1MP5A

Y177f variant of s. enterica rmla
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQAGTAVSLEEKPLQPKSNYAVTGLFFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Y177F VARIANT OF S. ENTERICA RmlA BOUND TO UDP-GLUCOSE
publication title Expanding pyrimidine diphosphosugar libraries via structure-based nucleotidylyltransferase engineering
pubmed doi rcsb
source organism Salmonella enterica
total genus 95
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2002-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1mp5A00
5AJOA 4FQWA 4D11C 4FCEA 1JVGA 1JYKA 2OEGA 5IDSA 3I0CA 3CKJA 1WT0A 2JCOA 1WT3A 5AJNA 1VH1A 2D7IA 2YQCA 2FYDB 1MC3A 2RITA 4Y9XA 2Y4JA 3JUJA 3D98A 3U2WA 4NANA 4KT7A 2FY7A 2Y4LA 3EE5A 4MYBA 4B4GA 1INIA 3SX5A 1ZJPA 1KWSA 3IOIA 3BRKX 1LVWA 2FYAA 4E1KA 1H5SA 4P02A 4UEGA 3PKQA 2W0VA 2WVMA 3SPTA 3T7NA 1ZJOA 2V0LA 3SXCA 4Y7VA 1LZIA 1ON6A 1MP5A 3Q7UA 3OH3A 4EEGA 1H5TB 1O7QA 2RJ1A 5C1GA 1FOAA 1HM0A 1ZCVA 3DK5A 1OQMB 3OGZA 1IINA 1G1LA 3OH1A 1ZCTA 2VSHA 2AGDA 2PGVA 1O23B 1R82A 5CQPA 2O1FA 1G2VA 1INJA 2WGZA 1H5RA 1VGWA 2RIXA 2P72A 5EIYA 1I52A 3GUEA 4DECA 5EJZA 1G3LA 4HO6A 1GQ9A 3V0PA 1G23A 1QWJA 4G3SA 3USQA 1K4VA 3D5NA 2Z87A 1ZCUA 2E8BA 1H7TA 2ZU9A 5FU0A 5CMFX 1VGTA 2VXMA 3DJ4A 3QVBA 1FGGA 3R2WA 4Y6NA 5CMHA 1WSZA 1XHBA 3U0YA 2AM4A 1G0RA 2D7RA 4CJCA 1XZ6A 2Y4KA 3SX8A 3CKNA 1FR8A 3OH2A 5C3DA 1H4EA 3TZTA 1QGSA 2YC3A 4EEMA 1FO8A 2XWNA 1GWWA 1W57A 1LZ0A 2WEEA 5J49A 2QH5A 2Z86A 1HV9A 3E26A 1NQIB 2AH9A 4ARWA 4FCUA 2PGYA 1ZJ0A 3SX7A 5C1LA 5FTSA 2Y4MA 3CKQA 3N9WA 4ASYA 3SX3A 1LL3A 5BXCA 5I1FA 2OEFA 5C49A 2AM3A 1VH3A 4FRAA 4Y7GA 1H7HA 4Y7UA 1FRWA 3HL3A 4FRDA 1ZI4A 2ICYA 4G87A 2RJ9A 1E5KA 2JCLA 3CKVA 1H3MA 3SXBA 4P00A 4Y62A 3I0DA 4G3QA 4JISA 1V83A 1TZFA 1ZI3A 1G8OA 4J18A 1LL2A 1VGUA 3SXAA 3SXDA 2E3DA 4EE4A 3I0IX 1NHEB 1H7EA 1R7XA 1Z90A 2DPWA 4HO4A 4ECMA 3V91A 1R81A 5JQQA 1S4PA 2FYBA 3I0HA 1PZYB 2RJ8A 3ZLKA 1H5TA 3U2UA 4EE5A 1YP2A 2GGQA 4EE3A 2OI5A 2WE9A 1H7FA 4HO2A 2O1GA 4YS8A 4B4BA 1GX4A 1FXOA 1R7UA 1ZJ2A 3O3PA 4AYLA 5CQLX 1R7VA 2ICXA 4B42A 4NAIA 4AC3A 1QG8A 4HCQA 3ZF8A 4Y7FA 2RJ7A 4Y64A 1HJLA 2D0JA 4Y7TA 4FRMA 5L6SA 2BO6A 4Y63A 4B2XA 1OMXA 1PZTA 3E25A 1H5SC 4KQLA 4AAWA 4KC2A 1G93A 3V0QA 1NF5B 3JTJA 1LZJA 2ZU7A 1ZCYA 1TVYA 4NALA 1OMZA 4FRLA 4IRPA 2JCKA 3T7MA 2X5SA 2VD4A 1S4OA 5C36A 2VS3A 4KRVA 3NGWA 1V84A 3U2XA 2PX7A 1EZIA 5C1HA 4DDZA 5HS2A 2A8WA 4HO8A 3Q4SA 4M28A 5FU8A 1JV3A 3U0XA 5CQMX 5CMJA 1WT1A 3I0JA 1VGZA 1QGQA 4KC1A 2RIZA 3CU0A 5C3AA 1VM8A 1NMMB 1W77A 5IFYA 3FOQA 4FRPA 2VS4A 1NWGB 2X5ZA 2QGIA 3RSBA 3FWWA 3CGXA 3ZLLA 1VZTA 1S4NA 1H4CA 1HJJA 2VS5A 2VSIA 5C4EA 3Q80A 3IOHA 3CKOA 2APCA 4L41C 5C8RA 4M2AA 5IDTA 5L6VA 2I7BA 2RJ5A 5C4BA 2Y7AA 5CQNX 4B5BA 4LW6A 2JCJA 2X60A 3ZGGA 4DE7A 1IIMA 5C4DA 1JV1A 2AESA 2NXVA 1HM8A 1ZJ1A 1W55A 3ZGFA 1MP4A 3LW6A 4D0ZA 5FV9A 1YP4A 1JVDA 2YESA 4KNXA 5CMGX 3SXEA 5C4FA 4KNRA 1O7OA 4HG6A 4D0TA 4D11A 2Q4JA 4FRQA 4B4MA 1R7YA 1FWYA 5DDVA 2XWMA 4C2SA 1GA8A 4BMAA 2V0IA 1GQCA 1ZHJA 2WVLA 2MZBA 3ST8A 2YCMA 5FTVA 4FREA 2YQJA 1G97A 3OKRA 1WT2A 5C47A 2RJ0A 3I0EA 3SXGA 4FRHA 2UX8A 2GGOA 1G9RA 4FROA 2XMHA 4M4KA 2RIYA 2AM5A 1GX0A 5CMIA 4AYJA 4HOCA 1G95A 2BO4A 2WAWA 5EJ1A 3BCVA 2RJ6A 3OAMA 3RMVA 3I0KA 4R7PA 2FFVA 1EYRA 1H7GA 2ZU8A 4HO9A 1ON8A 4FRBA 5AJPA 