1ZI5A

Crystal structure of human n-acetylgalactosaminyltransferase (gta) complexed with h type i trisaccharide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
284
structure length
264
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase (NAGAT) Includes: G
publication title Differential Recognition of the Type I and II H Antigen Acceptors by the Human ABO(H) Blood Group A and B Glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 264
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2005-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zi5A00
4GBPA 3V8ZA 1VH1A 2D7RA 5IDSA 2WGZA 2JCOA 4FRDA 5CQOA 4D48A 1QGQA 3IOHA 1HJLA 4XWIA 1ZI4A 5C3AA 3CKOA 5C48A 1H5TA 5I1FA 3V0OA 4KQLA 1ZCUA 5C4DA 1FZWA 4Y63A 5DDVA 1ZI1A 5CQLX 4HO3A 2W0VA 4JISA 4AYLA 1HM0A 2JCJA 4ASJA 1LL2A 1NKHB 3CKQA 1EYRA 2YESA 5C36A 4KC1A 3U0YA 1HJJA 3V91A 5BXCA 1LL0A 3D5NA 2AECA 1ZCVA 1V84A 1R80A 3R2WA 1YP2A 4FREA 3TZTA 1SS9A 1H5SA 1FXOA 1VGZA 1ZCYA 1ZI5A 3F1YA 4HCQA 3OAMA 4Y7VA 4G3QA 3RMWA 4M2BA 3ST8A 1Z90A 4M2AA 5L6VA 1JVGA 2FYBA 3I0LA 2BO6A 3GUEA 1GA8A 2PGVA 3JTJA 2X65A 2WE9A 3USRA 4HO2A 5CMJA 4HG6A 4EEMA 3I0CA 2XMHA 1QWJA 1WSZA 2Q4JA 4R7PA 1LZ7A 1LVWA 2XMEA 1VZUA 2O1HA 1JYKA 5C8RA 1H5RB 1IIMA 3JUJA 4E1KA 3V0MA 1H5RA 5JQQA 2VS4A 1MP5A 1NHEB 4BQHA 1VICA 1H5SD 4UEGA 4FCUA 1WT0A 5CQNX 3D98A 4HO4A 4M28A 5FV9A 1H7HA 5AJPA 3I0JA 4K6RA 5FYEA 1NMMB 2QH5A 1G3LA 1G9RA 4C2SA 2QGIA 2V0HA 4ECMA 3CKNA 2XWLA 1VGTA 1INJA 2VXMA 1PZYB 3D8VA 1JVDA 4Y7FA 1HM8A 1YP4A 1H7LA 4J18A 5FUHA 4D0ZA 2BO4A 1VM8A 1XZ6A 5CMIA 1GX0A 2GGOA 4HO9A 1VPAA 1H7TA 3Q7UA 3CKVA 3NGWA 1H4DA 3V0PA 1ON6A 2ICXA 3V90A 1HM9A 1G8OA 1OMZA 2OI6A 1EZIA 3OH2A 1MP4A 4FRLA 5C4BA 3SX5A 5EJ1A 2CU2A 2E3DA 1TW5A 2PGYA 4EEGA 4EE3A 3OC9A 4B4MA 2OI7A 2W0WA 3LW6A 4FRMA 2NXVA 2P73A 1R7YA 1ZJ2A 2XWNA 3ZGGA 4NANA 1V83A 4MNDA 4HO6A 5CMGX 2X5ZA 1ZJ3A 1ZDFA 2AM3A 2RJ0A 2Z86A 5C4CA 3V8YA 1ZIZA 4IRQA 4G87A 3IOJA 2BO8A 2A8UA 4JD0A 5C49A 4FRBA 3SXAA 2V0LA 2QKXA 2OI5A 3V0LA 1H4EA 5CQPA 1G97A 2WVKA 1FG5N 3DJ4A 3SXBA 4HO8A 1ZDGA 3SX3A 3RMVA 2AE7A 4G3PA 1H7GA 1H5SC 2XWMA 4MYBA 5DDTA 2Z87A 1YROB 5CMFX 2VXLA 4KC2A 2PA4A 4Y62A 3Q4SA 1R82A 4D0TA 4KNRA 2FYDB 1R7TA 4HOCA 1V82A 2YCMA 5C4FA 2X60A 4FRAA 1ZI3A 1MC3A 3CGXA 3QVBA 1ZHJA 4LW3A 1LZIA 5IDTA 2VS3A 4ZDQA 2Y7AA 3SXCA 4M4KA 3SX8A 4B3UA 5C1LA 4AC3A 4BMAA 4FROA 3T7MA 3U0XA 1G23A 5C4EA 3I0DA 3OH4A 1W57A 4HO5A 3DK5A 4KPXA 2P6WA 1KWSA 1WT2A 5J49A 4KT7A 4B42A 5L6SA 2VS5A 1TVYA 2APCA 4IRPA 4B4BA 1FR8A 4L41C 3USQA 4LW6A 5C3BA 2VFZA 2I5KA 4EEAA 2A8WA 2RITA 3PKQA 3BRKX 3ZF8A 4KXOA 1TZFA 1R7VA 1GQCA 3SXEA 1INIA 2Y4KA 4D11A 4EE5A 4DE7A 2ZU7A 4G3SA 3O3PA 5FTSA 1XHBA 2DPWA 3N9WA 1NF5B 3OH1A 2RIYA 3F1CA 1O7OA 2RJ9A 3DUVA 2Y4JA 3T7OA 1G93A 3U2TA 1O7QA 2WVLA 3RSBA 2YC5A 4CJCA 1G95A 1H7FA 2YQCA 2OEFA 1GWVA 2V0JA 5C1HA 1H7EA 1S4NA 2AESA 2WAWA 2RJ8A 1MP3A 2RJ1A 2AH9A 2RJ4A 2GGQA 2O1GA 2YQHA 5CQMX 3BCVA 3I0IX 2O1FA 1IINA 1FOAA 1S4PA 1W77A 3JUKA 4FRPA 1I52A 2MZBA 3CU0A 4FRQA 1ON8A 2YC3A 3Q80A 1H7QA 5FTVA 3SPTA 3I0EA 4Y7GA 2E8BA 2FFVA 3TQDA 1GQ9A 2FY7A 2ICYA 1NWGB 4Y6UA 4P00A 2X5SA 4P02A 3IOIA 1PZTA 2AM5A 4Y6NA 4ARWA 5AJNA 2JCLA 3T7NA 2D0JA 3I0HA 3I0GA 1HV9A 1G1LA 4NAKA 1H5TB 1OMXA 3ZLKA 5HS2A 1OQMB 1K4VA 2I5EA 2I7BA 4EE4A 4EVWA 3SX7A 4DDZA 5C3DA 3PNNA 1FXJA 3POLA 3U2UA 1H4CA 4B2XA 2ZU9A 3K8EA 3EE5A 5EJZA 4Y9XA 1QG8A 1WT1A 2VSHA 4YS8A 1LZJA 4FQWA 1O23B 1VZTA 1FGGA 4EEOA 1WVCA 2RIZA 1H5SB 1E5KA 1FWYA 1VGWA 3CKJA 1O0RA 3OGZA 1QGSA 2UX8A 2YQSA 1H3MA 3OH3A 2FFUA 3SXGA 4Y7UA 1VGUA 1R7XA 4KC4A 