1MP5A

Y177f variant of s. enterica rmla
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQAGTAVSLEEKPLQPKSNYAVTGLFFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y177F VARIANT OF S. ENTERICA RmlA BOUND TO UDP-GLUCOSE
publication title Expanding pyrimidine diphosphosugar libraries via structure-based nucleotidylyltransferase engineering
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Transferase
total genus 95
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2002-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1mp5A00
2XWLA 5C47A 2D0JA 3N9WA 4KNXA 1R80A 2Y4LA 1VZUA 2YESA 3OGZA 3OH3A 1LZ7A 1LZIA 4BQHA 1JYLA 4D0TA 3ZLKA 2VS3A 1QWJA 4IRQA 5C3DA 1GA8A 4KT7A 2E8BA 2WVKA 2GGOA 2Y4MA 1FXOA 3V0LA 4ASJA 2WVMA 1G97A 4YS8A 1HV9A 2FYDB 2A8UA 1ZI5A 4L41C 2AE7A 1WVCA 5DDVA 3V0PA 2VS5A 1JVDA 1NHEB 4KPZA 5CQLX 3F1CA 3V0QA 1H5SA 3TZTA 1PZYB 2RJ9A 1H4EA 1FR8A 1H7FA 3RMVA 1NQIB 3V90A 4FROA 4UEGA 3T7OA 1GWVA 5EIYA 1ZDFA 2W0WA 1NMMB 3OH0A 4KPXA 1O7OA 4Y9XA 4HO6A 4KNRA 2BO7A 2FYBA 1ZIZA 2V0KA 1R7VA 2I5KA 3V0MA 3V0NA 4B2XA 1H7QA 2YC5A 1V84A 2PA4A 1VZXA 5C4FA 2MZBA 2FFUA 4G87A 1WT0A 2QH5A 1H7EA 1WT1A 2WVLA 1O23B 3SXCA 1R82A 2O1HA 2E3DA 1R7YA 5C49A 1IIMA 5CMIA 1H4CA 3U0YA 3SXEA 2BO4A 1LZ0A 1O0RA 2VFZA 4CJCA 1ZCYA 4FREA 2YCMA 2V0LA 1TW5A 2PGVA 4D11A 1G93A 4JD0A 2ZU8A 5C3BA 5AJPA 3TQDA 2O1GA 5C4EA 1SS9A 1FGGA 2RIXA 3I0LA 1H5RA 3R2WA 3JUKA 3SX5A 1MP5A 4D48A 2X5SA 1ZCVA 4FRQA 1VGWA 4MYBA 5FU0A 5FTVA 1E5KA 1INIA 2ICYA 3GUEA 2FYCB 4Y6UA 2WEEA 2RIZA 1S4PA 1ZDGA 3OKRA 1MC3A 1H5SB 2AECA 1ON8A 4KC1A 4NAIA 2NXVA 1QGSA 1ZJ1A 4FRPA 5L6VA 1R7XA 1ZJOA 5I1FA 1EZIA 2JCKA 3V8YA 4Y7VA 3Q4SA 3SX7A 2JCJA 3U2VA 2OI7A 5C38A 1LL2A 3ZGGA 5JQQA 2WE9A 2I5EA 2QGIA 2FYAA 1TW1A 5C8RA 4HO0A 5C1GA 5C48A 3E25A 2VXLA 3D98A 4B42A 1PZTA 3ST8A 2Y4JA 4EE4A 3K8EA 1S4NA 4Y7FA 4AYLA 5FYEA 3CGXA 4EE5A 2WGZA 3RSBA 1GQ9A 4JISA 1IINA 4EE3A 5CMJA 5IFYA 4FRMA 4KQLA 1VH1A 1ZCUA 4G3QA 5CMFX 2VSIA 3U2UA 4E1KA 3JTJA 4B5BA 1JVGA 3ZF8A 1FWYA 3SXGA 1FGXA 1VICA 2V0HA 1GX0A 3R3IA 4M2AA 3I0CA 3V91A 1G23A 2Y7AA 1FO8A 3CKJA 5FTSA 3SXAA 4G3PA 2D7RA 1LL3A 1VH3A 1ZJPA 2V0JA 1WSZA 2X60A 5EJZA 5BXCA 1ZJ2A 1FZWA 1FO9A 4Y64A 1EYRA 3D8VA 1H5RB 3I0EA 2ZU7A 2YQJA 1H3MA 2AH9A 3LW6A 1R81A 1H5SC 2AM5A 1G0RA 2X65A 4NALA 5CQMX 1LVWA 2P6WA 2D7IA 1H4DA 1R7UA 3NGWA 2I7BA 4Y7GA 3K8DA 3T7MA 3IOIA 4FRBA 1VPAA 1LL0A 1VGZA 2RJ0A 3U2WA 4KC4A 2BO8A 4B2WA 2RITA 4HO3A 1QG8A 1O7QA 2FY7A 1KWSA 2VD4A 1ZI1A 2QKXA 4R7PA 4AYJA 4DECA 5FU8A 1OMXA 3OH1A 2XMEA 4KRVA 2A8WA 1VGTA 1V83A 1MP4A 4BMAA 2RJ7A 1YP2A 3QVBA 1G3LA 2P73A 3Q7UA 1H7LA 2Y4KA 4LW6A 1H7TA 1YP4A 1XHBA 3I0FA 1OMZA 2AM4A 4EEOA 4EVWA 2Z86A 1G8OA 2VXMA 4NAKA 1LZJA 2YQHA 1HM0A 4ASYA 3RMWA 3U2XA 3SXBA 3POLA 3I0DA 1FOAA 1W55A 4EEMA 1FR9A 3O3PA 4XWIA 2XWMA 3HL3A 2OI5A 4LW3A 2CU2A 2RJ5A 1JV3A 4FCEA 1H5SD 2VS4A 4HO2A 2PGYA 4HO5A 2RIYA 2YQCA 4M2BA 3E26A 1K4VA 4HOCA 1S4OA 1Z90A 4HCQA 4Y7UA 4K6RA 3OAMA 1VGUA 3FWWA 2RJ4A 2WAWA 5IDTA 1FRWA 3D5NA 5AJNA 2GGQA 4AAWA 1MP3A 2RJ8A 1OQMB 4B3UA 1HM8A 1NF5B 3CU0A 3PKQA 2XWNA 4B4BA 2ZU9A 5C4DA 1W57A 4B4MA 2W0VA 4HO9A 1H5TA 5C4BA 1ZJ0A 1HJJA 4EEGA 3IOHA 2FFVA 3SX3A 4FRHA 2XMHA 4FQWA 2Q4JA 5CMHA 2RJ1A 5IDSA 4AC3A 4G3SA 1TZFA 3OH4A 4KXOA 1G95A 2JCLA 3OC9A 4HG6A 2AM3A 3IOJA 3CKOA 1H7HA 2Z87A 3EE5A 4MNDA 4P02A 1INJA 1HM9A 1ZJ3A 3USQA 4GBPA 2JCOA 3I0IX 5J49A 4Y63A 3SPTA 3V0OA 4CVHA 1GX4A 2V0IA 1QGQA 2OI6A 5HS2A 3I0HA 4NANA 1ON6A 1GQCA 1YROB 4DDZA 5CQOA 5FV9A 3JUJA 4P00A 1W77A 3USRA 1G9RA 1R7TA 4C2SA 2X5ZA 4M4KA 5C3AA 4IRPA 