2AE7A 2VXLA 3V0MA 1JYLA 3V8ZA 5DDTA 4EEOA 2BO7A 1LL0A 2I5KA 4HO5A 3T7OA 3IOJA 2V0HA 2QKXA 3I0LA 5C4CA 4NAKA 1H7QA 4B3UA 5C48A 2FYCB 2O1HA 4CVHA 1VICA 1O0RA 3PKPA 2RJ4A 2XWLA 1SS9A 3DUVA 1VPAA 1FO9A 3I0GA 3D8VA 3F1CA 1GWVA 4ZDQA 4IRQA 1R80A 3R3IA 4LW3A 1H5SB 3V8YA 2A8UA 4HO3A 3OH0A 1H5SD 4Y6UA 1VZXA 5FUHA 3V90A 1WVCA 2P73A 2YC5A 2FFUA 3K8EA 2PA4A 3RMWA 2YQHA 3F1YA 2VFZA 1R7TA 2BO8A 5FYEA 1NKHB 1YP3A 3V0OA 4EVWA 1LZ7A 4KPXA 3JUKA 3U2VA 1FZWA 3V0NA 4CJ8A 1ZJ3A 4BQHA 4M2BA 1FR9A 2W0WA 3TQDA 3OH4A 1H5RB 1ZI5A 2OI6A 4D48A 4JD0A 1ZIZA 4GBPA 3USRA 1ZDGA 2YQSA 1ZDFA 5CQOA 3U2TA 1VZUA 2AECA 4KC4A 1H7LA 4B2WA 2V0KA 2I5EA 1YROB 1FG5N 3PNNA 2V0JA 3OC9A 3POLA 3V0LA 5C3BA 4HO0A 2P6WA 5C38A 4G3PA 3K8DA 2X65A 3I0FA 1ZI1A 2WVKA 2XMEA 1TW5A 1TW1A 1H4DA 3KIAA 1FGXA 4ASJA 1HM9A 2Y6PA 1V82A 4KXOA 4CJBA 4XWIA 4EEAA 2CU2A 1FXJA 1MP3A 4MNDA 2OI7A 4K6RA 4KPZA
chains in the Genus database with same CATH superfamily
5AJOA 4FQWA 4D11C 4FCEA 1JVGA 1JYKA 2OEGA 5IDSA 3I0CA 3CKJA 1WT0A 2JCOA 1WT3A 5AJNA 1VH1A 2D7IA 2YQCA 2FYDB 1MC3A 2RITA 4Y9XA 2Y4JA 3JUJA 3D98A 3U2WA 4NANA 4KT7A 2FY7A 2Y4LA 3EE5A 4MYBA 4B4GA 1INIA 3SX5A 1ZJPA 1KWSA 3IOIA 3BRKX 1LVWA 2FYAA 4E1KA 1H5SA 4P02A 4UEGA 3PKQA 2W0VA 2WVMA 3SPTA 3T7NA 1ZJOA 2V0LA 3SXCA 4Y7VA 1LZIA 1ON6A 1MP5A 3Q7UA 3OH3A 4EEGA 1H5TB 1O7QA 2RJ1A 5C1GA 1FOAA 1HM0A 1ZCVA 3DK5A 1OQMB 3OGZA 1IINA 1G1LA 3OH1A 1ZCTA 2VSHA 2AGDA 2PGVA 1O23B 1R82A 5CQPA 2O1FA 1G2VA 1INJA 2WGZA 1H5RA 1VGWA 2RIXA 2P72A 5EIYA 1I52A 3GUEA 4DECA 5EJZA 1G3LA 4HO6A 1GQ9A 3V0PA 1G23A 1QWJA 4G3SA 5D92A 3USQA 1K4VA 3D5NA 2Z87A 1ZCUA 2E8BA 1H7TA 2ZU9A 5FU0A 5CMFX 1VGTA 2VXMA 4FIXA 3DJ4A 3QVBA 2J0AA 1FGGA 3R2WA 4Y6NA 5CMHA 1WSZA 1XHBA 3U0YA 2AM4A 1G0RA 2D7RA 4CJCA 1XZ6A 2Y4KA 3SX8A 3CKNA 1FR8A 3OH2A 5C3DA 1H4EA 3TZTA 1QGSA 2YC3A 4EEMA 1FO8A 2XWNA 1GWWA 1W57A 1LZ0A 2WEEA 5J49A 2QH5A 2Z86A 1HV9A 3E26A 1NQIB 2AH9A 4ARWA 4FCUA 2PGYA 1ZJ0A 3SX7A 5C1LA 5FTSA 2Y4MA 3CKQA 3N9WA 4ASYA 3SX3A 1LL3A 5BXCA 5I1FA 2OEFA 5C49A 2AM3A 1VH3A 4FRAA 4Y7GA 1H7HA 4Y7UA 1FRWA 3HL3A 4FRDA 1ZI4A 2ICYA 4G87A 2RJ9A 1E5KA 2JCLA 3CKVA 1H3MA 3SXBA 4P00A 4Y62A 3I0DA 4G3QA 4JISA 1V83A 1TZFA 1ZI3A 1G8OA 4J18A 1LL2A 1VGUA 3SXAA 3SXDA 2E3DA 4EE4A 3I0IX 1NHEB 1H7EA 1R7XA 1Z90A 2DPWA 2VK9A 4HO4A 4ECMA 3V91A 1R81A 5JQQA 1S4PA 2FYBA 3I0HA 1PZYB 2RJ8A 3ZLKA 1H5TA 3U2UA 4EE5A 1YP2A 2GGQA 4EE3A 2OI5A 2WE9A 1H7FA 4HO2A 2O1GA 4YS8A 4B4BA 1GX4A 1FXOA 1R7UA 1ZJ2A 3O3PA 4AYLA 5CQLX 1R7VA 5D91A 2ICXA 4B42A 4NAIA 4AC3A 1QG8A 4HCQA 3ZF8A 4Y7FA 2RJ7A 4Y64A 1HJLA 2D0JA 4Y7TA 4FRMA 5L6SA 2BO6A 4Y63A 4B2XA 1OMXA 1PZTA 3E25A 1H5SC 4KQLA 4AAWA 4KC2A 1G93A 3V0QA 1NF5B 3JTJA 1LZJA 2ZU7A 1ZCYA 1TVYA 4NALA 1OMZA 4FRLA 4IRPA 2JCKA 3T7MA 2X5SA 2VD4A 1S4OA 5C36A 2VS3A 4KRVA 3NGWA 1V84A 3U2XA 2PX7A 1EZIA 5C1HA 4DDZA 5HS2A 2A8WA 4HO8A 3Q4SA 4M28A 5FU8A 1JV3A 3U0XA 5CQMX 5CMJA 1WT1A 3I0JA 1VGZA 1QGQA 4KC1A 2RIZA 3CU0A 5C3AA 1VM8A 1NMMB 1W77A 5IFYA 3FOQA 4FRPA 2VS4A 1NWGB 2X5ZA 2J0BA 2QGIA 3RSBA 3FWWA 3CGXA 3ZLLA 1VZTA 1S4NA 1H4CA 1HJJA 2VS5A 2VSIA 5C4EA 3Q80A 3IOHA 3CKOA 2APCA 4L41C 5C8RA 4M2AA 5IDTA 5L6VA 2I7BA 2RJ5A 5C4BA 2Y7AA 5CQNX 4B5BA 4LW6A 2JCJA 2X60A 3ZGGA 4DE7A 1IIMA 5C4DA 1JV1A 2AESA 2NXVA 1HM8A 1ZJ1A 1W55A 3ZGFA 1MP4A 3LW6A 4D0ZA 5FV9A 1YP4A 1JVDA 