1FGXA 2D7IA 4B4GA 1JV3A 1FRWA 1JV1A 2WEEA 5FU8A 4B5BA 2OEGA 2V0IA 2Y6PA 3K8DA 1ZJ0A 2P72A 1R81A 1G2VA 4ASYA 3SXDA 5C1GA 2BO7A 3I0FA 4Y64A 1TW1A 4KNXA 1R7UA 5IFYA 3ZLLA 2AM4A 1VZXA 3I0KA 5CMHA 2V0KA 2YQJA 2AGDA 1YP3A 3U2VA 1ZJOA 4KPZA 3FWWA 1VH3A 1NQIB 3E26A 4D11C 1S4OA 2Y4MA 2WVMA 4Y7TA 5FU0A 4FCEA 3V0NA 2RJ5A 1ZJPA 5C38A 1G0RA 2PX7A 4NALA 4NAIA 5AJOA 1LZ0A 3R3IA 4HO0A 1LL3A 3PKPA 4CJ8A 1FO8A 1ZJ1A 1FR9A 3ZGFA 3OKRA 3U2WA 4AYJA 2Y4LA 3E25A 1W55A 3HL3A 3V0QA 4FRHA 2FYAA 1JYLA 2RIXA 2FYCB 2VD4A 4DECA 2ZU8A 4KRVA 1WT3A 2JCKA 1GWWA 2RJ7A 1GX4A 5EIYA 4CVHA 5C47A 3FOQA 1FO9A 1ZCTA 4CJBA 4AAWA 4B2WA 3KIAA 3OH0A 3U2XA 2VSIA 2RJ6A
chains in the Genus database with same CATH superfamily
4GBPA 3V8ZA 1VH1A 2D7RA 5IDSA 2WGZA 2JCOA 4FRDA 5CQOA 4D48A 1QGQA 3IOHA 1HJLA 4XWIA 1ZI4A 5C3AA 3CKOA 5C48A 1H5TA 5I1FA 3V0OA 4KQLA 1ZCUA 5C4DA 1FZWA 4Y63A 5DDVA 1ZI1A 5CQLX 4HO3A 2W0VA 4JISA 4AYLA 1HM0A 2JCJA 4ASJA 1LL2A 1NKHB 3CKQA 1EYRA 2YESA 5C36A 4KC1A 3U0YA 1HJJA 3V91A 5BXCA 1LL0A 3D5NA 2AECA 1ZCVA 1V84A 1R80A 3R2WA 1YP2A 4FREA 3TZTA 1SS9A 1H5SA 1FXOA 1VGZA 1ZCYA 1ZI5A 3F1YA 4HCQA 3OAMA 4Y7VA 4G3QA 3RMWA 4M2BA 3ST8A 1Z90A 4M2AA 5L6VA 1JVGA 2FYBA 3I0LA 2BO6A 3GUEA 1GA8A 2PGVA 3JTJA 2X65A 2WE9A 3USRA 4HO2A 5CMJA 4HG6A 4EEMA 3I0CA 2XMHA 1QWJA 1WSZA 2Q4JA 4R7PA 1LZ7A 1LVWA 2XMEA 1VZUA 2O1HA 1JYKA 5C8RA 1H5RB 1IIMA 3JUJA 4E1KA 3V0MA 1H5RA 5JQQA 2VS4A 1MP5A 1NHEB 4BQHA 1VICA 1H5SD 4UEGA 4FCUA 1WT0A 5CQNX 3D98A 4HO4A 4M28A 5FV9A 1H7HA 5AJPA 3I0JA 4K6RA 5FYEA 1NMMB 2QH5A 1G3LA 1G9RA 4C2SA 2QGIA 2V0HA 4ECMA 3CKNA 2XWLA 1VGTA 1INJA 2VXMA 1PZYB 3D8VA 2C0NA 1JVDA 4Y7FA 1HM8A 1YP4A 1H7LA 4J18A 5FUHA 4D0ZA 2BO4A 1VM8A 1XZ6A 5CMIA 1GX0A 2GGOA 4HO9A 1VPAA 1H7TA 3Q7UA 3CKVA 3NGWA 1H4DA 3V0PA 1ON6A 2ICXA 3V90A 1HM9A 1G8OA 1OMZA 2OI6A 1EZIA 3OH2A 1MP4A 4FRLA 5C4BA 3SX5A 5EJ1A 2CU2A 2E3DA 1TW5A 2PGYA 4EEGA 4EE3A 3OC9A 4B4MA 2OI7A 2W0WA 3LW6A 4FRMA 2NXVA 2P73A 1R7YA 1ZJ2A 2XWNA 3ZGGA 4NANA 1V83A 4MNDA 4HO6A 5CMGX 2X5ZA 1ZJ3A 1ZDFA 2AM3A 2RJ0A 2Z86A 5C4CA 3V8YA 1ZIZA 4IRQA 4G87A 3IOJA 2BO8A 4Q7CA 2A8UA 4JD0A 5C49A 4FRBA 3SXAA 2V0LA 2QKXA 2OI5A 3V0LA 1H4EA 5CQPA 1G97A 2WVKA 1FG5N 3DJ4A 3SXBA 4HO8A 1ZDGA 3SX3A 3RMVA 2AE7A 4G3PA 1H7GA 1H5SC 2XWMA 4MYBA 5DDTA 2Z87A 1YROB 5CMFX 2VXLA 4KC2A 2PA4A 4Y62A 3Q4SA 1R82A 4D0TA 4KNRA 2FYDB 1R7TA 4HOCA 1V82A 2YCMA 5C4FA 2X60A 4FRAA 1ZI3A 4FIXA 1MC3A 3CGXA 3QVBA 1ZHJA 4LW3A 1LZIA 5IDTA 2VS3A 4ZDQA 2Y7AA 3SXCA 4M4KA 3SX8A 4B3UA 5C1LA 4AC3A 4BMAA 4FROA 3T7MA 3U0XA 1G23A 5C4EA 3I0DA 3OH4A 1W57A 2J0BA 4HO5A 3DK5A 4KPXA 2P6WA 1KWSA 1WT2A 5J49A 4KT7A 4B42A 5L6SA 2VS5A 1TVYA 2APCA 4IRPA 4B4BA 1FR8A 4L41C 3USQA 4LW6A 5C3BA 2VFZA 2I5KA 4EEAA 2A8WA 2RITA 3PKQA 3BRKX 3ZF8A 4KXOA 1TZFA 1R7VA 1GQCA 3SXEA 1INIA 2Y4KA 4D11A 5D92A 4EE5A 4DE7A 2ZU7A 4G3SA 3O3PA 5FTSA 1XHBA 2DPWA 3N9WA 1NF5B 3OH1A 4FIYA 2RIYA 3F1CA 1O7OA 2RJ9A 3DUVA 2Y4JA 3T7OA 1G93A 3U2TA 1O7QA 2WVLA 3RSBA 2YC5A 4CJCA 1G95A 1H7FA 2YQCA 2OEFA 1GWVA 2V0JA 5C1HA 1H7EA 1S4NA 2AESA 2WAWA 2RJ8A 1MP3A 2RJ1A 2AH9A 2RJ4A 2GGQA 2O1GA 2YQHA 5CQMX 3BCVA 3I0IX 2O1FA 1IINA 1FOAA 1S4PA 1W77A 3JUKA 4FRPA 1I52A 2MZBA 3CU0A 4FRQA 1ON8A 2YC3A 3Q80A 1H7QA 5FTVA 3SPTA 3I0EA 4Y7GA 2E8BA 2FFVA 3TQDA 1GQ9A 2FY7A 2ICYA 1NWGB 4Y6UA 4P00A 2X5SA 4P02A 3IOIA 1PZTA 2AM5A 4Y6NA 4ARWA 5AJNA 2JCLA 3T7NA 2D0JA 3I0HA 3I0GA 1HV9A 1G1LA 4NAKA 1H5TB 1OMXA 3ZLKA 5HS2A 1OQMB 1K4VA 2I5EA 2I7BA 4EE4A 4EVWA 3SX7A 4DDZA 5C3DA 3PNNA 1FXJA 3POLA 3U2UA 1H4CA 4B2XA 2ZU9A 4MIXA 3K8EA 3EE5A 5EJZA 4Y9XA 1QG8A 1WT1A 2VSHA 4YS8A 