A;  2WEE A;  2XMH A;  3ST8 A;  1HM0 A;  1FO8 A;  2YQC A;  1WVC A;  3FOQ A;  3U2U A;  3R2W A;  5CMJ A;  4D0Z A;  1LZI A;  3PKQ A;  3SX7 A;  2OI6 A;  4AC3 A;  5IDT A;  1R7Y A;  3OAM A;  2YC5 A;  1H5S C;  2FFV A;  5C3D A;  5C4C A;  2X65 A;  1H7H A;  1QWJ A;  4B2W A;  2XWM A;  1TVY A;  1FOA A;  2YQS A;  1ZCV A;  3KIA A;  3NGW A;  1TZF A;  1FXO A;  1ZI5 A;  5C36 A;  3V0Q A;  5FTS A;  1PZT A;  4KPX A;  2P73 A;  3POL A;  1LZ0 A;  2XWL A;  4FRM A;  5C4F A;  2V0L A;  4ASJ A;  1R7T A;  4J18 A;  1HJJ A;  3OH3 A;  1MC3 A;  4B2X A;  5C38 A;  2FYB A;  3DJ4 A;  5IDS A;  2OI5 A;  4KNX A;  5HS2 A;  2ZU8 A;  1QGQ A;  2XWN A;  1ON6 A;  1JVG A;  5FUH A;  4B4B A;  5L6S A;  1G97 A;  2RJ1 A;  1H5R B;  3JUJ A;  2I7B A;  4M4K A;  4UEG A;  1HV9 A;  3V0M A;  2AGD A;  1NKH B;  1VGZ A;  3CKJ A;  2V0H A;  1YRO B;  3BRK X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...