1H7GA 5DDTA 4B4GA 3BRKX 2UX8A 5CQPA 4ECMA 5C1LA 2PX7A 5EJ1A 1TVYA 1WT2A 2BO6A 4CJBA 3SXDA 2AGDA 4HO8A 1V82A 1FG5N 4FRLA 1HJLA 4Y62A 1ZI4A 4EEAA 3Q80A 1GWWA 4KC2A 1NKHB 1JYKA 4FCUA 1ZCTA 1ZHJA 2OEGA 1NWGB 3U2TA 4FRAA 1WT3A 1FXJA 4J18A 1H5TB 3I0GA 5FUHA 2P72A 3CKQA 3F1YA 5C36A 4D11C 1G1LA 4M28A 3CKVA 3CKNA 1ZI3A 4CJ8A 4HO4A 3FOQA 5CMGX 2O1FA 3BCVA 3PKPA 2RJ6A 4ZDQA 1VZTA 1YP3A 5C4CA 2ICXA 2YQSA 3DK5A 2OEFA 1VM8A 3PNNA 2APCA 3I0JA 1G2VA 4ARWA 3ZGFA 3ZLLA 3OH2A 1JV1A 5AJOA 5L6SA 3V8ZA 2Y6PA 4DE7A 4FRDA 2DPWA 2VSHA 3SX8A 3KIAA 2AESA 3DJ4A 3DUVA 3T7NA 4D0ZA 2YC3A 4Y6NA 1XZ6A 5C1HA 3I0KA 3U0XA 5CQNX 1I52A 4Y7TA
chains in the Genus database with same CATH superfamily
2XWLA 5C47A 2D0JA 3N9WA 4KNXA 1R80A 2Y4LA 1VZUA 2YESA 3OGZA 3OH3A 1LZ7A 1LZIA 4BQHA 1JYLA 4D0TA 3ZLKA 2VS3A 1QWJA 4IRQA 5C3DA 1GA8A 4KT7A 2E8BA 2WVKA 2GGOA 2Y4MA 1FXOA 3V0LA 4ASJA 2WVMA 1G97A 4YS8A 1HV9A 2FYDB 2A8UA 1ZI5A 4L41C 2AE7A 1WVCA 5DDVA 3V0PA 2VS5A 1JVDA 1NHEB 4KPZA 5CQLX 3F1CA 3V0QA 1H5SA 3TZTA 1PZYB 2RJ9A 1H4EA 1FR8A 1H7FA 3RMVA 1NQIB 3V90A 4FROA 4UEGA 3T7OA 1GWVA 5EIYA 1ZDFA 2W0WA 1NMMB 3OH0A 4KPXA 1O7OA 4Y9XA 4HO6A 4KNRA 2BO7A 2FYBA 1ZIZA 2V0KA 1R7VA 2I5KA 3V0MA 3V0NA 4B2XA 1H7QA 2YC5A 1V84A 2PA4A 1VZXA 5C4FA 2MZBA 2FFUA 4G87A 1WT0A 2QH5A 2J0AA 1H7EA 1WT1A 2WVLA 1O23B 3SXCA 1R82A 2O1HA 2E3DA 1R7YA 5C49A 1IIMA 5CMIA 1H4CA 3U0YA 3SXEA 2BO4A 1LZ0A 1O0RA 2VFZA 4CJCA 1ZCYA 5D91A 4FREA 2YCMA 2V0LA 1TW5A 2PGVA 4D11A 1G93A 4JD0A 2ZU8A 5C3BA 5AJPA 3TQDA 2O1GA 5C4EA 1SS9A 1FGGA 2RIXA 3I0LA 1H5RA 3R2WA 3JUKA 3SX5A 1MP5A 4D48A 2X5SA 1ZCVA 4FRQA 1VGWA 4MYBA 5FU0A 5FTVA 1E5KA 1INIA 2ICYA 3GUEA 2FYCB 4Y6UA 2WEEA 2RIZA 1S4PA 1ZDGA 3OKRA 1MC3A 1H5SB 2AECA 1ON8A 4KC1A 4NAIA 2NXVA 1QGSA 1ZJ1A 4FRPA 5L6VA 1R7XA 1ZJOA 5I1FA 1EZIA 2JCKA 3V8YA 4Y7VA 3Q4SA 3SX7A 2JCJA 3U2VA 2OI7A 5C38A 1LL2A 3ZGGA 5JQQA 2WE9A 2I5EA 2QGIA 2FYAA 1TW1A 5C8RA 4HO0A 5C1GA 5C48A 3E25A 2VXLA 3D98A 4B42A 1PZTA 3ST8A 2Y4JA 4EE4A 3K8EA 1S4NA 4Y7FA 4AYLA 5FYEA 3CGXA 4EE5A 2WGZA 3RSBA 1GQ9A 4JISA 1IINA 4EE3A 5CMJA 5IFYA 4FRMA 4KQLA 1VH1A 1ZCUA 4G3QA 4Q7CA 5CMFX 2VSIA 3U2UA 4E1KA 3JTJA 4B5BA 1JVGA 3ZF8A 1FWYA 3SXGA 1FGXA 1VICA 2V0HA 1GX0A 3R3IA 4M2AA 3I0CA 3V91A 1G23A 2Y7AA 4O6NA 1FO8A 3CKJA 5FTSA 3SXAA 4G3PA 2D7RA 1LL3A 1VH3A 1ZJPA 2V0JA 1WSZA 2VK9A 2X60A 4FIXA 5EJZA 5BXCA 1ZJ2A 1FZWA 1FO9A 4Y64A 1EYRA 3D8VA 1H5RB 3I0EA 2ZU7A 2YQJA 1H3MA 2AH9A 3LW6A 1R81A 1H5SC 2AM5A 1G0RA 2X65A 4NALA 5CQMX 1LVWA 2P6WA 2D7IA 1H4DA 1R7UA 3NGWA 2I7BA 4Y7GA 3K8DA 3T7MA 3IOIA 4FRBA 1VPAA 1LL0A 1VGZA 2RJ0A 3U2WA 4KC4A 2BO8A 4B2WA 2RITA 4HO3A 1QG8A 1O7QA 2FY7A 1KWSA 2VD4A 1ZI1A 2QKXA 4R7PA 4AYJA 4DECA 5FU8A 1OMXA 3OH1A 2XMEA 4KRVA 2A8WA 1VGTA 1V83A 1MP4A 4BMAA 2RJ7A 1YP2A 3QVBA 1G3LA 2P73A 3Q7UA 1H7LA 2Y4KA 4LW6A 1H7TA 1YP4A 1XHBA 3I0FA 1OMZA 2AM4A 4EEOA 4EVWA 2Z86A 1G8OA 2VXMA 4NAKA 1LZJA 2YQHA 1HM0A 5D92A 3RMWA 3U2XA 3SXBA 4ASYA 3POLA 3I0DA 1FOAA 1W55A 4EEMA 1FR9A 3O3PA 4XWIA 2XWMA 3HL3A 2OI5A 4LW3A 2CU2A 2RJ5A 1JV3A 4FCEA 1H5SD 2VS4A 4HO2A 2PGYA 4HO5A 2RIYA 2YQCA 4M2BA 3E26A 1K4VA 4HOCA 1S4OA 1Z90A 4HCQA 4Y7UA 4K6RA 3OAMA 1VGUA 3FWWA 2RJ4A 2WAWA 5IDTA 1FRWA 3D5NA 5AJNA 2GGQA 4AAWA 1MP3A 2RJ8A 1OQMB 4B3UA 1HM8A 1NF5B 3CU0A 3PKQA 4MIXA 2XWNA 4B4BA 2ZU9A 5C4DA 1W57A 4B4MA 2W0VA 4HO9A 1H5TA 5C4BA 2C0NA 1ZJ0A 1HJJA 4EEGA 3IOHA 2FFVA 3SX3A 4FRHA 2XMHA 4FQWA 2Q4JA 5CMHA 2RJ1A 5IDSA 4AC3A 4G3SA 1TZFA 3OH4A 4KXOA 1G95A 2JCLA 3OC9A 4HG6A 2AM3A 3IOJA 3CKOA 1H7HA 2Z87A 3EE5A 4MNDA 4P02A 1INJA 1HM9A 1ZJ3A 3USQA 4GBPA 2JCOA 3I0IX 5J49A 