1LZJA 4FQWA 4O6NA 1O23B 1VZTA 1FGGA 4EEOA 1WVCA 2RIZA 1H5SB 1E5KA 1FWYA 1VGWA 3CKJA 1O0RA 3OGZA 1QGSA 2UX8A 2YQSA 1H3MA 3OH3A 2FFUA 3SXGA 4Y7UA 1VGUA 1R7XA 4KC4A 1FGXA 2D7IA 4B4GA 1JV3A 1FRWA 1JV1A 2WEEA 5FU8A 4B5BA 2OEGA 2V0IA 2Y6PA 3K8DA 1ZJ0A 2P72A 1R81A 1G2VA 4ASYA 3SXDA 5C1GA 2BO7A 3I0FA 4Y64A 1TW1A 4KNXA 4O6MA 1R7UA 5IFYA 3ZLLA 2AM4A 1VZXA 3I0KA 5CMHA 2V0KA 2YQJA 2AGDA 1YP3A 3U2VA 2VK9A 1ZJOA 4KPZA 3FWWA 1VH3A 1NQIB 3E26A 4D11C 1S4OA 2Y4MA 2WVMA 4Y7TA 5FU0A 4FCEA 3V0NA 2RJ5A 1ZJPA 5C38A 1G0RA 2PX7A 4NALA 4NAIA 5D91A 5AJOA 1LZ0A 3R3IA 4HO0A 1LL3A 3PKPA 4CJ8A 1FO8A 1ZJ1A 1FR9A 3ZGFA 3OKRA 3U2WA 4AYJA 2Y4LA 3E25A 1W55A 3HL3A 3V0QA 4FRHA 2FYAA 1JYLA 2RIXA 2FYCB 2VD4A 4DECA 2ZU8A 4KRVA 1WT3A 2JCKA 1GWWA 2RJ7A 1GX4A 5EIYA 4CVHA 5C47A 3FOQA 1FO9A 1ZCTA 4CJBA 4AAWA 4B2WA 3KIAA 3OH0A 3U2XA 2VSIA 2J0AA 2RJ6A
chains in the Genus database with same CATH topology
4GBPA 3V8ZA 1VH1A 2D7RA 5IDSA 2WGZA 2JCOA 4FRDA 5CQOA 4D48A 1QGQA 3IOHA 1HJLA 4XWIA 1ZI4A 5C3AA 3CKOA 5C48A 1H5TA 5I1FA 3V0OA 4KQLA 1ZCUA 5C4DA 1FZWA 4Y63A 5DDVA 1ZI1A 5CQLX 4HO3A 2W0VA 4JISA 4AYLA 1HM0A 2JCJA 4ASJA 1LL2A 1NKHB 3CKQA 1EYRA 2YESA 5C36A 4KC1A 3U0YA 1HJJA 3V91A 5BXCA 1LL0A 3D5NA 2AECA 1ZCVA 1V84A 1R80A 3R2WA 1YP2A 4FREA 3TZTA 1SS9A 1H5SA 1FXOA 1VGZA 1ZCYA 1ZI5A 3F1YA 4HCQA 3OAMA 4Y7VA 4G3QA 3RMWA 4M2BA 3ST8A 1Z90A 4M2AA 5L6VA 1JVGA 2FYBA 3I0LA 2BO6A 3GUEA 1GA8A 2PGVA 3JTJA 2X65A 2WE9A 3USRA 4HO2A 5CMJA 4HG6A 4EEMA 3I0CA 2XMHA 1QWJA 1WSZA 2Q4JA 4R7PA 1LZ7A 1LVWA 2XMEA 1VZUA 2O1HA 1JYKA 5C8RA 1H5RB 1IIMA 3JUJA 4E1KA 3V0MA 1H5RA 5JQQA 2VS4A 1MP5A 1NHEB 4BQHA 1VICA 1H5SD 4UEGA 4FCUA 1WT0A 5CQNX 3D98A 4HO4A 4M28A 5FV9A 1H7HA 5AJPA 3I0JA 4K6RA 5FYEA 1NMMB 2QH5A 1G3LA 1G9RA 4C2SA 2QGIA 2V0HA 4ECMA 3CKNA 2XWLA 1VGTA 1INJA 2VXMA 1PZYB 3D8VA 2C0NA 1JVDA 4Y7FA 1HM8A 1YP4A 1H7LA 4J18A 5FUHA 4D0ZA 2BO4A 1VM8A 1XZ6A 5CMIA 1GX0A 2GGOA 4HO9A 1VPAA 1H7TA 3Q7UA 3CKVA 3NGWA 1H4DA 3V0PA 1ON6A 2ICXA 3V90A 1HM9A 1G8OA 1OMZA 2OI6A 1EZIA 3OH2A 1MP4A 4FRLA 5C4BA 3SX5A 5EJ1A 2CU2A 2E3DA 1TW5A 2PGYA 4EEGA 4EE3A 3OC9A 4B4MA 2OI7A 2W0WA 3LW6A 4FRMA 2NXVA 2P73A 1R7YA 1ZJ2A 2XWNA 3ZGGA 4NANA 1V83A 4MNDA 4HO6A 5CMGX 2X5ZA 1ZJ3A 1ZDFA 2AM3A 2RJ0A 2Z86A 5C4CA 3V8YA 1ZIZA 4IRQA 4G87A 3IOJA 2BO8A 4Q7CA 2A8UA 4JD0A 5C49A 4FRBA 3SXAA 2V0LA 2QKXA 2OI5A 3V0LA 1H4EA 5CQPA 1G97A 2WVKA 1FG5N 3DJ4A 3SXBA 4HO8A 1ZDGA 3SX3A 3RMVA 2AE7A 4G3PA 1H7GA 1H5SC 2XWMA 4MYBA 5DDTA 2Z87A 1YROB 5CMFX 2VXLA 4KC2A 2PA4A 4Y62A 3Q4SA 1R82A 4D0TA 4KNRA 2FYDB 1R7TA 4HOCA 1V82A 2YCMA 5C4FA 2X60A 4FRAA 1ZI3A 4FIXA 1MC3A 3CGXA 3QVBA 1ZHJA 4LW3A 1LZIA 5IDTA 2VS3A 4ZDQA 2Y7AA 3SXCA 4M4KA 3SX8A 4B3UA 5C1LA 4AC3A 4BMAA 4FROA 3T7MA 3U0XA 1G23A 5C4EA 3I0DA 3OH4A 1W57A 2J0BA 4HO5A 3DK5A 4KPXA 2P6WA 1KWSA 1WT2A 5J49A 4KT7A 4B42A 5L6SA 2VS5A 1TVYA 2APCA 4IRPA 4B4BA 1FR8A 4L41C 3USQA 4LW6A 5C3BA 2VFZA 2I5KA 4EEAA 2A8WA 2RITA 3PKQA 3BRKX 3ZF8A 4KXOA 1TZFA 1R7VA 1GQCA 3SXEA 1INIA 2Y4KA 4D11A 5D92A 4EE5A 4DE7A 2ZU7A 4G3SA 3O3PA 5FTSA 1XHBA 2DPWA 3N9WA 1NF5B 3OH1A 4FIYA 2RIYA 3F1CA 1O7OA 2RJ9A 3DUVA 2Y4JA 3T7OA 1G93A 3U2TA 1O7QA 2WVLA 3RSBA 2YC5A 4CJCA 1G95A 1H7FA 2YQCA 2OEFA 1GWVA 2V0JA 5C1HA 1H7EA 1S4NA 2AESA 2WAWA 2RJ8A 1MP3A 2RJ1A 2AH9A 2RJ4A 2GGQA 2O1GA 2YQHA 5CQMX 3BCVA 3I0IX 2O1FA 1IINA 1FOAA 1S4PA 1W77A 3JUKA 4FRPA 1I52A 2MZBA 3CU0A 4FRQA 1ON8A 2YC3A 3Q80A 1H7QA 5FTVA 3SPTA 3I0EA 4Y7GA 2E8BA 2FFVA 3TQDA 1GQ9A 2FY7A 2ICYA 1NWGB 4Y6UA 4P00A 2X5SA 4P02A 3IOIA 1PZTA 2AM5A 4Y6NA 4ARWA 5AJNA 2JCLA 3T7NA 2D0JA 3I0HA 3I0GA 1HV9A 