2YESA 4KNXA 5CMGX 3SXEA 5C4FA 4KNRA 1O7OA 4HG6A 4D0TA 4D11A 2Q4JA 4FRQA 4B4MA 1R7YA 1FWYA 5DDVA 2XWMA 4C2SA 1GA8A 4BMAA 2V0IA 1GQCA 1ZHJA 2WVLA 2MZBA 3ST8A 2YCMA 5FTVA 4FREA 4Q7CA 2YQJA 1G97A 3OKRA 1WT2A 5C47A 2RJ0A 3I0EA 3SXGA 4FRHA 2UX8A 2GGOA 1G9RA 4FROA 2XMHA 4M4KA 2RIYA 2AM5A 1GX0A 5CMIA 4AYJA 4HOCA 1G95A 2BO4A 2WAWA 5EJ1A 3BCVA 2RJ6A 3OAMA 3RMVA 3I0KA 4R7PA 2FFVA 1EYRA 1H7GA 2ZU8A 4HO9A 1ON8A 4FRBA 5AJPA 2AE7A 2VXLA 3V0MA 1JYLA 3V8ZA 5DDTA 4EEOA 2BO7A 1LL0A 2I5KA 4HO5A 3T7OA 3IOJA 2V0HA 2QKXA 3I0LA 5C4CA 4NAKA 1H7QA 4B3UA 5C48A 2FYCB 2O1HA 4CVHA 1VICA 1O0RA 3PKPA 2RJ4A 2XWLA 1SS9A 3DUVA 4MIXA 1VPAA 1FO9A 3I0GA 3D8VA 3F1CA 1GWVA 4ZDQA 4IRQA 1R80A 3R3IA 4LW3A 1H5SB 3V8YA 2A8UA 4HO3A 3OH0A 1H5SD 4Y6UA 1VZXA 5FUHA 3V90A 1WVCA 2P73A 2YC5A 2FFUA 3K8EA 2PA4A 3RMWA 2YQHA 3F1YA 2VFZA 1R7TA 2BO8A 5FYEA 1NKHB 1YP3A 3V0OA 4EVWA 1LZ7A 4KPXA 3JUKA 3U2VA 1FZWA 3V0NA 4CJ8A 1ZJ3A 4BQHA 4M2BA 1FR9A 2W0WA 3TQDA 3OH4A 1H5RB 1ZI5A 2OI6A 4D48A 4JD0A 1ZIZA 4GBPA 2C0NA 3USRA 1ZDGA 2YQSA 1ZDFA 5CQOA 3U2TA 1VZUA 2AECA 4KC4A 1H7LA 4B2WA 4O6MA 2V0KA 2I5EA 1YROB 1FG5N 3PNNA 2V0JA 3OC9A 3POLA 3V0LA 5C3BA 4HO0A 2P6WA 5C38A 4G3PA 3K8DA 2X65A 3I0FA 1ZI1A 2WVKA 2XMEA 1TW5A 1TW1A 1H4DA 3KIAA 1FGXA 4ASJA 1HM9A 2Y6PA 1V82A 4KXOA 4CJBA 4XWIA 4EEAA 4O6NA 2CU2A 1FXJA 4FIYA 1MP3A 4MNDA 2OI7A 4K6RA 4KPZA
chains in the Genus database with same CATH topology
5AJOA 4FQWA 4D11C 4FCEA 1JVGA 1JYKA 2OEGA 5IDSA 3I0CA 3CKJA 1WT0A 2JCOA 1WT3A 5AJNA 1VH1A 2D7IA 2YQCA 2FYDB 1MC3A 2RITA 4Y9XA 2Y4JA 3JUJA 3D98A 3U2WA 4NANA 4KT7A 2FY7A 2Y4LA 3EE5A 4MYBA 4B4GA 1INIA 3SX5A 1ZJPA 1KWSA 3IOIA 3BRKX 1LVWA 2FYAA 4E1KA 1H5SA 4P02A 4UEGA 3PKQA 2W0VA 2WVMA 3SPTA 3T7NA 1ZJOA 2V0LA 3SXCA 4Y7VA 1LZIA 1ON6A 1MP5A 3Q7UA 3OH3A 4EEGA 1H5TB 1O7QA 2RJ1A 5C1GA 1FOAA 1HM0A 1ZCVA 3DK5A 1OQMB 3OGZA 1IINA 1G1LA 3OH1A 1ZCTA 2VSHA 2AGDA 2PGVA 1O23B 1R82A 5CQPA 2O1FA 1G2VA 1INJA 2WGZA 1H5RA 1VGWA 2RIXA 2P72A 5EIYA 1I52A 3GUEA 4DECA 5EJZA 1G3LA 4HO6A 1GQ9A 3V0PA 1G23A 1QWJA 4G3SA 5D92A 3USQA 1K4VA 3D5NA 2Z87A 1ZCUA 2E8BA 1H7TA 2ZU9A 5FU0A 5CMFX 1VGTA 2VXMA 4FIXA 3DJ4A 3QVBA 2J0AA 1FGGA 3R2WA 4Y6NA 5CMHA 1WSZA 1XHBA 3U0YA 2AM4A 1G0RA 2D7RA 4CJCA 1XZ6A 2Y4KA 3SX8A 3CKNA 1FR8A 3OH2A 5C3DA 1H4EA 3TZTA 1QGSA 2YC3A 4EEMA 1FO8A 2XWNA 1GWWA 1W57A 1LZ0A 2WEEA 5J49A 2QH5A 2Z86A 1HV9A 3E26A 1NQIB 2AH9A 4ARWA 4FCUA 2PGYA 1ZJ0A 3SX7A 5C1LA 5FTSA 2Y4MA 3CKQA 3N9WA 4ASYA 3SX3A 1LL3A 5BXCA 5I1FA 2OEFA 5C49A 2AM3A 1VH3A 4FRAA 4Y7GA 1H7HA 4Y7UA 1FRWA 3HL3A 4FRDA 1ZI4A 2ICYA 4G87A 2RJ9A 1E5KA 2JCLA 3CKVA 1H3MA 3SXBA 4P00A 4Y62A 3I0DA 4G3QA 4JISA 1V83A 1TZFA 1ZI3A 1G8OA 4J18A 1LL2A 1VGUA 3SXAA 3SXDA 2E3DA 4EE4A 3I0IX 1NHEB 1H7EA 1R7XA 1Z90A 2DPWA 2VK9A 4HO4A 4ECMA 3V91A 1R81A 5JQQA 1S4PA 2FYBA 3I0HA 1PZYB 2RJ8A 3ZLKA 1H5TA 3U2UA 4EE5A 1YP2A 2GGQA 4EE3A 2OI5A 2WE9A 1H7FA 4HO2A 2O1GA 4YS8A 4B4BA 1GX4A 1FXOA 1R7UA 1ZJ2A 3O3PA 4AYLA 5CQLX 1R7VA 5D91A 2ICXA 4B42A 4NAIA 4AC3A 1QG8A 4HCQA 3ZF8A 4Y7FA 2RJ7A 4Y64A 1HJLA 2D0JA 4Y7TA 4FRMA 5L6SA 2BO6A 4Y63A 4B2XA 1OMXA 1PZTA 3E25A 1H5SC 4KQLA 4AAWA 4KC2A 1G93A 3V0QA 1NF5B 3JTJA 1LZJA 2ZU7A 1ZCYA 1TVYA 4NALA 1OMZA 4FRLA 4IRPA 2JCKA 3T7MA 2X5SA 2VD4A 1S4OA 5C36A 2VS3A 4KRVA 3NGWA 1V84A 3U2XA 2PX7A 1EZIA 5C1HA 4DDZA 5HS2A 2A8WA 4HO8A 