4Y63A 3SPTA 3V0OA 4CVHA 1GX4A 2V0IA 1QGQA 2OI6A 5HS2A 3I0HA 4NANA 1ON6A 1GQCA 1YROB 2J0BA 4DDZA 5CQOA 5FV9A 3JUJA 4P00A 1W77A 3USRA 1G9RA 1R7TA 4C2SA 2X5ZA 4M4KA 5C3AA 4IRPA 1H7GA 5DDTA 4B4GA 3BRKX 2UX8A 5CQPA 4ECMA 5C1LA 2PX7A 5EJ1A 1TVYA 1WT2A 2BO6A 4CJBA 3SXDA 2AGDA 4HO8A 1V82A 1FG5N 4FRLA 1HJLA 4Y62A 1ZI4A 4EEAA 3Q80A 1GWWA 4KC2A 1NKHB 1JYKA 4FCUA 1ZCTA 1ZHJA 2OEGA 1NWGB 3U2TA 4FRAA 1WT3A 1FXJA 4J18A 1H5TB 3I0GA 5FUHA 2P72A 3CKQA 3F1YA 5C36A 4D11C 1G1LA 4M28A 3CKVA 3CKNA 1ZI3A 4CJ8A 4HO4A 3FOQA 5CMGX 2O1FA 4O6MA 3BCVA 3PKPA 2RJ6A 4ZDQA 4FIYA 1VZTA 1YP3A 5C4CA 2ICXA 2YQSA 3DK5A 2OEFA 1VM8A 3PNNA 2APCA 3I0JA 1G2VA 4ARWA 3ZGFA 3ZLLA 3OH2A 1JV1A 5AJOA 5L6SA 3V8ZA 2Y6PA 4DE7A 4FRDA 2DPWA 2VSHA 3SX8A 3KIAA 2AESA 3DJ4A 3DUVA 3T7NA 4D0ZA 2YC3A 4Y6NA 1XZ6A 5C1HA 3I0KA 3U0XA 5CQNX 1I52A 4Y7TA
chains in the Genus database with same CATH topology
2XWLA 5C47A 2D0JA 3N9WA 4KNXA 1R80A 2Y4LA 1VZUA 2YESA 3OGZA 3OH3A 1LZ7A 1LZIA 4BQHA 1JYLA 4D0TA 3ZLKA 2VS3A 1QWJA 4IRQA 5C3DA 1GA8A 4KT7A 2E8BA 2WVKA 2GGOA 2Y4MA 1FXOA 3V0LA 4ASJA 2WVMA 1G97A 4YS8A 1HV9A 2FYDB 2A8UA 1ZI5A 4L41C 2AE7A 1WVCA 5DDVA 3V0PA 2VS5A 1JVDA 1NHEB 4KPZA 5CQLX 3F1CA 3V0QA 1H5SA 3TZTA 1PZYB 2RJ9A 1H4EA 1FR8A 1H7FA 3RMVA 1NQIB 3V90A 4FROA 4UEGA 3T7OA 1GWVA 5EIYA 1ZDFA 2W0WA 1NMMB 3OH0A 4KPXA 1O7OA 4Y9XA 4HO6A 4KNRA 2BO7A 2FYBA 1ZIZA 2V0KA 1R7VA 2I5KA 3V0MA 3V0NA 4B2XA 1H7QA 2YC5A 1V84A 2PA4A 1VZXA 5C4FA 2MZBA 2FFUA 4G87A 1WT0A 2QH5A 2J0AA 1H7EA 1WT1A 2WVLA 1O23B 3SXCA 1R82A 2O1HA 2E3DA 1R7YA 5C49A 1IIMA 5CMIA 1H4CA 3U0YA 3SXEA 2BO4A 1LZ0A 1O0RA 2VFZA 4CJCA 1ZCYA 5D91A 4FREA 2YCMA 2V0LA 1TW5A 2PGVA 4D11A 1G93A 4JD0A 2ZU8A 5C3BA 5AJPA 3TQDA 2O1GA 5C4EA 1SS9A 1FGGA 2RIXA 3I0LA 1H5RA 3R2WA 3JUKA 3SX5A 1MP5A 4D48A 2X5SA 1ZCVA 4FRQA 1VGWA 4MYBA 5FU0A 5FTVA 1E5KA 1INIA 2ICYA 3GUEA 2FYCB 4Y6UA 2WEEA 2RIZA 1S4PA 1ZDGA 3OKRA 1MC3A 1H5SB 2AECA 1ON8A 4KC1A 4NAIA 2NXVA 1QGSA 1ZJ1A 4FRPA 5L6VA 1R7XA 1ZJOA 5I1FA 1EZIA 2JCKA 3V8YA 4Y7VA 3Q4SA 3SX7A 2JCJA 3U2VA 2OI7A 5C38A 1LL2A 3ZGGA 5JQQA 2WE9A 2I5EA 2QGIA 2FYAA 1TW1A 5C8RA 4HO0A 5C1GA 5C48A 3E25A 2VXLA 3D98A 4B42A 1PZTA 3ST8A 2Y4JA 4EE4A 3K8EA 1S4NA 4Y7FA 4AYLA 5FYEA 3CGXA 4EE5A 2WGZA 3RSBA 1GQ9A 4JISA 1IINA 4EE3A 5CMJA 5IFYA 4FRMA 4KQLA 1VH1A 1ZCUA 4G3QA 4Q7CA 5CMFX 2VSIA 3U2UA 4E1KA 3JTJA 4B5BA 1JVGA 3ZF8A 1FWYA 3SXGA 1FGXA 1VICA 2V0HA 1GX0A 3R3IA 4M2AA 3I0CA 3V91A 1G23A 2Y7AA 4O6NA 1FO8A 3CKJA 5FTSA 3SXAA 4G3PA 2D7RA 1LL3A 1VH3A 1ZJPA 2V0JA 1WSZA 2VK9A 2X60A 4FIXA 5EJZA 5BXCA 1ZJ2A 1FZWA 1FO9A 4Y64A 1EYRA 3D8VA 1H5RB 3I0EA 2ZU7A 2YQJA 1H3MA 2AH9A 3LW6A 1R81A 1H5SC 2AM5A 1G0RA 2X65A 4NALA 5CQMX 1LVWA 2P6WA 2D7IA 1H4DA 1R7UA 3NGWA 2I7BA 4Y7GA 3K8DA 3T7MA 3IOIA 4FRBA 1VPAA 1LL0A 1VGZA 2RJ0A 3U2WA 4KC4A 2BO8A 4B2WA 2RITA 4HO3A 1QG8A 1O7QA 2FY7A 1KWSA 2VD4A 1ZI1A 2QKXA 4R7PA 4AYJA 4DECA 5FU8A 1OMXA 3OH1A 2XMEA 4KRVA 2A8WA 1VGTA 1V83A 1MP4A 4BMAA 2RJ7A 1YP2A 3QVBA 1G3LA 2P73A 3Q7UA 1H7LA 2Y4KA 4LW6A 1H7TA 1YP4A 1XHBA 3I0FA 1OMZA 2AM4A 4EEOA 4EVWA 2Z86A 1G8OA 2VXMA 4NAKA 1LZJA 2YQHA 1HM0A 5D92A 3RMWA 3U2XA 3SXBA 4ASYA 3POLA 3I0DA 1FOAA 1W55A 4EEMA 1FR9A 3O3PA 4XWIA 2XWMA 3HL3A 2OI5A 4LW3A 2CU2A 2RJ5A 1JV3A 4FCEA 1H5SD 2VS4A 4HO2A 2PGYA 4HO5A 2RIYA 2YQCA 4M2BA 3E26A 1K4VA 4HOCA 1S4OA 1Z90A 4HCQA 4Y7UA 4K6RA 3OAMA 1VGUA 3FWWA 2RJ4A 2WAWA 5IDTA 1FRWA 3D5NA 5AJNA 2GGQA 4AAWA 1MP3A 2RJ8A 1OQMB 4B3UA 1HM8A 1NF5B 3CU0A 3PKQA 4MIXA 2XWNA 4B4BA 2ZU9A 5C4DA 1W57A 4B4MA 2W0VA 4HO9A 1H5TA 5C4BA 2C0NA 1ZJ0A 1HJJA 4EEGA 3IOHA 2FFVA 3SX3A 4FRHA 