1G1LA 4NAKA 1H5TB 1OMXA 3ZLKA 5HS2A 1OQMB 1K4VA 2I5EA 2I7BA 4EE4A 4EVWA 3SX7A 4DDZA 5C3DA 3PNNA 1FXJA 3POLA 3U2UA 1H4CA 4B2XA 2ZU9A 4MIXA 3K8EA 3EE5A 5EJZA 4Y9XA 1QG8A 1WT1A 2VSHA 4YS8A 1LZJA 4FQWA 4O6NA 1O23B 1VZTA 1FGGA 4EEOA 1WVCA 2RIZA 1H5SB 1E5KA 1FWYA 1VGWA 3CKJA 1O0RA 3OGZA 1QGSA 2UX8A 2YQSA 1H3MA 3OH3A 2FFUA 3SXGA 4Y7UA 1VGUA 1R7XA 4KC4A 1FGXA 2D7IA 4B4GA 1JV3A 1FRWA 1JV1A 2WEEA 5FU8A 4B5BA 2OEGA 2V0IA 2Y6PA 3K8DA 1ZJ0A 2P72A 1R81A 1G2VA 4ASYA 3SXDA 5C1GA 2BO7A 3I0FA 4Y64A 1TW1A 4KNXA 4O6MA 1R7UA 5IFYA 3ZLLA 2AM4A 1VZXA 3I0KA 5CMHA 2V0KA 2YQJA 2AGDA 1YP3A 3U2VA 2VK9A 1ZJOA 4KPZA 3FWWA 1VH3A 1NQIB 3E26A 4D11C 1S4OA 2Y4MA 2WVMA 4Y7TA 5FU0A 4FCEA 3V0NA 2RJ5A 1ZJPA 5C38A 1G0RA 2PX7A 4NALA 4NAIA 5D91A 5AJOA 1LZ0A 3R3IA 4HO0A 1LL3A 3PKPA 4CJ8A 1FO8A 1ZJ1A 1FR9A 3ZGFA 3OKRA 3U2WA 4AYJA 2Y4LA 3E25A 1W55A 3HL3A 3V0QA 4FRHA 2FYAA 1JYLA 2RIXA 2FYCB 2VD4A 4DECA 2ZU8A 4KRVA 1WT3A 2JCKA 1GWWA 2RJ7A 1GX4A 5EIYA 4CVHA 5C47A 3FOQA 1FO9A 1ZCTA 4CJBA 4AAWA 4B2WA 3KIAA 3OH0A 3U2XA 2VSIA 2J0AA 2RJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBP A;  3V8Z A;  1VH1 A;  2D7R A;  5IDS A;  2WGZ A;  2JCO A;  4FRD A;  5CQO A;  4D48 A;  1QGQ A;  3IOH A;  1HJL A;  4XWI A;  1ZI4 A;  5C3A A;  3CKO A;  5C48 A;  1H5T A;  5I1F A;  3V0O A;  4KQL A;  1ZCU A;  5C4D A;  1FZW A;  4Y63 A;  5DDV A;  1ZI1 A;  5CQL X;  4HO3 A;  2W0V A;  4JIS A;  4AYL A;  1HM0 A;  2JCJ A;  4ASJ A;  1LL2 A;  1NKH B;  3CKQ A;  1EYR A;  2YES A;  5C36 A;  4KC1 A;  3U0Y A;  1HJJ A;  3V91 A;  5BXC A;  1LL0 A;  3D5N A;  2AEC A;  1ZCV A;  1V84 A;  1R80 A;  3R2W A;  1YP2 A;  4FRE A;  3TZT A;  1SS9 A;  1H5S A;  1FXO A;  1VGZ A;  1ZCY A;  1ZI5 A;  3F1Y A;  4HCQ A;  3OAM A;  4Y7V A;  4G3Q A;  3RMW A;  4M2B A;  3ST8 A;  1Z90 A;  4M2A A;  5L6V A;  1JVG A;  2FYB A;  3I0L A;  2BO6 A;  3GUE A;  1GA8 A;  2PGV A;  3JTJ A;  2X65 A;  2WE9 A;  3USR A;  4HO2 A;  5CMJ A;  4HG6 A;  4EEM A;  3I0C A;  2XMH A;  1QWJ A;  1WSZ A;  2Q4J A;  4R7P A;  1LZ7 A;  1LVW A;  2XME A;  1VZU A;  2O1H A;  1JYK A;  5C8R A;  1H5R B;  1IIM A;  3JUJ A;  4E1K A;  3V0M A;  1H5R A;  5JQQ A;  2VS4 A;  1MP5 A;  1NHE B;  4BQH A;  1VIC A;  1H5S D;  4UEG A;  4FCU A;  1WT0 A;  5CQN X;  3D98 A;  4HO4 A;  4M28 A;  5FV9 A;  1H7H A;  5AJP A;  3I0J A;  4K6R A;  5FYE A;  1NMM B;  2QH5 A;  1G3L A;  1G9R A;  4C2S A;  2QGI A;  2V0H A;  4ECM A;  3CKN A;  2XWL A;  1VGT A;  1INJ A;  2VXM A;  1PZY B;  3D8V A;  1JVD A;  4Y7F A;  1HM8 A;  1YP4 A;  1H7L A;  4J18 A;  5FUH A;  4D0Z A;  2BO4 A;  1VM8 A;  1XZ6 A;  5CMI A;  1GX0 A;  2GGO A;  4HO9 A;  1VPA A;  1H7T A;  3Q7U A;  3CKV A;  3NGW A;  1H4D A;  3V0P A;  1ON6 A;  2ICX A;  3V90 A;  1HM9 A;  1G8O A;  1OMZ A;  2OI6 A;  1EZI A;  3OH2 A;  1MP4 A;  4FRL A;  5C4B A;  3SX5 A;  5EJ1 A;  2CU2 A;  2E3D A;  1TW5 A;  2PGY A;  4EEG A;  4EE3 A;  3OC9 A;  4B4M A;  2OI7 A;  2W0W A;  3LW6 A;  4FRM A;  2NXV A;  2P73 A;  1R7Y A;  1ZJ2 A;  2XWN A;  3ZGG A;  4NAN A;  1V83 A;  4MND A;  4HO6 A;  5CMG X;  2X5Z A;  1ZJ3 A;  1ZDF A;  2AM3 A;  2RJ0 A;  2Z86 A;  5C4C A;  3V8Y A;  1ZIZ A;  4IRQ A;  4G87 A;  3IOJ A;  2BO8 A;  2A8U A;  4JD0 A;  5C49 A;  4FRB A;  3SXA A;  2V0L A;  2QKX A;  2OI5 A;  3V0L A;  1H4E A;  5CQP A;  1G97 A;  2WVK A;  1FG5 N;  3DJ4 A;  3SXB A;  4HO8 A;  1ZDG A;  3SX3 A;  3RMV A;  2AE7 A;  4G3P A;  1H7G A;  1H5S C;  2XWM A;  4MYB A;  5DDT A;  2Z87 A;  1YRO B;  5CMF X;  2VXL A;  4KC2 A;  2PA4 A;  4Y62 A;  3Q4S A;  1R82 A;  4D0T A;  4KNR A;  2FYD B;  1R7T A;  4HOC A;  1V82 A;  2YCM A;  5C4F A;  