3Q4SA 4M28A 5FU8A 1JV3A 3U0XA 5CQMX 5CMJA 1WT1A 3I0JA 1VGZA 1QGQA 4KC1A 2RIZA 3CU0A 5C3AA 1VM8A 1NMMB 1W77A 5IFYA 3FOQA 4FRPA 2VS4A 1NWGB 2X5ZA 2J0BA 2QGIA 3RSBA 3FWWA 3CGXA 3ZLLA 1VZTA 1S4NA 1H4CA 1HJJA 2VS5A 2VSIA 5C4EA 3Q80A 3IOHA 3CKOA 2APCA 4L41C 5C8RA 4M2AA 5IDTA 5L6VA 2I7BA 2RJ5A 5C4BA 2Y7AA 5CQNX 4B5BA 4LW6A 2JCJA 2X60A 3ZGGA 4DE7A 1IIMA 5C4DA 1JV1A 2AESA 2NXVA 1HM8A 1ZJ1A 1W55A 3ZGFA 1MP4A 3LW6A 4D0ZA 5FV9A 1YP4A 1JVDA 2YESA 4KNXA 5CMGX 3SXEA 5C4FA 4KNRA 1O7OA 4HG6A 4D0TA 4D11A 2Q4JA 4FRQA 4B4MA 1R7YA 1FWYA 5DDVA 2XWMA 4C2SA 1GA8A 4BMAA 2V0IA 1GQCA 1ZHJA 2WVLA 2MZBA 3ST8A 2YCMA 5FTVA 4FREA 4Q7CA 2YQJA 1G97A 3OKRA 1WT2A 5C47A 2RJ0A 3I0EA 3SXGA 4FRHA 2UX8A 2GGOA 1G9RA 4FROA 2XMHA 4M4KA 2RIYA 2AM5A 1GX0A 5CMIA 4AYJA 4HOCA 1G95A 2BO4A 2WAWA 5EJ1A 3BCVA 2RJ6A 3OAMA 3RMVA 3I0KA 4R7PA 2FFVA 1EYRA 1H7GA 2ZU8A 4HO9A 1ON8A 4FRBA 5AJPA 2AE7A 2VXLA 3V0MA 1JYLA 3V8ZA 5DDTA 4EEOA 2BO7A 1LL0A 2I5KA 4HO5A 3T7OA 3IOJA 2V0HA 2QKXA 3I0LA 5C4CA 4NAKA 1H7QA 4B3UA 5C48A 2FYCB 2O1HA 4CVHA 1VICA 1O0RA 3PKPA 2RJ4A 2XWLA 1SS9A 3DUVA 4MIXA 1VPAA 1FO9A 3I0GA 3D8VA 3F1CA 1GWVA 4ZDQA 4IRQA 1R80A 3R3IA 4LW3A 1H5SB 3V8YA 2A8UA 4HO3A 3OH0A 1H5SD 4Y6UA 1VZXA 5FUHA 3V90A 1WVCA 2P73A 2YC5A 2FFUA 3K8EA 2PA4A 3RMWA 2YQHA 3F1YA 2VFZA 1R7TA 2BO8A 5FYEA 1NKHB 1YP3A 3V0OA 4EVWA 1LZ7A 4KPXA 3JUKA 3U2VA 1FZWA 3V0NA 4CJ8A 1ZJ3A 4BQHA 4M2BA 1FR9A 2W0WA 3TQDA 3OH4A 1H5RB 1ZI5A 2OI6A 4D48A 4JD0A 1ZIZA 4GBPA 2C0NA 3USRA 1ZDGA 2YQSA 1ZDFA 5CQOA 3U2TA 1VZUA 2AECA 4KC4A 1H7LA 4B2WA 4O6MA 2V0KA 2I5EA 1YROB 1FG5N 3PNNA 2V0JA 3OC9A 3POLA 3V0LA 5C3BA 4HO0A 2P6WA 5C38A 4G3PA 3K8DA 2X65A 3I0FA 1ZI1A 2WVKA 2XMEA 1TW5A 1TW1A 1H4DA 3KIAA 1FGXA 4ASJA 1HM9A 2Y6PA 1V82A 4KXOA 4CJBA 4XWIA 4EEAA 4O6NA 2CU2A 1FXJA 4FIYA 1MP3A 4MNDA 2OI7A 4K6RA 4KPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJO A;  4FQW A;  4D11 C;  4FCE A;  1JVG A;  1JYK A;  2OEG A;  5IDS A;  3I0C A;  3CKJ A;  1WT0 A;  2JCO A;  1WT3 A;  5AJN A;  1VH1 A;  2D7I A;  2YQC A;  2FYD B;  1MC3 A;  2RIT A;  4Y9X A;  2Y4J A;  3JUJ A;  3D98 A;  3U2W A;  4NAN A;  4KT7 A;  2FY7 A;  2Y4L A;  3EE5 A;  4MYB A;  4B4G A;  1INI A;  3SX5 A;  1ZJP A;  1KWS A;  3IOI A;  3BRK X;  1LVW A;  2FYA A;  4E1K A;  1H5S A;  4P02 A;  4UEG A;  3PKQ A;  2W0V A;  2WVM A;  3SPT A;  3T7N A;  1ZJO A;  2V0L A;  3SXC A;  4Y7V A;  1LZI A;  1ON6 A;  1MP5 A;  3Q7U A;  3OH3 A;  4EEG A;  1H5T B;  1O7Q A;  2RJ1 A;  5C1G A;  1FOA A;  1HM0 A;  1ZCV A;  3DK5 A;  1OQM B;  3OGZ A;  1IIN A;  1G1L A;  3OH1 A;  1ZCT A;  2VSH A;  2AGD A;  2PGV A;  1O23 B;  1R82 A;  5CQP A;  2O1F A;  1G2V A;  1INJ A;  2WGZ A;  1H5R A;  1VGW A;  2RIX A;  2P72 A;  5EIY A;  1I52 A;  3GUE A;  4DEC A;  5EJZ A;  1G3L A;  4HO6 A;  1GQ9 A;  3V0P A;  1G23 A;  1QWJ A;  4G3S A;  3USQ A;  1K4V A;  3D5N A;  2Z87 A;  1ZCU A;  2E8B A;  1H7T A;  2ZU9 A;  5FU0 A;  5CMF X;  1VGT A;  2VXM A;  3DJ4 A;  3QVB A;  1FGG A;  3R2W A;  4Y6N A;  5CMH A;  1WSZ A;  1XHB A;  3U0Y A;  2AM4 A;  1G0R A;  2D7R A;  4CJC A;  1XZ6 A;  2Y4K A;  3SX8 A;  3CKN A;  1FR8 A;  3OH2 A;  5C3D A;  1H4E A;  3TZT A;  1QGS A;  2YC3 A;  4EEM A;  1FO8 A;  2XWN A;  1GWW A;  1W57 A;  1LZ0 A;  2WEE A;  5J49 A;  2QH5 A;  2Z86 A;  1HV9 A;  3E26 A;  1NQI B;  2AH9 A;  4ARW A;  4FCU