2XMHA 4FQWA 2Q4JA 5CMHA 2RJ1A 5IDSA 4AC3A 4G3SA 1TZFA 3OH4A 4KXOA 1G95A 2JCLA 3OC9A 4HG6A 2AM3A 3IOJA 3CKOA 1H7HA 2Z87A 3EE5A 4MNDA 4P02A 1INJA 1HM9A 1ZJ3A 3USQA 4GBPA 2JCOA 3I0IX 5J49A 4Y63A 3SPTA 3V0OA 4CVHA 1GX4A 2V0IA 1QGQA 2OI6A 5HS2A 3I0HA 4NANA 1ON6A 1GQCA 1YROB 2J0BA 4DDZA 5CQOA 5FV9A 3JUJA 4P00A 1W77A 3USRA 1G9RA 1R7TA 4C2SA 2X5ZA 4M4KA 5C3AA 4IRPA 1H7GA 5DDTA 4B4GA 3BRKX 2UX8A 5CQPA 4ECMA 5C1LA 2PX7A 5EJ1A 1TVYA 1WT2A 2BO6A 4CJBA 3SXDA 2AGDA 4HO8A 1V82A 1FG5N 4FRLA 1HJLA 4Y62A 1ZI4A 4EEAA 3Q80A 1GWWA 4KC2A 1NKHB 1JYKA 4FCUA 1ZCTA 1ZHJA 2OEGA 1NWGB 3U2TA 4FRAA 1WT3A 1FXJA 4J18A 1H5TB 3I0GA 5FUHA 2P72A 3CKQA 3F1YA 5C36A 4D11C 1G1LA 4M28A 3CKVA 3CKNA 1ZI3A 4CJ8A 4HO4A 3FOQA 5CMGX 2O1FA 4O6MA 3BCVA 3PKPA 2RJ6A 4ZDQA 4FIYA 1VZTA 1YP3A 5C4CA 2ICXA 2YQSA 3DK5A 2OEFA 1VM8A 3PNNA 2APCA 3I0JA 1G2VA 4ARWA 3ZGFA 3ZLLA 3OH2A 1JV1A 5AJOA 5L6SA 3V8ZA 2Y6PA 4DE7A 4FRDA 2DPWA 2VSHA 3SX8A 3KIAA 2AESA 3DJ4A 3DUVA 3T7NA 4D0ZA 2YC3A 4Y6NA 1XZ6A 5C1HA 3I0KA 3U0XA 5CQNX 1I52A 4Y7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWL A;  5C47 A;  2D0J A;  3N9W A;  4KNX A;  1R80 A;  2Y4L A;  1VZU A;  2YES A;  3OGZ A;  3OH3 A;  1LZ7 A;  1LZI A;  4BQH A;  1JYL A;  4D0T A;  3ZLK A;  2VS3 A;  1QWJ A;  4IRQ A;  5C3D A;  1GA8 A;  4KT7 A;  2E8B A;  2WVK A;  2GGO A;  2Y4M A;  1FXO A;  3V0L A;  4ASJ A;  2WVM A;  1G97 A;  4YS8 A;  1HV9 A;  2FYD B;  2A8U A;  1ZI5 A;  4L41 C;  2AE7 A;  1WVC A;  5DDV A;  3V0P A;  2VS5 A;  1JVD A;  1NHE B;  4KPZ A;  5CQL X;  3F1C A;  3V0Q A;  1H5S A;  3TZT A;  1PZY B;  2RJ9 A;  1H4E A;  1FR8 A;  1H7F A;  3RMV A;  1NQI B;  3V90 A;  4FRO A;  4UEG A;  3T7O A;  1GWV A;  5EIY A;  1ZDF A;  2W0W A;  1NMM B;  3OH0 A;  4KPX A;  1O7O A;  4Y9X A;  4HO6 A;  4KNR A;  2BO7 A;  2FYB A;  1ZIZ A;  2V0K A;  1R7V A;  2I5K A;  3V0M A;  3V0N A;  4B2X A;  1H7Q A;  2YC5 A;  1V84 A;  2PA4 A;  1VZX A;  5C4F A;  2MZB A;  2FFU A;  4G87 A;  1WT0 A;  2QH5 A;  1H7E A;  1WT1 A;  2WVL A;  1O23 B;  3SXC A;  1R82 A;  2O1H A;  2E3D A;  1R7Y A;  5C49 A;  1IIM A;  5CMI A;  1H4C A;  3U0Y A;  3SXE A;  2BO4 A;  1LZ0 A;  1O0R A;  2VFZ A;  4CJC A;  1ZCY A;  4FRE A;  2YCM A;  2V0L A;  1TW5 A;  2PGV A;  4D11 A;  1G93 A;  4JD0 A;  2ZU8 A;  5C3B A;  5AJP A;  3TQD A;  2O1G A;  5C4E A;  1SS9 A;  1FGG A;  2RIX A;  3I0L A;  1H5R A;  3R2W A;  3JUK A;  3SX5 A;  1MP5 A;  4D48 A;  2X5S A;  1ZCV A;  4FRQ A;  1VGW A;  4MYB A;  5FU0 A;  5FTV A;  1E5K A;  1INI A;  2ICY A;  3GUE A;  2FYC B;  4Y6U A;  2WEE A;  2RIZ A;  1S4P A;  1ZDG A;  3OKR A;  1MC3 A;  1H5S B;  2AEC A;  1ON8 A;  4KC1 A;  4NAI A;  2NXV A;  1QGS A;  1ZJ1 A;  4FRP A;  5L6V A;  1R7X A;  1ZJO A;  5I1F A;  1EZI A;  2JCK A;  3V8Y A;  4Y7V A;  3Q4S A;  3SX7 A;  2JCJ A;  3U2V A;  2OI7 A;  5C38 A;  1LL2 A;  3ZGG A;  5JQQ A;  2WE9 A;  2I5E A;  2QGI A;  2FYA A;  1TW1 A;  5C8R A;  4HO0 A;  5C1G A;  5C48 A;  3E25 A;  2VXL A;  3D98 A;  4B42 A;  1PZT A;  3ST8 A;  2Y4J A;  4EE4 A;  3K8E A;  1S4N A;  4Y7F A;  4AYL A;  5FYE A;  3CGX A;  4EE5 A;  2WGZ A;  3RSB A;  1GQ9 A;  4JIS A;  1IIN A;  4EE3 A;  5CMJ A;  5IFY A;  4FRM A;  4KQL A;  1VH1 A;  1ZCU A;  4G3Q A;  5CMF X;  2VSI A;  3U2U A;  4E1K A;  3JTJ A;  4B5B A;  1JVG A;  3ZF8 A;  1FWY A;  3SXG A;  1FGX A;  1VIC A;  2V0H A;  1GX0 A;  3R3I A;  4M2A A;  3I0C A;  3V91 A;  1G23 A;  2Y7A A;  1FO8 A;  3CKJ A;  5FTS A;  3SXA A;  4G3P A;  2D7R A;  1LL3 A;  1VH3 A;  1ZJP A;  2V0J A;  1WSZ A;  2X60 A;  5EJZ A;  5BXC A;  1ZJ2 A;  1FZW A;  1FO9 A;  4Y64 A;  1EYR A;  3D8V A;  