2X60 A;  4FRA A;  1ZI3 A;  1MC3 A;  3CGX A;  3QVB A;  1ZHJ A;  4LW3 A;  1LZI A;  5IDT A;  2VS3 A;  4ZDQ A;  2Y7A A;  3SXC A;  4M4K A;  3SX8 A;  4B3U A;  5C1L A;  4AC3 A;  4BMA A;  4FRO A;  3T7M A;  3U0X A;  1G23 A;  5C4E A;  3I0D A;  3OH4 A;  1W57 A;  4HO5 A;  3DK5 A;  4KPX A;  2P6W A;  1KWS A;  1WT2 A;  5J49 A;  4KT7 A;  4B42 A;  5L6S A;  2VS5 A;  1TVY A;  2APC A;  4IRP A;  4B4B A;  1FR8 A;  4L41 C;  3USQ A;  4LW6 A;  5C3B A;  2VFZ A;  2I5K A;  4EEA A;  2A8W A;  2RIT A;  3PKQ A;  3BRK X;  3ZF8 A;  4KXO A;  1TZF A;  1R7V A;  1GQC A;  3SXE A;  1INI A;  2Y4K A;  4D11 A;  4EE5 A;  4DE7 A;  2ZU7 A;  4G3S A;  3O3P A;  5FTS A;  1XHB A;  2DPW A;  3N9W A;  1NF5 B;  3OH1 A;  2RIY A;  3F1C A;  1O7O A;  2RJ9 A;  3DUV A;  2Y4J A;  3T7O A;  1G93 A;  3U2T A;  1O7Q A;  2WVL A;  3RSB A;  2YC5 A;  4CJC A;  1G95 A;  1H7F A;  2YQC A;  2OEF A;  1GWV A;  2V0J A;  5C1H A;  1H7E A;  1S4N A;  2AES A;  2WAW A;  2RJ8 A;  1MP3 A;  2RJ1 A;  2AH9 A;  2RJ4 A;  2GGQ A;  2O1G A;  2YQH A;  5CQM X;  3BCV A;  3I0I X;  2O1F A;  1IIN A;  1FOA A;  1S4P A;  1W77 A;  3JUK A;  4FRP A;  1I52 A;  2MZB A;  3CU0 A;  4FRQ A;  1ON8 A;  2YC3 A;  3Q80 A;  1H7Q A;  5FTV A;  3SPT A;  3I0E A;  4Y7G A;  2E8B A;  2FFV A;  3TQD A;  1GQ9 A;  2FY7 A;  2ICY A;  1NWG B;  4Y6U A;  4P00 A;  2X5S A;  4P02 A;  3IOI A;  1PZT A;  2AM5 A;  4Y6N A;  4ARW A;  5AJN A;  2JCL A;  3T7N A;  2D0J A;  3I0H A;  3I0G A;  1HV9 A;  1G1L A;  4NAK A;  1H5T B;  1OMX A;  3ZLK A;  5HS2 A;  1OQM B;  1K4V A;  2I5E A;  2I7B A;  4EE4 A;  4EVW A;  3SX7 A;  4DDZ A;  5C3D A;  3PNN A;  1FXJ A;  3POL A;  3U2U A;  1H4C A;  4B2X A;  2ZU9 A;  3K8E A;  3EE5 A;  5EJZ A;  4Y9X A;  1QG8 A;  1WT1 A;  2VSH A;  4YS8 A;  1LZJ A;  4FQW A;  1O23 B;  1VZT A;  1FGG A;  4EEO A;  1WVC A;  2RIZ A;  1H5S B;  1E5K A;  1FWY A;  1VGW A;  3CKJ A;  1O0R A;  3OGZ A;  1QGS A;  2UX8 A;  2YQS A;  1H3M A;  3OH3 A;  2FFU A;  3SXG A;  4Y7U A;  1VGU A;  1R7X A;  4KC4 A;  1FGX A;  2D7I A;  4B4G A;  1JV3 A;  1FRW A;  1JV1 A;  2WEE A;  5FU8 A;  4B5B A;  2OEG A;  2V0I A;  2Y6P A;  3K8D A;  1ZJ0 A;  2P72 A;  1R81 A;  1G2V A;  4ASY A;  3SXD A;  5C1G A;  2BO7 A;  3I0F A;  4Y64 A;  1TW1 A;  4KNX A;  1R7U A;  5IFY A;  3ZLL A;  2AM4 A;  1VZX A;  3I0K A;  5CMH A;  2V0K A;  2YQJ A;  2AGD A;  1YP3 A;  3U2V A;  1ZJO A;  4KPZ A;  3FWW A;  1VH3 A;  1NQI B;  3E26 A;  4D11 C;  1S4O A;  2Y4M A;  2WVM A;  4Y7T A;  5FU0 A;  4FCE A;  3V0N A;  2RJ5 A;  1ZJP A;  5C38 A;  1G0R A;  2PX7 A;  4NAL A;  4NAI A;  5AJO A;  1LZ0 A;  3R3I A;  4HO0 A;  1LL3 A;  3PKP A;  4CJ8 A;  1FO8 A;  1ZJ1 A;  1FR9 A;  3ZGF A;  3OKR A;  3U2W A;  4AYJ A;  2Y4L A;  3E25 A;  1W55 A;  3HL3 A;  3V0Q A;  4FRH A;  2FYA A;  1JYL A;  2RIX A;  2FYC B;  2VD4 A;  4DEC A;  2ZU8 A;  4KRV A;  1WT3 A;  2JCK A;  1GWW A;  2RJ7 A;  1GX4 A;  5EIY A;  4CVH A;  5C47 A;  3FOQ A;  1FO9 A;  1ZCT A;  4CJB A;  4AAW A;  4B2W A;  3KIA A;  3OH0 A;  3U2X A;  2VSI A;  2RJ6 A; 
#chains in the Genus database with same CATH topology