A;  2PGY A;  1ZJ0 A;  3SX7 A;  5C1L A;  5FTS A;  2Y4M A;  3CKQ A;  3N9W A;  4ASY A;  3SX3 A;  1LL3 A;  5BXC A;  5I1F A;  2OEF A;  5C49 A;  2AM3 A;  1VH3 A;  4FRA A;  4Y7G A;  1H7H A;  4Y7U A;  1FRW A;  3HL3 A;  4FRD A;  1ZI4 A;  2ICY A;  4G87 A;  2RJ9 A;  1E5K A;  2JCL A;  3CKV A;  1H3M A;  3SXB A;  4P00 A;  4Y62 A;  3I0D A;  4G3Q A;  4JIS A;  1V83 A;  1TZF A;  1ZI3 A;  1G8O A;  4J18 A;  1LL2 A;  1VGU A;  3SXA A;  3SXD A;  2E3D A;  4EE4 A;  3I0I X;  1NHE B;  1H7E A;  1R7X A;  1Z90 A;  2DPW A;  4HO4 A;  4ECM A;  3V91 A;  1R81 A;  5JQQ A;  1S4P A;  2FYB A;  3I0H A;  1PZY B;  2RJ8 A;  3ZLK A;  1H5T A;  3U2U A;  4EE5 A;  1YP2 A;  2GGQ A;  4EE3 A;  2OI5 A;  2WE9 A;  1H7F A;  4HO2 A;  2O1G A;  4YS8 A;  4B4B A;  1GX4 A;  1FXO A;  1R7U A;  1ZJ2 A;  3O3P A;  4AYL A;  5CQL X;  1R7V A;  2ICX A;  4B42 A;  4NAI A;  4AC3 A;  1QG8 A;  4HCQ A;  3ZF8 A;  4Y7F A;  2RJ7 A;  4Y64 A;  1HJL A;  2D0J A;  4Y7T A;  4FRM A;  5L6S A;  2BO6 A;  4Y63 A;  4B2X A;  1OMX A;  1PZT A;  3E25 A;  1H5S C;  4KQL A;  4AAW A;  4KC2 A;  1G93 A;  3V0Q A;  1NF5 B;  3JTJ A;  1LZJ A;  2ZU7 A;  1ZCY A;  1TVY A;  4NAL A;  1OMZ A;  4FRL A;  4IRP A;  2JCK A;  3T7M A;  2X5S A;  2VD4 A;  1S4O A;  5C36 A;  2VS3 A;  4KRV A;  3NGW A;  1V84 A;  3U2X A;  2PX7 A;  1EZI A;  5C1H A;  4DDZ A;  5HS2 A;  2A8W A;  4HO8 A;  3Q4S A;  4M28 A;  5FU8 A;  1JV3 A;  3U0X A;  5CQM X;  5CMJ A;  1WT1 A;  3I0J A;  1VGZ A;  1QGQ A;  4KC1 A;  2RIZ A;  3CU0 A;  5C3A A;  1VM8 A;  1NMM B;  1W77 A;  5IFY A;  3FOQ A;  4FRP A;  2VS4 A;  1NWG B;  2X5Z A;  2QGI A;  3RSB A;  3FWW A;  3CGX A;  3ZLL A;  1VZT A;  1S4N A;  1H4C A;  1HJJ A;  2VS5 A;  2VSI A;  5C4E A;  3Q80 A;  3IOH A;  3CKO A;  2APC A;  4L41 C;  5C8R A;  4M2A A;  5IDT A;  5L6V A;  2I7B A;  2RJ5 A;  5C4B A;  2Y7A A;  5CQN X;  4B5B A;  4LW6 A;  2JCJ A;  2X60 A;  3ZGG A;  4DE7 A;  1IIM A;  5C4D A;  1JV1 A;  2AES A;  2NXV A;  1HM8 A;  1ZJ1 A;  1W55 A;  3ZGF A;  1MP4 A;  3LW6 A;  4D0Z A;  5FV9 A;  1YP4 A;  1JVD A;  2YES A;  4KNX A;  5CMG X;  3SXE A;  5C4F A;  4KNR A;  1O7O A;  4HG6 A;  4D0T A;  4D11 A;  2Q4J A;  4FRQ A;  4B4M A;  1R7Y A;  1FWY A;  5DDV A;  2XWM A;  4C2S A;  1GA8 A;  4BMA A;  2V0I A;  1GQC A;  1ZHJ A;  2WVL A;  2MZB A;  3ST8 A;  2YCM A;  5FTV A;  4FRE A;  2YQJ A;  1G97 A;  3OKR A;  1WT2 A;  5C47 A;  2RJ0 A;  3I0E A;  3SXG A;  4FRH A;  2UX8 A;  2GGO A;  1G9R A;  4FRO A;  2XMH A;  4M4K A;  2RIY A;  2AM5 A;  1GX0 A;  5CMI A;  4AYJ A;  4HOC A;  1G95 A;  2BO4 A;  2WAW A;  5EJ1 A;  3BCV A;  2RJ6 A;  3OAM A;  3RMV A;  3I0K A;  4R7P A;  2FFV A;  1EYR A;  1H7G A;  2ZU8 A;  4HO9 A;  1ON8 A;  4FRB A;  5AJP A;  2AE7 A;  2VXL A;  3V0M A;  1JYL A;  3V8Z A;  5DDT A;  4EEO A;  2BO7 A;  1LL0 A;  2I5K A;  4HO5 A;  3T7O A;  3IOJ A;  2V0H A;  2QKX A;  3I0L A;  5C4C A;  4NAK A;  1H7Q A;  4B3U A;  5C48 A;  2FYC B;  2O1H A;  4CVH A;  1VIC A;  1O0R A;  3PKP A;  2RJ4 A;  2XWL A;  1SS9 A;  3DUV A;  1VPA A;  1FO9 A;  3I0G A;  3D8V A;  3F1C A;  1GWV A;  4ZDQ A;  4IRQ A;  1R80 A;  3R3I A;  4LW3 A;  1H5S B;  3V8Y A;  2A8U A;  4HO3 A;  3OH0 A;  1H5S D;  4Y6U A;  1VZX A;  5FUH A;  3V90 A;  1WVC A;  2P73 A;  2YC5 A;  2FFU A;  3K8E A;  2PA4 A;  3RMW A;  2YQH A;  3F1Y A;  2VFZ A;  1R7T A;  2BO8 A;  5FYE A;  1NKH