1H5R B;  3I0E A;  2ZU7 A;  2YQJ A;  1H3M A;  2AH9 A;  3LW6 A;  1R81 A;  1H5S C;  2AM5 A;  1G0R A;  2X65 A;  4NAL A;  5CQM X;  1LVW A;  2P6W A;  2D7I A;  1H4D A;  1R7U A;  3NGW A;  2I7B A;  4Y7G A;  3K8D A;  3T7M A;  3IOI A;  4FRB A;  1VPA A;  1LL0 A;  1VGZ A;  2RJ0 A;  3U2W A;  4KC4 A;  2BO8 A;  4B2W A;  2RIT A;  4HO3 A;  1QG8 A;  1O7Q A;  2FY7 A;  1KWS A;  2VD4 A;  1ZI1 A;  2QKX A;  4R7P A;  4AYJ A;  4DEC A;  5FU8 A;  1OMX A;  3OH1 A;  2XME A;  4KRV A;  2A8W A;  1VGT A;  1V83 A;  1MP4 A;  4BMA A;  2RJ7 A;  1YP2 A;  3QVB A;  1G3L A;  2P73 A;  3Q7U A;  1H7L A;  2Y4K A;  4LW6 A;  1H7T A;  1YP4 A;  1XHB A;  3I0F A;  1OMZ A;  2AM4 A;  4EEO A;  4EVW A;  2Z86 A;  1G8O A;  2VXM A;  4NAK A;  1LZJ A;  2YQH A;  1HM0 A;  4ASY A;  3RMW A;  3U2X A;  3SXB A;  3POL A;  3I0D A;  1FOA A;  1W55 A;  4EEM A;  1FR9 A;  3O3P A;  4XWI A;  2XWM A;  3HL3 A;  2OI5 A;  4LW3 A;  2CU2 A;  2RJ5 A;  1JV3 A;  4FCE A;  1H5S D;  2VS4 A;  4HO2 A;  2PGY A;  4HO5 A;  2RIY A;  2YQC A;  4M2B A;  3E26 A;  1K4V A;  4HOC A;  1S4O A;  1Z90 A;  4HCQ A;  4Y7U A;  4K6R A;  3OAM A;  1VGU A;  3FWW A;  2RJ4 A;  2WAW A;  5IDT A;  1FRW A;  3D5N A;  5AJN A;  2GGQ A;  4AAW A;  1MP3 A;  2RJ8 A;  1OQM B;  4B3U A;  1HM8 A;  1NF5 B;  3CU0 A;  3PKQ A;  2XWN A;  4B4B A;  2ZU9 A;  5C4D A;  1W57 A;  4B4M A;  2W0V A;  4HO9 A;  1H5T A;  5C4B A;  1ZJ0 A;  1HJJ A;  4EEG A;  3IOH A;  2FFV A;  3SX3 A;  4FRH A;  2XMH A;  4FQW A;  2Q4J A;  5CMH A;  2RJ1 A;  5IDS A;  4AC3 A;  4G3S A;  1TZF A;  3OH4 A;  4KXO A;  1G95 A;  2JCL A;  3OC9 A;  4HG6 A;  2AM3 A;  3IOJ A;  3CKO A;  1H7H A;  2Z87 A;  3EE5 A;  4MND A;  4P02 A;  1INJ A;  1HM9 A;  1ZJ3 A;  3USQ A;  4GBP A;  2JCO A;  3I0I X;  5J49 A;  4Y63 A;  3SPT A;  3V0O A;  4CVH A;  1GX4 A;  2V0I A;  1QGQ A;  2OI6 A;  5HS2 A;  3I0H A;  4NAN A;  1ON6 A;  1GQC A;  1YRO B;  4DDZ A;  5CQO A;  5FV9 A;  3JUJ A;  4P00 A;  1W77 A;  3USR A;  1G9R A;  1R7T A;  4C2S A;  2X5Z A;  4M4K A;  5C3A A;  4IRP A;  1H7G A;  5DDT A;  4B4G A;  3BRK X;  2UX8 A;  5CQP A;  4ECM A;  5C1L A;  2PX7 A;  5EJ1 A;  1TVY A;  1WT2 A;  2BO6 A;  4CJB A;  3SXD A;  2AGD A;  4HO8 A;  1V82 A;  1FG5 N;  4FRL A;  1HJL A;  4Y62 A;  1ZI4 A;  4EEA A;  3Q80 A;  1GWW A;  4KC2 A;  1NKH B;  1JYK A;  4FCU A;  1ZCT A;  1ZHJ A;  2OEG A;  1NWG B;  3U2T A;  4FRA A;  1WT3 A;  1FXJ A;  4J18 A;  1H5T B;  3I0G A;  5FUH A;  2P72 A;  3CKQ A;  3F1Y A;  5C36 A;  4D11 C;  1G1L A;  4M28 A;  3CKV A;  3CKN A;  1ZI3 A;  4CJ8 A;  4HO4 A;  3FOQ A;  5CMG X;  2O1F A;  3BCV A;  3PKP A;  2RJ6 A;  4ZDQ A;  1VZT A;  1YP3 A;  5C4C A;  2ICX A;  2YQS A;  3DK5 A;  2OEF A;  1VM8 A;  3PNN A;  2APC A;  3I0J A;  1G2V A;  4ARW A;  3ZGF A;  3ZLL A;  3OH2 A;  1JV1 A;  5AJO A;  5L6S A;  3V8Z A;  2Y6P A;  4DE7 A;  4FRD A;  2DPW A;  2VSH A;  3SX8 A;  3KIA A;  2AES A;  3DJ4 A;  3DUV A;  3T7N A;  4D0Z A;  2YC3 A;  4Y6N A;  1XZ6 A;  5C1H A;  3I0K A;  3U0X A;  5CQN X;  1I52 A;  4Y7T A; 
#chains in the Genus database with same CATH topology
 2XWL A;  5C47 A;  2D0J A;  3N9W A;  4KNX A;  1R80 A;  2Y4L A;  1VZU A;  2YES A;  3OGZ A;  3OH3 A;  1LZ7 A;  1LZI A;  4BQH A;  1JYL A;  4D0T A;  3ZLK A;  2VS3 A;  1QWJ A;  4IRQ A;  5C3D A;  1GA8 A;  4KT7 A;  2E8B A;  2WVK A;  2GGO A;  2Y4M A;  1FXO A;  3V0L A;  4ASJ A;  2WVM A;  1G97 A;  4YS8 A;  1HV9 A;  2FYD B;  2A8U A;  1ZI5 A;  4L41 C;  2AE7 A;  1WVC A;  5DDV A;  3V0P A;  2VS5 A;  1JVD A;  1NHE B;  4KPZ A;  5CQL X;  3F1C A;  3V0Q A;  1H5S A;  3TZT A;  1PZY B;  2RJ9 A;  1H4E A;  1FR8 A;  1H7F A;  