 4GBP A;  3V8Z A;  1VH1 A;  2D7R A;  5IDS A;  2WGZ A;  2JCO A;  4FRD A;  5CQO A;  4D48 A;  1QGQ A;  3IOH A;  1HJL A;  4XWI A;  1ZI4 A;  5C3A A;  3CKO A;  5C48 A;  1H5T A;  5I1F A;  3V0O A;  4KQL A;  1ZCU A;  5C4D A;  1FZW A;  4Y63 A;  5DDV A;  1ZI1 A;  5CQL X;  4HO3 A;  2W0V A;  4JIS A;  4AYL A;  1HM0 A;  2JCJ A;  4ASJ A;  1LL2 A;  1NKH B;  3CKQ A;  1EYR A;  2YES A;  5C36 A;  4KC1 A;  3U0Y A;  1HJJ A;  3V91 A;  5BXC A;  1LL0 A;  3D5N A;  2AEC A;  1ZCV A;  1V84 A;  1R80 A;  3R2W A;  1YP2 A;  4FRE A;  3TZT A;  1SS9 A;  1H5S A;  1FXO A;  1VGZ A;  1ZCY A;  1ZI5 A;  3F1Y A;  4HCQ A;  3OAM A;  4Y7V A;  4G3Q A;  3RMW A;  4M2B A;  3ST8 A;  1Z90 A;  4M2A A;  5L6V A;  1JVG A;  2FYB A;  3I0L A;  2BO6 A;  3GUE A;  1GA8 A;  2PGV A;  3JTJ A;  2X65 A;  2WE9 A;  3USR A;  4HO2 A;  5CMJ A;  4HG6 A;  4EEM A;  3I0C A;  2XMH A;  1QWJ A;  1WSZ A;  2Q4J A;  4R7P A;  1LZ7 A;  1LVW A;  2XME A;  1VZU A;  2O1H A;  1JYK A;  5C8R A;  1H5R B;  1IIM A;  3JUJ A;  4E1K A;  3V0M A;  1H5R A;  5JQQ A;  2VS4 A;  1MP5 A;  1NHE B;  4BQH A;  1VIC A;  1H5S D;  4UEG A;  4FCU A;  1WT0 A;  5CQN X;  3D98 A;  4HO4 A;  4M28 A;  5FV9 A;  1H7H A;  5AJP A;  3I0J A;  4K6R A;  5FYE A;  1NMM B;  2QH5 A;  1G3L A;  1G9R A;  4C2S A;  2QGI A;  2V0H A;  4ECM A;  3CKN A;  2XWL A;  1VGT A;  1INJ A;  2VXM A;  1PZY B;  3D8V A;  2C0N A;  1JVD A;  4Y7F A;  1HM8 A;  1YP4 A;  1H7L A;  4J18 A;  5FUH A;  4D0Z A;  2BO4 A;  1VM8 A;  1XZ6 A;  5CMI A;  1GX0 A;  2GGO A;  4HO9 A;  1VPA A;  1H7T A;  3Q7U A;  3CKV A;  3NGW A;  1H4D A;  3V0P A;  1ON6 A;  2ICX A;  3V90 A;  1HM9 A;  1G8O A;  1OMZ A;  2OI6 A;  1EZI A;  3OH2 A;  1MP4 A;  4FRL A;  5C4B A;  3SX5 A;  5EJ1 A;  2CU2 A;  2E3D A;  1TW5 A;  2PGY A;  4EEG A;  4EE3 A;  3OC9 A;  4B4M A;  2OI7 A;  2W0W A;  3LW6 A;  4FRM A;  2NXV A;  2P73 A;  1R7Y A;  1ZJ2 A;  2XWN A;  3ZGG A;  4NAN A;  1V83 A;  4MND A;  4HO6 A;  5CMG X;  2X5Z A;  1ZJ3 A;  1ZDF A;  2AM3 A;  2RJ0 A;  2Z86 A;  5C4C A;  3V8Y A;  1ZIZ A;  4IRQ A;  4G87 A;  3IOJ A;  2BO8 A;  4Q7C A;  2A8U A;  4JD0 A;  5C49 A;  4FRB A;  3SXA A;  2V0L A;  2QKX A;  2OI5 A;  3V0L A;  1H4E A;  5CQP A;  1G97 A;  2WVK A;  1FG5 N;  3DJ4 A;  3SXB A;  4HO8 A;  1ZDG A;  3SX3 A;  3RMV A;  2AE7 A;  4G3P A;  1H7G A;  1H5S C;  2XWM A;  4MYB A;  5DDT A;  2Z87 A;  1YRO B;  5CMF X;  2VXL A;  4KC2 A;  2PA4 A;  4Y62 A;  3Q4S A;  1R82 A;  4D0T A;  4KNR A;  2FYD B;  1R7T A;  4HOC A;  1V82 A;  2YCM A;  5C4F A;  2X60 A;  4FRA A;  1ZI3 A;  4FIX A;  1MC3 A;  3CGX A;  3QVB A;  1ZHJ A;  4LW3 A;  1LZI A;  5IDT A;  2VS3 A;  4ZDQ A;  2Y7A A;  3SXC A;  4M4K A;  3SX8 A;  4B3U A;  5C1L A;  4AC3 A;  4BMA A;  4FRO A;  3T7M A;  3U0X A;  1G23 A;  5C4E A;  3I0D A;  3OH4 A;  1W57 A;  2J0B A;  4HO5 A;  3DK5 A;  4KPX A;  2P6W A;  1KWS A;  1WT2 A;  5J49 A;  4KT7 A;  4B42 A;  5L6S A;  2VS5 A;  1TVY A;  2APC A;  4IRP A;  4B4B A;  1FR8 A;  4L41 C;  3USQ A;  4LW6 A;  5C3B A;  2VFZ A;  2I5K A;  4EEA A;  2A8W A;  2RIT A;  3PKQ A;  3BRK X;  3ZF8 A;  4KXO A;  1TZF A;  1R7V A;  1GQC A;  3SXE A;  1INI A;  2Y4K A;  4D11 A;  5D92 A;  4EE5 A;  4DE7 A;  2ZU7 A;  4G3S A;  3O3P A;  5FTS A;  1XHB A;  2DPW A;  3N9W A;  1NF5 B;  3OH1 A;  4FIY A;  2RIY A;  3F1C A;  1O7O A;  2RJ9 A;  3DUV A;  2Y4J A;  3T7O A;  1G93 A;  3U2T A;  1O7Q A;  2WVL A;  3RSB A;  2YC5 A;  4CJC A;  1G95 A;  1H7F A;  2YQC A;  2OEF A;  1GWV A;  2V0J A;  5C1H A;  1H7E A;  1S4N A;  2AES A;  2WAW A;  2RJ8 A;  1MP3 A;  2RJ1 A;  2AH9 A;  2RJ4 A;  2GGQ A;  2O1G A;  2YQH A;  5CQM X;  3BCV A;  3I0I X;  2O1F A;  1IIN A;  1FOA A;  1S4P A;  1W77 A;  3JUK A;  4FRP A;  1I52 A;  2MZB A;  3CU0 A;  4FRQ A;  1ON8 A;  2YC3 A;  3Q80 A;  1H7Q A;  5FTV A;  3SPT A;  3I0E A;  4Y7G A;  2E8B A;  2FFV A;  3TQD A;  1GQ9 A;  2FY7 A;  2ICY A;  1NWG B;  4Y6U A;  4P00 A;  2X5S A;  4P02 A;  3IOI A;  1PZT A;  2AM5 A;  4Y6N A;  4ARW A;  5AJN A;  2JCL A;  3T7N A;  2D0J A;  3I0H A;  3I0G A;  1HV9 A;  1G1L A;  4NAK A;  1H5T B;  1OMX A;  3ZLK A;  5HS2 A;  1OQM B;  1K4V A;  2I5E A;  2I7B A;  4EE4 A;  4EVW A;  3SX7 A;  