B;  1YP3 A;  3V0O A;  4EVW A;  1LZ7 A;  4KPX A;  3JUK A;  3U2V A;  1FZW A;  3V0N A;  4CJ8 A;  1ZJ3 A;  4BQH A;  4M2B A;  1FR9 A;  2W0W A;  3TQD A;  3OH4 A;  1H5R B;  1ZI5 A;  2OI6 A;  4D48 A;  4JD0 A;  1ZIZ A;  4GBP A;  3USR A;  1ZDG A;  2YQS A;  1ZDF A;  5CQO A;  3U2T A;  1VZU A;  2AEC A;  4KC4 A;  1H7L A;  4B2W A;  2V0K A;  2I5E A;  1YRO B;  1FG5 N;  3PNN A;  2V0J A;  3OC9 A;  3POL A;  3V0L A;  5C3B A;  4HO0 A;  2P6W A;  5C38 A;  4G3P A;  3K8D A;  2X65 A;  3I0F A;  1ZI1 A;  2WVK A;  2XME A;  1TW5 A;  1TW1 A;  1H4D A;  3KIA A;  1FGX A;  4ASJ A;  1HM9 A;  2Y6P A;  1V82 A;  4KXO A;  4CJB A;  4XWI A;  4EEA A;  2CU2 A;  1FXJ A;  1MP3 A;  4MND A;  2OI7 A;  4K6R A;  4KPZ A; 
#chains in the Genus database with same CATH topology
 5AJO A;  4FQW A;  4D11 C;  4FCE A;  1JVG A;  1JYK A;  2OEG A;  5IDS A;  3I0C A;  3CKJ A;  1WT0 A;  2JCO A;  1WT3 A;  5AJN A;  1VH1 A;  2D7I A;  2YQC A;  2FYD B;  1MC3 A;  2RIT A;  4Y9X A;  2Y4J A;  3JUJ A;  3D98 A;  3U2W A;  4NAN A;  4KT7 A;  2FY7 A;  2Y4L A;  3EE5 A;  4MYB A;  4B4G A;  1INI A;  3SX5 A;  1ZJP A;  1KWS A;  3IOI A;  3BRK X;  1LVW A;  2FYA A;  4E1K A;  1H5S A;  4P02 A;  4UEG A;  3PKQ A;  2W0V A;  2WVM A;  3SPT A;  3T7N A;  1ZJO A;  2V0L A;  3SXC A;  4Y7V A;  1LZI A;  1ON6 A;  1MP5 A;  3Q7U A;  3OH3 A;  4EEG A;  1H5T B;  1O7Q A;  2RJ1 A;  5C1G A;  1FOA A;  1HM0 A;  1ZCV A;  3DK5 A;  1OQM B;  3OGZ A;  1IIN A;  1G1L A;  3OH1 A;  1ZCT A;  2VSH A;  2AGD A;  2PGV A;  1O23 B;  1R82 A;  5CQP A;  2O1F A;  1G2V A;  1INJ A;  2WGZ A;  1H5R A;  1VGW A;  2RIX A;  2P72 A;  5EIY A;  1I52 A;  3GUE A;  4DEC A;  5EJZ A;  1G3L A;  4HO6 A;  1GQ9 A;  3V0P A;  1G23 A;  1QWJ A;  4G3S A;  5D92 A;  3USQ A;  1K4V A;  3D5N A;  2Z87 A;  1ZCU A;  2E8B A;  1H7T A;  2ZU9 A;  5FU0 A;  5CMF X;  1VGT A;  2VXM A;  4FIX A;  3DJ4 A;  3QVB A;  2J0A A;  1FGG A;  3R2W A;  4Y6N A;  5CMH A;  1WSZ A;  1XHB A;  3U0Y A;  2AM4 A;  1G0R A;  2D7R A;  4CJC A;  1XZ6 A;  2Y4K A;  3SX8 A;  3CKN A;  1FR8 A;  3OH2 A;  5C3D A;  1H4E A;  3TZT A;  1QGS A;  2YC3 A;  4EEM A;  1FO8 A;  2XWN A;  1GWW A;  1W57 A;  1LZ0 A;  2WEE A;  5J49 A;  2QH5 A;  2Z86 A;  1HV9 A;  3E26 A;  1NQI B;  2AH9 A;  4ARW A;  4FCU A;  2PGY A;  1ZJ0 A;  3SX7 A;  5C1L A;  5FTS A;  2Y4M A;  3CKQ A;  3N9W A;  4ASY A;  3SX3 A;  1LL3 A;  5BXC A;  5I1F A;  2OEF A;  5C49 A;  2AM3 A;  1VH3 A;  4FRA A;  4Y7G A;  1H7H A;  4Y7U A;  1FRW A;  3HL3 A;  4FRD A;  1ZI4 A;  2ICY A;  4G87 A;  2RJ9 A;  1E5K A;  2JCL A;  3CKV A;  1H3M A;  3SXB A;  4P00 A;  4Y62 A;  3I0D A;  4G3Q A;  4JIS A;  1V83 A;  1TZF A;  1ZI3 A;  1G8O A;  4J18 A;  1LL2 A;  1VGU A;  3SXA A;  3SXD A;  2E3D A;  4EE4 A;  3I0I X;  1NHE B;  1H7E A;  1R7X A;  1Z90 A;  2DPW A;  2VK9 A;  4HO4 A;  4ECM A;  3V91 A;  1R81 A;  5JQQ A;  1S4P A;  2FYB A;  3I0H A;  1PZY B;  2RJ8 A;  3ZLK A;  1H5T A;  3U2U A;  4EE5 A;  1YP2 A;  2GGQ A;  4EE3 A;  2OI5 A;  2WE9 A;  1H7F A;  4HO2 A;  2O1G A;  4YS8 A;  4B4B A;  1GX4 A;  1FXO A;  1R7U A;  1ZJ2 A;  3O3P A;  4AYL A;  5CQL X;  1R7V A;  5D91 A;  2ICX A;  4B42 A;  4NAI A;  4AC3 A;  1QG8 A;  4HCQ A;  3ZF8 A;  4Y7F A;  2RJ7 A;  4Y64 A;  1HJL A;  2D0J A;  4Y7T A;  4FRM A;  5L6S A;  2BO6 A;  4Y63 A;  4B2X A;  1OMX A;  1PZT A;  3E25 A;  1H5S C;  4KQL A;  