3RMV A;  1NQI B;  3V90 A;  4FRO A;  4UEG A;  3T7O A;  1GWV A;  5EIY A;  1ZDF A;  2W0W A;  1NMM B;  3OH0 A;  4KPX A;  1O7O A;  4Y9X A;  4HO6 A;  4KNR A;  2BO7 A;  2FYB A;  1ZIZ A;  2V0K A;  1R7V A;  2I5K A;  3V0M A;  3V0N A;  4B2X A;  1H7Q A;  2YC5 A;  1V84 A;  2PA4 A;  1VZX A;  5C4F A;  2MZB A;  2FFU A;  4G87 A;  1WT0 A;  2QH5 A;  2J0A A;  1H7E A;  1WT1 A;  2WVL A;  1O23 B;  3SXC A;  1R82 A;  2O1H A;  2E3D A;  1R7Y A;  5C49 A;  1IIM A;  5CMI A;  1H4C A;  3U0Y A;  3SXE A;  2BO4 A;  1LZ0 A;  1O0R A;  2VFZ A;  4CJC A;  1ZCY A;  5D91 A;  4FRE A;  2YCM A;  2V0L A;  1TW5 A;  2PGV A;  4D11 A;  1G93 A;  4JD0 A;  2ZU8 A;  5C3B A;  5AJP A;  3TQD A;  2O1G A;  5C4E A;  1SS9 A;  1FGG A;  2RIX A;  3I0L A;  1H5R A;  3R2W A;  3JUK A;  3SX5 A;  1MP5 A;  4D48 A;  2X5S A;  1ZCV A;  4FRQ A;  1VGW A;  4MYB A;  5FU0 A;  5FTV A;  1E5K A;  1INI A;  2ICY A;  3GUE A;  2FYC B;  4Y6U A;  2WEE A;  2RIZ A;  1S4P A;  1ZDG A;  3OKR A;  1MC3 A;  1H5S B;  2AEC A;  1ON8 A;  4KC1 A;  4NAI A;  2NXV A;  1QGS A;  1ZJ1 A;  4FRP A;  5L6V A;  1R7X A;  1ZJO A;  5I1F A;  1EZI A;  2JCK A;  3V8Y A;  4Y7V A;  3Q4S A;  3SX7 A;  2JCJ A;  3U2V A;  2OI7 A;  5C38 A;  1LL2 A;  3ZGG A;  5JQQ A;  2WE9 A;  2I5E A;  2QGI A;  2FYA A;  1TW1 A;  5C8R A;  4HO0 A;  5C1G A;  5C48 A;  3E25 A;  2VXL A;  3D98 A;  4B42 A;  1PZT A;  3ST8 A;  2Y4J A;  4EE4 A;  3K8E A;  1S4N A;  4Y7F A;  4AYL A;  5FYE A;  3CGX A;  4EE5 A;  2WGZ A;  3RSB A;  1GQ9 A;  4JIS A;  1IIN A;  4EE3 A;  5CMJ A;  5IFY A;  4FRM A;  4KQL A;  1VH1 A;  1ZCU A;  4G3Q A;  4Q7C A;  5CMF X;  2VSI A;  3U2U A;  4E1K A;  3JTJ A;  4B5B A;  1JVG A;  3ZF8 A;  1FWY A;  3SXG A;  1FGX A;  1VIC A;  2V0H A;  1GX0 A;  3R3I A;  4M2A A;  3I0C A;  3V91 A;  1G23 A;  2Y7A A;  4O6N A;  1FO8 A;  3CKJ A;  5FTS A;  3SXA A;  4G3P A;  2D7R A;  1LL3 A;  1VH3 A;  1ZJP A;  2V0J A;  1WSZ A;  2VK9 A;  2X60 A;  4FIX A;  5EJZ A;  5BXC A;  1ZJ2 A;  1FZW A;  1FO9 A;  4Y64 A;  1EYR A;  3D8V A;  1H5R B;  3I0E A;  2ZU7 A;  2YQJ A;  1H3M A;  2AH9 A;  3LW6 A;  1R81 A;  1H5S C;  2AM5 A;  1G0R A;  2X65 A;  4NAL A;  5CQM X;  1LVW A;  2P6W A;  2D7I A;  1H4D A;  1R7U A;  3NGW A;  2I7B A;  4Y7G A;  3K8D A;  3T7M A;  3IOI A;  4FRB A;  1VPA A;  1LL0 A;  1VGZ A;  2RJ0 A;  3U2W A;  4KC4 A;  2BO8 A;  4B2W A;  2RIT A;  4HO3 A;  1QG8 A;  1O7Q A;  2FY7 A;  1KWS A;  2VD4 A;  1ZI1 A;  2QKX A;  4R7P A;  4AYJ A;  4DEC A;  5FU8 A;  1OMX A;  3OH1 A;  2XME A;  4KRV A;  2A8W A;  1VGT A;  1V83 A;  1MP4 A;  4BMA A;  2RJ7 A;  1YP2 A;  3QVB A;  1G3L A;  2P73 A;  3Q7U A;  1H7L A;  2Y4K A;  4LW6 A;  1H7T A;  1YP4 A;  1XHB A;  3I0F A;  1OMZ A;  2AM4 A;  4EEO A;  4EVW A;  2Z86 A;  1G8O A;  2VXM A;  4NAK A;  1LZJ A;  2YQH A;  1HM0 A;  5D92 A;  3RMW A;  3U2X A;  3SXB A;  4ASY A;  3POL A;  3I0D A;  1FOA A;  1W55 A;  4EEM A;  1FR9 A;  3O3P A;  4XWI A;  2XWM A;  3HL3 A;  2OI5 A;  4LW3 A;  2CU2 A;  2RJ5 A;  1JV3 A;  4FCE A;  1H5S D;  2VS4 A;  4HO2 A;  2PGY A;  4HO5 A;  2RIY A;  2YQC A;  4M2B A;  3E26 A;  1K4V A;  4HOC A;  1S4O A;  1Z90 A;  4HCQ A;  4Y7U A;  4K6R A;  3OAM A;  1VGU A;  3FWW A;  2RJ4 A;  2WAW A;  5IDT A;  1FRW A;  3D5N A;  5AJN A;  2GGQ A;  4AAW A;  1MP3 A;  2RJ8 A;  1OQM B;  4B3U A;  1HM8 A;  1NF5 B;  3CU0 A;  3PKQ A;  4MIX A;  2XWN A;  4B4B A;  2ZU9 A;  5C4D A;  1W57 A;  4B4M A;  2W0V A;  4HO9 A;  1H5T A;  5C4B A;  2C0N A;  1ZJ0 A;  1HJJ A;  4EEG A;  3IOH A;  2FFV A;  3SX3 A;  4FRH A;  2XMH A;  4FQW A;  2Q4J A;  5CMH A;  2RJ1 A;  5IDS A;  4AC3 A;  4G3S A;  1TZF A;  3OH4 A;  4KXO