4DDZ A;  5C3D A;  3PNN A;  1FXJ A;  3POL A;  3U2U A;  1H4C A;  4B2X A;  2ZU9 A;  4MIX A;  3K8E A;  3EE5 A;  5EJZ A;  4Y9X A;  1QG8 A;  1WT1 A;  2VSH A;  4YS8 A;  1LZJ A;  4FQW A;  4O6N A;  1O23 B;  1VZT A;  1FGG A;  4EEO A;  1WVC A;  2RIZ A;  1H5S B;  1E5K A;  1FWY A;  1VGW A;  3CKJ A;  1O0R A;  3OGZ A;  1QGS A;  2UX8 A;  2YQS A;  1H3M A;  3OH3 A;  2FFU A;  3SXG A;  4Y7U A;  1VGU A;  1R7X A;  4KC4 A;  1FGX A;  2D7I A;  4B4G A;  1JV3 A;  1FRW A;  1JV1 A;  2WEE A;  5FU8 A;  4B5B A;  2OEG A;  2V0I A;  2Y6P A;  3K8D A;  1ZJ0 A;  2P72 A;  1R81 A;  1G2V A;  4ASY A;  3SXD A;  5C1G A;  2BO7 A;  3I0F A;  4Y64 A;  1TW1 A;  4KNX A;  4O6M A;  1R7U A;  5IFY A;  3ZLL A;  2AM4 A;  1VZX A;  3I0K A;  5CMH A;  2V0K A;  2YQJ A;  2AGD A;  1YP3 A;  3U2V A;  2VK9 A;  1ZJO A;  4KPZ A;  3FWW A;  1VH3 A;  1NQI B;  3E26 A;  4D11 C;  1S4O A;  2Y4M A;  2WVM A;  4Y7T A;  5FU0 A;  4FCE A;  3V0N A;  2RJ5 A;  1ZJP A;  5C38 A;  1G0R A;  2PX7 A;  4NAL A;  4NAI A;  5D91 A;  5AJO A;  1LZ0 A;  3R3I A;  4HO0 A;  1LL3 A;  3PKP A;  4CJ8 A;  1FO8 A;  1ZJ1 A;  1FR9 A;  3ZGF A;  3OKR A;  3U2W A;  4AYJ A;  2Y4L A;  3E25 A;  1W55 A;  3HL3 A;  3V0Q A;  4FRH A;  2FYA A;  1JYL A;  2RIX A;  2FYC B;  2VD4 A;  4DEC A;  2ZU8 A;  4KRV A;  1WT3 A;  2JCK A;  1GWW A;  2RJ7 A;  1GX4 A;  5EIY A;  4CVH A;  5C47 A;  3FOQ A;  1FO9 A;  1ZCT A;  4CJB A;  4AAW A;  4B2W A;  3KIA A;  3OH0 A;  3U2X A;  2VSI A;  2J0A A;  2RJ6 A; 
#chains in the Genus database with same CATH homology
 4GBP A;  3V8Z A;  1VH1 A;  2D7R A;  5IDS A;  2WGZ A;  2JCO A;  4FRD A;  5CQO A;  4D48 A;  1QGQ A;  3IOH A;  1HJL A;  4XWI A;  1ZI4 A;  5C3A A;  3CKO A;  5C48 A;  1H5T A;  5I1F A;  3V0O A;  4KQL A;  1ZCU A;  5C4D A;  1FZW A;  4Y63 A;  5DDV A;  1ZI1 A;  5CQL X;  4HO3 A;  2W0V A;  4JIS A;  4AYL A;  1HM0 A;  2JCJ A;  4ASJ A;  1LL2 A;  1NKH B;  3CKQ A;  1EYR A;  2YES A;  5C36 A;  4KC1 A;  3U0Y A;  1HJJ A;  3V91 A;  5BXC A;  1LL0 A;  3D5N A;  2AEC A;  1ZCV A;  1V84 A;  1R80 A;  3R2W A;  1YP2 A;  4FRE A;  3TZT A;  1SS9 A;  1H5S A;  1FXO A;  1VGZ A;  1ZCY A;  1ZI5 A;  3F1Y A;  4HCQ A;  3OAM A;  4Y7V A;  4G3Q A;  3RMW A;  4M2B A;  3ST8 A;  1Z90 A;  4M2A A;  5L6V A;  1JVG A;  2FYB A;  3I0L A;  2BO6 A;  3GUE A;  1GA8 A;  2PGV A;  3JTJ A;  2X65 A;  2WE9 A;  3USR A;  4HO2 A;  5CMJ A;  4HG6 A;  4EEM A;  3I0C A;  2XMH A;  1QWJ A;  1WSZ A;  2Q4J A;  4R7P A;  1LZ7 A;  1LVW A;  2XME A;  1VZU A;  2O1H A;  1JYK A;  5C8R A;  1H5R B;  1IIM A;  3JUJ A;  4E1K A;  3V0M A;  1H5R A;  5JQQ A;  2VS4 A;  1MP5 A;  1NHE B;  4BQH A;  1VIC A;  1H5S D;  4UEG A;  4FCU A;  1WT0 A;  5CQN X;  3D98 A;  4HO4 A;  4M28 A;  5FV9 A;  1H7H A;  5AJP A;  3I0J A;  4K6R A;  5FYE A;  1NMM B;  2QH5 A;  1G3L A;  1G9R A;  4C2S A;  2QGI A;  2V0H A;  4ECM A;  3CKN A;  2XWL A;  1VGT A;  1INJ A;  2VXM A;  1PZY B;  3D8V A;  2C0N A;  1JVD A;  4Y7F A;  1HM8 A;  1YP4 A;  1H7L A;  4J18 A;  5FUH A;  4D0Z A;  2BO4 A;  1VM8 A;  1XZ6 A;  5CMI A;  1GX0 A;  2GGO A;  4HO9 A;  1VPA A;  1H7T A;  3Q7U A;  3CKV A;  3NGW A;  1H4D A;  3V0P A;  1ON6 A;  2ICX A;  3V90 A;  1HM9 A;  1G8O A;  1OMZ A;  2OI6 A;  1EZI A;  3OH2 A;  1MP4 A;  4FRL A;  5C4B A;  3SX5 A;  5EJ1 A;  2CU2 A;  2E3D A;  1TW5 A;  2PGY A;  4EEG A;  4EE3 A;  3OC9 A;  4B4M A;  2OI7 A;  2W0W A;  3LW6 A;  4FRM A;  2NXV A;  2P73 A;  1R7Y A;  1ZJ2 A;  2XWN A;  3ZGG A;  4NAN A;  1V83 A;  4MND A;  4HO6 A;  5CMG X;  2X5Z A;  1ZJ3 A;  1ZDF A;  2AM3 A;  2RJ0 A;  2Z86 A;  5C4C A;  3V8Y A;  1ZIZ A;  4IRQ A;  4G87 A;  3IOJ A;  2BO8 A;  4Q7C A;  2A8U A;  4JD0 A;  5C49 A;  4FRB A;  3SXA A;  2V0L A;  2QKX A;  2OI5 A;  3V0L A;  1H4E A;  5CQP A;  1G97 A;  2WVK A;  1FG5 N;  3DJ4 A;  3SXB A;  4HO8 A;  1ZDG A;  3SX3 A;  3RMV A;  2AE7 A;  4G3P A;  1H7G A;  1H5S C;  2XWM A;  4MYB A;  5DDT A;  2Z87 A;  1YRO B;  5CMF X;  2VXL A;  4KC2 A;  2PA4 A;  4Y62 A;  3Q4S A;  1R82 A;  4D0T A;  4KNR A;  2FYD B;  1R7T A;  4HOC A;  1V82 A;  2YCM A;  5C4F A;  2X60 A;  4FRA A;  1ZI3 A;  4FIX A;  1MC3 A;  3CGX A;  3QVB A;  1ZHJ A;  4LW3 A;  1LZI A;  5IDT A;  2VS3 A;  4ZDQ A;  2Y7A A;  3SXC A;  4M4K A;  3SX8 A;  4B3U A;  5C1L A;  4AC3 A;  4BMA A;  4FRO A;  3T7M A;  3U0X A;  1G23 A;  5C4E A;  3I0D A;  3OH4 A;  1W57 A;  2J0B A;  4HO5 A;  3DK5 A;  4KPX A;  2P6W A;  1KWS A;  1WT2 A;  5J49 A;  4KT7 A;  4B42 A;  5L6S A;  2VS5 A;  1TVY A;  2APC A;  4IRP A;  4B4B A;  1FR8 A;  4L41 C;  3USQ A;  4LW6 A;  5C3B A;  2VFZ A;  2I5K A;  4EEA A;  2A8W A;  2RIT A;  3PKQ A;  3BRK X;  3ZF8 A;  4KXO A;  1TZF A;  1R7V A;  1GQC A;  3SXE A;  1INI A;  2Y4K A;  4D11 A;  5D92 A;  4EE5 A;  4DE7 A;  2ZU7 A;  4G3S A;  3O3P A;  5FTS A;  1XHB A;  2DPW A;  3N9W A;  1NF5 B;  3OH1 A;  4FIY A;  2RIY A;  3F1C A;  1O7O A;  2RJ9 A;  3DUV A;  2Y4J A;  3T7O A;  1G93 A;  3U2T A;  1O7Q A;  2WVL A;  3RSB A;  2YC5 A;  4CJC A;  1G95 A;  1H7F A;  2YQC A;  2OEF A;  1GWV A;  2V0J A;  5C1H A;  1H7E A;  1S4N A;  2AES A;  2WAW A;  2RJ8 A;  1MP3 A;  2RJ1 A;  2AH9 A;  2RJ4 A;  2GGQ A;  2O1G A;  2YQH A;  5CQM X;  3BCV A;  3I0I X;  2O1F A;  1IIN A;  1FOA A;  1S4P A;  1W77 A;  3JUK A;  4FRP A;  1I52 A;  2MZB A;  3CU0 A;  4FRQ A;  1ON8 A;  2YC3 A;  3Q80 A;  1H7Q A;  5FTV A;  3SPT A;  3I0E A;  4Y7G A;  2E8B A;  2FFV A;  3TQD A;  1GQ9 A;  2FY7 A;  2ICY A;  1NWG B;  4Y6U A;  4P00 A;  2X5S A;  4P02 A;  3IOI A;  1PZT A;  2AM5 A;  4Y6N A;  4ARW A;  5AJN A;  2JCL A;  3T7N A;  2D0J A;  3I0H A;  3I0G A;  1HV9 A;  1G1L A;  4NAK A;  1H5T B;  1OMX A;  3ZLK A;  5HS2 A;  1OQM B;  1K4V A;  2I5E A;  2I7B A;  4EE4 A;  4EVW A;  3SX7 A;  4DDZ A;  5C3D A;  3PNN A;  1FXJ A;  3POL A;  3U2U A;  1H4C A;  4B2X A;  2ZU9 A;  4MIX A;  3K8E A;  3EE5 A;  5EJZ A;  4Y9X A;  1QG8 A;  1WT1 A;  2VSH A;  4YS8 A;  1LZJ A;  4FQW A;  4O6N A;  1O23 B;  1VZT A;  1FGG A;  4EEO A;  1WVC A;  2RIZ A;  1H5S B;  1E5K A;  1FWY A;  1VGW A;  3CKJ A;  1O0R A;  3OGZ A;  1QGS A;  2UX8 A;  2YQS A;  1H3M A;  3OH3 A;  2FFU A;  3SXG A;  4Y7U A;  1VGU A;  1R7X A;  4KC4 A;  1FGX A;  2D7I A;  4B4G A;  1JV3 A;  1FRW A;  1JV1 A;  2WEE A;  5FU8 A;  4B5B A;  2OEG A;  2V0I A;  2Y6P A;  3K8D A;  1ZJ0 A;  2P72 A;  1R81 A;  1G2V A;  4ASY A;  3SXD A;  5C1G A;  2BO7 A;  3I0F A;  4Y64 A;  1TW1 A;  4KNX A;  4O6M A;  1R7U A;  5IFY A;  3ZLL A;  2AM4 A;  1VZX A;  3I0K A;  5CMH A;  2V0K A;  2YQJ A;  2AGD A;  1YP3 A;  3U2V A;  2VK9 A;  1ZJO A;  4KPZ A;  3FWW A;  1VH3 A;  1NQI B;  3E26 A;  4D11 C;  1S4O A;  2Y4M A;  2WVM A;  4Y7T A;  5FU0 A;  4FCE A;  3V0N A;  2RJ5 A;  1ZJP A;  5C38 A;  1G0R A;  2PX7 A;  4NAL A;  4NAI A;  5D91 A;  5AJO A;  1LZ0 A;  3R3I A;  4HO0 A;  1LL3 A;  3PKP A;  4CJ8 A;  1FO8 A;  1ZJ1 A;  1FR9 A;  3ZGF A;  3OKR A;  3U2W A;  4AYJ A;  2Y4L A;  3E25 A;  1W55 A;  3HL3 A;  3V0Q A;  4FRH A;  2FYA A;  1JYL A;  2RIX A;  2FYC B;  2VD4 A;  4DEC A;  2ZU8 A;  4KRV A;  1WT3 A;  2JCK A;  1GWW A;  2RJ7 A;  1GX4 A;  5EIY A;  4CVH A;  5C47 A;  3FOQ A;  1FO9 A;  1ZCT A;  4CJB A;  4AAW A;  4B2W A;  3KIA A;  3OH0 A;  3U2X A;  2VSI A;  2J0A A;  2RJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...