4AAW A;  4KC2 A;  1G93 A;  3V0Q A;  1NF5 B;  3JTJ A;  1LZJ A;  2ZU7 A;  1ZCY A;  1TVY A;  4NAL A;  1OMZ A;  4FRL A;  4IRP A;  2JCK A;  3T7M A;  2X5S A;  2VD4 A;  1S4O A;  5C36 A;  2VS3 A;  4KRV A;  3NGW A;  1V84 A;  3U2X A;  2PX7 A;  1EZI A;  5C1H A;  4DDZ A;  5HS2 A;  2A8W A;  4HO8 A;  3Q4S A;  4M28 A;  5FU8 A;  1JV3 A;  3U0X A;  5CQM X;  5CMJ A;  1WT1 A;  3I0J A;  1VGZ A;  1QGQ A;  4KC1 A;  2RIZ A;  3CU0 A;  5C3A A;  1VM8 A;  1NMM B;  1W77 A;  5IFY A;  3FOQ A;  4FRP A;  2VS4 A;  1NWG B;  2X5Z A;  2J0B A;  2QGI A;  3RSB A;  3FWW A;  3CGX A;  3ZLL A;  1VZT A;  1S4N A;  1H4C A;  1HJJ A;  2VS5 A;  2VSI A;  5C4E A;  3Q80 A;  3IOH A;  3CKO A;  2APC A;  4L41 C;  5C8R A;  4M2A A;  5IDT A;  5L6V A;  2I7B A;  2RJ5 A;  5C4B A;  2Y7A A;  5CQN X;  4B5B A;  4LW6 A;  2JCJ A;  2X60 A;  3ZGG A;  4DE7 A;  1IIM A;  5C4D A;  1JV1 A;  2AES A;  2NXV A;  1HM8 A;  1ZJ1 A;  1W55 A;  3ZGF A;  1MP4 A;  3LW6 A;  4D0Z A;  5FV9 A;  1YP4 A;  1JVD A;  2YES A;  4KNX A;  5CMG X;  3SXE A;  5C4F A;  4KNR A;  1O7O A;  4HG6 A;  4D0T A;  4D11 A;  2Q4J A;  4FRQ A;  4B4M A;  1R7Y A;  1FWY A;  5DDV A;  2XWM A;  4C2S A;  1GA8 A;  4BMA A;  2V0I A;  1GQC A;  1ZHJ A;  2WVL A;  2MZB A;  3ST8 A;  2YCM A;  5FTV A;  4FRE A;  4Q7C A;  2YQJ A;  1G97 A;  3OKR A;  1WT2 A;  5C47 A;  2RJ0 A;  3I0E A;  3SXG A;  4FRH A;  2UX8 A;  2GGO A;  1G9R A;  4FRO A;  2XMH A;  4M4K A;  2RIY A;  2AM5 A;  1GX0 A;  5CMI A;  4AYJ A;  4HOC A;  1G95 A;  2BO4 A;  2WAW A;  5EJ1 A;  3BCV A;  2RJ6 A;  3OAM A;  3RMV A;  3I0K A;  4R7P A;  2FFV A;  1EYR A;  1H7G A;  2ZU8 A;  4HO9 A;  1ON8 A;  4FRB A;  5AJP A;  2AE7 A;  2VXL A;  3V0M A;  1JYL A;  3V8Z A;  5DDT A;  4EEO A;  2BO7 A;  1LL0 A;  2I5K A;  4HO5 A;  3T7O A;  3IOJ A;  2V0H A;  2QKX A;  3I0L A;  5C4C A;  4NAK A;  1H7Q A;  4B3U A;  5C48 A;  2FYC B;  2O1H A;  4CVH A;  1VIC A;  1O0R A;  3PKP A;  2RJ4 A;  2XWL A;  1SS9 A;  3DUV A;  4MIX A;  1VPA A;  1FO9 A;  3I0G A;  3D8V A;  3F1C A;  1GWV A;  4ZDQ A;  4IRQ A;  1R80 A;  3R3I A;  4LW3 A;  1H5S B;  3V8Y A;  2A8U A;  4HO3 A;  3OH0 A;  1H5S D;  4Y6U A;  1VZX A;  5FUH A;  3V90 A;  1WVC A;  2P73 A;  2YC5 A;  2FFU A;  3K8E A;  2PA4 A;  3RMW A;  2YQH A;  3F1Y A;  2VFZ A;  1R7T A;  2BO8 A;  5FYE A;  1NKH B;  1YP3 A;  3V0O A;  4EVW A;  1LZ7 A;  4KPX A;  3JUK A;  3U2V A;  1FZW A;  3V0N A;  4CJ8 A;  1ZJ3 A;  4BQH A;  4M2B A;  1FR9 A;  2W0W A;  3TQD A;  3OH4 A;  1H5R B;  1ZI5 A;  2OI6 A;  4D48 A;  4JD0 A;  1ZIZ A;  4GBP A;  2C0N A;  3USR A;  1ZDG A;  2YQS A;  1ZDF A;  5CQO A;  3U2T A;  1VZU A;  2AEC A;  4KC4 A;  1H7L A;  4B2W A;  4O6M A;  2V0K A;  2I5E A;  1YRO B;  1FG5 N;  3PNN A;  2V0J A;  3OC9 A;  3POL A;  3V0L A;  5C3B A;  4HO0 A;  2P6W A;  5C38 A;  4G3P A;  3K8D A;  2X65 A;  3I0F A;  1ZI1 A;  2WVK A;  2XME A;  1TW5 A;  1TW1 A;  1H4D A;  3KIA A;  1FGX A;  4ASJ A;  1HM9 A;  2Y6P A;  1V82 A;  4KXO A;  4CJB A;  4XWI A;  4EEA A;  4O6N A;  2CU2 A;  1FXJ A;  4FIY A;  1MP3 A;  4MND A;  2OI7 A;  4K6R A;  4KPZ A; 
#chains in the Genus database with same CATH homology