A;  1G95 A;  2JCL A;  3OC9 A;  4HG6 A;  2AM3 A;  3IOJ A;  3CKO A;  1H7H A;  2Z87 A;  3EE5 A;  4MND A;  4P02 A;  1INJ A;  1HM9 A;  1ZJ3 A;  3USQ A;  4GBP A;  2JCO A;  3I0I X;  5J49 A;  4Y63 A;  3SPT A;  3V0O A;  4CVH A;  1GX4 A;  2V0I A;  1QGQ A;  2OI6 A;  5HS2 A;  3I0H A;  4NAN A;  1ON6 A;  1GQC A;  1YRO B;  2J0B A;  4DDZ A;  5CQO A;  5FV9 A;  3JUJ A;  4P00 A;  1W77 A;  3USR A;  1G9R A;  1R7T A;  4C2S A;  2X5Z A;  4M4K A;  5C3A A;  4IRP A;  1H7G A;  5DDT A;  4B4G A;  3BRK X;  2UX8 A;  5CQP A;  4ECM A;  5C1L A;  2PX7 A;  5EJ1 A;  1TVY A;  1WT2 A;  2BO6 A;  4CJB A;  3SXD A;  2AGD A;  4HO8 A;  1V82 A;  1FG5 N;  4FRL A;  1HJL A;  4Y62 A;  1ZI4 A;  4EEA A;  3Q80 A;  1GWW A;  4KC2 A;  1NKH B;  1JYK A;  4FCU A;  1ZCT A;  1ZHJ A;  2OEG A;  1NWG B;  3U2T A;  4FRA A;  1WT3 A;  1FXJ A;  4J18 A;  1H5T B;  3I0G A;  5FUH A;  2P72 A;  3CKQ A;  3F1Y A;  5C36 A;  4D11 C;  1G1L A;  4M28 A;  3CKV A;  3CKN A;  1ZI3 A;  4CJ8 A;  4HO4 A;  3FOQ A;  5CMG X;  2O1F A;  4O6M A;  3BCV A;  3PKP A;  2RJ6 A;  4ZDQ A;  4FIY A;  1VZT A;  1YP3 A;  5C4C A;  2ICX A;  2YQS A;  3DK5 A;  2OEF A;  1VM8 A;  3PNN A;  2APC A;  3I0J A;  1G2V A;  4ARW A;  3ZGF A;  3ZLL A;  3OH2 A;  1JV1 A;  5AJO A;  5L6S A;  3V8Z A;  2Y6P A;  4DE7 A;  4FRD A;  2DPW A;  2VSH A;  3SX8 A;  3KIA A;  2AES A;  3DJ4 A;  3DUV A;  3T7N A;  4D0Z A;  2YC3 A;  4Y6N A;  1XZ6 A;  5C1H A;  3I0K A;  3U0X A;  5CQN X;  1I52 A;  4Y7T A; 
#chains in the Genus database with same CATH homology
 2XWL A;  5C47 A;  2D0J A;  3N9W A;  4KNX A;  1R80 A;  2Y4L A;  1VZU A;  2YES A;  3OGZ A;  3OH3 A;  1LZ7 A;  1LZI A;  4BQH A;  1JYL A;  4D0T A;  3ZLK A;  2VS3 A;  1QWJ A;  4IRQ A;  5C3D A;  1GA8 A;  4KT7 A;  2E8B A;  2WVK A;  2GGO A;  2Y4M A;  1FXO A;  3V0L A;  4ASJ A;  2WVM A;  1G97 A;  4YS8 A;  1HV9 A;  2FYD B;  2A8U A;  1ZI5 A;  4L41 C;  2AE7 A;  1WVC A;  5DDV A;  3V0P A;  2VS5 A;  1JVD A;  1NHE B;  4KPZ A;  5CQL X;  3F1C A;  3V0Q A;  1H5S A;  3TZT A;  1PZY B;  2RJ9 A;  1H4E A;  1FR8 A;  1H7F A;  3RMV A;  1NQI B;  3V90 A;  4FRO A;  4UEG A;  3T7O A;  1GWV A;  5EIY A;  1ZDF A;  2W0W A;  1NMM B;  3OH0 A;  4KPX A;  1O7O A;  4Y9X A;  4HO6 A;  4KNR A;  2BO7 A;  2FYB A;  1ZIZ A;  2V0K A;  1R7V A;  2I5K A;  3V0M A;  3V0N A;  4B2X A;  1H7Q A;  2YC5 A;  1V84 A;  2PA4 A;  1VZX A;  5C4F A;  2MZB A;  2FFU A;  4G87 A;  1WT0 A;  2QH5 A;  2J0A A;  1H7E A;  1WT1 A;  2WVL A;  1O23 B;  3SXC A;  1R82 A;  2O1H A;  2E3D A;  1R7Y A;  5C49 A;  1IIM A;  5CMI A;  1H4C A;  3U0Y A;  3SXE A;  2BO4 A;  1LZ0 A;  1O0R A;  2VFZ A;  4CJC A;  1ZCY A;  5D91 A;  4FRE A;  2YCM A;  2V0L A;  1TW5 A;  2PGV A;  4D11 A;  1G93 A;  4JD0 A;  2ZU8 A;  5C3B A;  5AJP A;  3TQD A;  2O1G A;  5C4E A;  1SS9 A;  1FGG A;  2RIX A;  3I0L A;  1H5R A;  3R2W A;  3JUK A;  3SX5 A;  1MP5 A;  4D48 A;  2X5S A;  1ZCV A;  4FRQ A;  1VGW A;  4MYB A;  5FU0 A;  5FTV A;  1E5K A;  1INI A;  2ICY A;  3GUE A;  2FYC B;  4Y6U A;  2WEE A;  2RIZ A;  1S4P A;  1ZDG A;  3OKR A;  1MC3 A;  1H5S B;  2AEC A;  1ON8 A;  4KC1 A;  4NAI A;  2NXV A;  1QGS A;  1ZJ1 A;  4FRP A;  5L6V A;  1R7X A;  1ZJO A;  5I1F A;  1EZI A;  2JCK A;  3V8Y A;  4Y7V A;  3Q4S A;  3SX7 A;  2JCJ A;  3U2V A;  2OI7 A;  5C38 A;  1LL2 A;  3ZGG A;  5JQQ A;  2WE9 A;  2I5E A;  2QGI A;  2FYA A;  1TW1 A;  5C8R A;  4HO0 A;  5C1G A;  5C48 A;  3E25 A;  2VXL A;  3D98 A;  4B42 A;  1PZT A;  3ST8 A;  2Y4J A;  4EE4 A;  3K8E A;  1S4N A;  4Y7F A;  4AYL A;  5FYE A;  3CGX A;  4EE5 A;  2WGZ A;  3RSB A;  1GQ9 A;  4JIS A;  1IIN A;  4EE3 A;  5CMJ A;  5IFY A;  4FRM A;  4KQL A;  1VH1 A;  1ZCU A;  4G3Q A;  4Q7C A;  5CMF X;  2VSI A;  3U2U A;  4E1K A;  3JTJ A;  4B5B A;  1JVG A;  3ZF8 A;  1FWY A;  3SXG A;  1FGX A;  1VIC A;  2V0H A;  1GX0 A;  3R3I A;  4M2A A;  3I0C A;  3V91 A;  1G23 A;  2Y7A A;  4O6N A;  1FO8 A;  3CKJ A;  5FTS A;  3SXA A;  4G3P A;  2D7R A;  1LL3 A;  1VH3 A;  1ZJP A;  2V0J A;  1WSZ A;  2VK9 A;  2X60 A;  4FIX A;  5EJZ A;  5BXC A;  1ZJ2 A;  1FZW A;  1FO9 A;  4Y64 A;  1EYR A;  3D8V A;  1H5R B;  3I0E A;  2ZU7 A;  2YQJ A;  1H3M A;  2AH9 A;  3LW6 A;  1R81 A;  1H5S C;  2AM5 A;  1G0R A;  2X65 A;  4NAL A;  5CQM X;  1LVW A;  2P6W A;  2D7I A;  1H4D A;  1R7U A;  3NGW A;  2I7B A;  4Y7G A;  3K8D A;  3T7M A;  3IOI A;  4FRB A;  1VPA A;  1LL0 A;  1VGZ A;  2RJ0 A;  3U2W A;  4KC4 A;  2BO8 A;  4B2W A;  2RIT A;  4HO3 A;  1QG8 A;  1O7Q A;  2FY7 A;  1KWS A;  2VD4 A;  1ZI1 A;  2QKX A;  4R7P A;  4AYJ A;  4DEC A;  5FU8 A;  1OMX A;  3OH1 A;  2XME A;  4KRV A;  2A8W A;  1VGT A;  1V83 A;  1MP4 A;  4BMA A;  2RJ7 A;  1YP2 A;  3QVB A;  1G3L A;  2P73 A;  3Q7U A;  1H7L A;  2Y4K A;  4LW6 A;  1H7T A;  1YP4 A;  1XHB A;  3I0F A;  1OMZ A;  2AM4 A;  4EEO A;  4EVW A;  2Z86 A;  1G8O A;  2VXM A;  4NAK A;  1LZJ A;  2YQH A;  1HM0 A;  5D92 A;  3RMW A;  3U2X A;  3SXB A;  4ASY A;  3POL A;  3I0D A;  1FOA A;  1W55 A;  4EEM A;  1FR9 A;  3O3P A;  4XWI A;  2XWM A;  3HL3 A;  2OI5 A;  4LW3 A;  2CU2 A;  2RJ5 A;  1JV3 A;  4FCE A;  1H5S D;  2VS4 A;  4HO2 A;  2PGY A;  4HO5 A;  2RIY A;  2YQC A;  4M2B A;  3E26 A;  1K4V A;  4HOC A;  1S4O A;  1Z90 A;  4HCQ A;  4Y7U A;  4K6R A;  3OAM A;  1VGU A;  3FWW A;  2RJ4 A;  2WAW A;  5IDT A;  1FRW A;  3D5N A;  5AJN A;  2GGQ A;  4AAW A;  1MP3 A;  2RJ8 A;  1OQM B;  4B3U A;  1HM8 A;  1NF5 B;  3CU0 A;  3PKQ A;  4MIX A;  2XWN A;  4B4B A;  2ZU9 A;  5C4D A;  1W57 A;  4B4M A;  2W0V A;  4HO9 A;  1H5T A;  5C4B A;  2C0N A;  1ZJ0 A;  1HJJ A;  4EEG A;  3IOH A;  2FFV A;  3SX3 A;  4FRH A;  2XMH A;  4FQW A;  2Q4J A;  5CMH A;  2RJ1 A;  5IDS A;  4AC3 A;  4G3S A;  1TZF A;  3OH4 A;  4KXO A;  1G95 A;  2JCL A;  3OC9 A;  4HG6 A;  2AM3 A;  3IOJ A;  3CKO A;  1H7H A;  2Z87 A;  3EE5 A;  4MND A;  4P02 A;  1INJ A;  1HM9 A;  1ZJ3 A;  3USQ A;  4GBP A;  2JCO A;  3I0I X;  5J49 A;  4Y63 A;  3SPT A;  3V0O A;  4CVH A;  1GX4 A;  2V0I A;  1QGQ A;  2OI6 A;  5HS2 A;  3I0H A;  4NAN A;  1ON6 A;  1GQC A;  1YRO B;  2J0B A;  4DDZ A;  5CQO A;  5FV9 A;  3JUJ A;  4P00 A;  1W77 A;  3USR A;  1G9R A;  1R7T A;  4C2S A;  2X5Z A;  4M4K A;  5C3A A;  4IRP A;  1H7G A;  5DDT A;  4B4G A;  3BRK X;  2UX8 A;  5CQP A;  4ECM A;  5C1L A;  2PX7 A;  5EJ1 A;  1TVY A;  1WT2 A;  2BO6 A;  4CJB A;  3SXD A;  2AGD A;  4HO8 A;  1V82 A;  1FG5 N;  4FRL A;  1HJL A;  4Y62 A;  1ZI4 A;  4EEA A;  3Q80 A;  1GWW A;  4KC2 A;  1NKH B;  1JYK A;  4FCU A;  1ZCT A;  1ZHJ A;  2OEG A;  1NWG B;  3U2T A;  4FRA A;  1WT3 A;  1FXJ A;  4J18 A;  1H5T B;  3I0G A;  5FUH A;  2P72 A;  3CKQ A;  3F1Y A;  5C36 A;  4D11 C;  1G1L A;  4M28 A;  3CKV A;  3CKN A;  1ZI3 A;  4CJ8 A;  4HO4 A;  3FOQ A;  5CMG X;  2O1F A;  4O6M A;  3BCV A;  3PKP A;  2RJ6 A;  4ZDQ A;  4FIY A;  1VZT A;  1YP3 A;  5C4C A;  2ICX A;  2YQS A;  3DK5 A;  2OEF A;  1VM8 A;  3PNN A;  2APC A;  3I0J A;  1G2V A;  4ARW A;  3ZGF A;  3ZLL A;  3OH2 A;  1JV1 A;  5AJO A;  5L6S A;  3V8Z A;  2Y6P A;  4DE7 A;  4FRD A;  2DPW A;  2VSH A;  3SX8 A;  3KIA A;  2AES A;  3DJ4 A;  3DUV A;  3T7N A;  4D0Z A;  2YC3 A;  4Y6N A;  1XZ6 A;  5C1H A;  3I0K A;  3U0X A;  5CQN X;  1I52 A;  4Y7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...