 5AJO A;  4FQW A;  4D11 C;  4FCE A;  1JVG A;  1JYK A;  2OEG A;  5IDS A;  3I0C A;  3CKJ A;  1WT0 A;  2JCO A;  1WT3 A;  5AJN A;  1VH1 A;  2D7I A;  2YQC A;  2FYD B;  1MC3 A;  2RIT A;  4Y9X A;  2Y4J A;  3JUJ A;  3D98 A;  3U2W A;  4NAN A;  4KT7 A;  2FY7 A;  2Y4L A;  3EE5 A;  4MYB A;  4B4G A;  1INI A;  3SX5 A;  1ZJP A;  1KWS A;  3IOI A;  3BRK X;  1LVW A;  2FYA A;  4E1K A;  1H5S A;  4P02 A;  4UEG A;  3PKQ A;  2W0V A;  2WVM A;  3SPT A;  3T7N A;  1ZJO A;  2V0L A;  3SXC A;  4Y7V A;  1LZI A;  1ON6 A;  1MP5 A;  3Q7U A;  3OH3 A;  4EEG A;  1H5T B;  1O7Q A;  2RJ1 A;  5C1G A;  1FOA A;  1HM0 A;  1ZCV A;  3DK5 A;  1OQM B;  3OGZ A;  1IIN A;  1G1L A;  3OH1 A;  1ZCT A;  2VSH A;  2AGD A;  2PGV A;  1O23 B;  1R82 A;  5CQP A;  2O1F A;  1G2V A;  1INJ A;  2WGZ A;  1H5R A;  1VGW A;  2RIX A;  2P72 A;  5EIY A;  1I52 A;  3GUE A;  4DEC A;  5EJZ A;  1G3L A;  4HO6 A;  1GQ9 A;  3V0P A;  1G23 A;  1QWJ A;  4G3S A;  5D92 A;  3USQ A;  1K4V A;  3D5N A;  2Z87 A;  1ZCU A;  2E8B A;  1H7T A;  2ZU9 A;  5FU0 A;  5CMF X;  1VGT A;  2VXM A;  4FIX A;  3DJ4 A;  3QVB A;  2J0A A;  1FGG A;  3R2W A;  4Y6N A;  5CMH A;  1WSZ A;  1XHB A;  3U0Y A;  2AM4 A;  1G0R A;  2D7R A;  4CJC A;  1XZ6 A;  2Y4K A;  3SX8 A;  3CKN A;  1FR8 A;  3OH2 A;  5C3D A;  1H4E A;  3TZT A;  1QGS A;  2YC3 A;  4EEM A;  1FO8 A;  2XWN A;  1GWW A;  1W57 A;  1LZ0 A;  2WEE A;  5J49 A;  2QH5 A;  2Z86 A;  1HV9 A;  3E26 A;  1NQI B;  2AH9 A;  4ARW A;  4FCU A;  2PGY A;  1ZJ0 A;  3SX7 A;  5C1L A;  5FTS A;  2Y4M A;  3CKQ A;  3N9W A;  4ASY A;  3SX3 A;  1LL3 A;  5BXC A;  5I1F A;  2OEF A;  5C49 A;  2AM3 A;  1VH3 A;  4FRA A;  4Y7G A;  1H7H A;  4Y7U A;  1FRW A;  3HL3 A;  4FRD A;  1ZI4 A;  2ICY A;  4G87 A;  2RJ9 A;  1E5K A;  2JCL A;  3CKV A;  1H3M A;  3SXB A;  4P00 A;  4Y62 A;  3I0D A;  4G3Q A;  4JIS A;  1V83 A;  1TZF A;  1ZI3 A;  1G8O A;  4J18 A;  1LL2 A;  1VGU A;  3SXA A;  3SXD A;  2E3D A;  4EE4 A;  3I0I X;  1NHE B;  1H7E A;  1R7X A;  1Z90 A;  2DPW A;  2VK9 A;  4HO4 A;  4ECM A;  3V91 A;  1R81 A;  5JQQ A;  1S4P A;  2FYB A;  3I0H A;  1PZY B;  2RJ8 A;  3ZLK A;  1H5T A;  3U2U A;  4EE5 A;  1YP2 A;  2GGQ A;  4EE3 A;  2OI5 A;  2WE9 A;  1H7F A;  4HO2 A;  2O1G A;  4YS8 A;  4B4B A;  1GX4 A;  1FXO A;  1R7U A;  1ZJ2 A;  3O3P A;  4AYL A;  5CQL X;  1R7V A;  5D91 A;  2ICX A;  4B42 A;  4NAI A;  4AC3 A;  1QG8 A;  4HCQ A;  3ZF8 A;  4Y7F A;  2RJ7 A;  4Y64 A;  1HJL A;  2D0J A;  4Y7T A;  4FRM A;  5L6S A;  2BO6 A;  4Y63 A;  4B2X A;  1OMX A;  1PZT A;  3E25 A;  1H5S C;  4KQL A;  4AAW A;  4KC2 A;  1G93 A;  3V0Q A;  1NF5 B;  3JTJ A;  1LZJ A;  2ZU7 A;  1ZCY A;  1TVY A;  4NAL A;  1OMZ A;  4FRL A;  4IRP A;  2JCK A;  3T7M A;  2X5S A;  2VD4 A;  1S4O A;  5C36 A;  2VS3 A;  4KRV A;  3NGW A;  1V84 A;  3U2X A;  2PX7 A;  1EZI A;  5C1H A;  4DDZ A;  5HS2 A;  2A8W A;  4HO8 A;  3Q4S A;  4M28 A;  5FU8 A;  1JV3 A;  3U0X A;  5CQM X;  5CMJ A;  1WT1 A;  3I0J A;  1VGZ A;  1QGQ A;  4KC1 A;  2RIZ A;  3CU0 A;  5C3A A;  1VM8 A;  1NMM B;  1W77 A;  5IFY A;  3FOQ A;  4FRP A;  2VS4 A;  1NWG B;  2X5Z A;  2J0B A;  2QGI A;  3RSB A;  3FWW A;  3CGX A;  3ZLL A;  1VZT A;  1S4N A;  1H4C A;  1HJJ A;  2VS5 A;  2VSI A;  5C4E A;  3Q80 A;  3IOH A;  3CKO A;  2APC A;  4L41 C;  5C8R A;  4M2A A;  5IDT A;  5L6V A;  2I7B A;  2RJ5 A;  5C4B A;  2Y7A A;  5CQN X;  4B5B A;  4LW6 A;  2JCJ A;  2X60 A;  3ZGG A;  4DE7 A;  1IIM A;  5C4D A;  1JV1 A;  2AES A;  2NXV A;  1HM8 A;  1ZJ1 A;  1W55 A;  3ZGF A;  1MP4 A;  3LW6 A;  4D0Z A;  5FV9 A;  1YP4 A;  1JVD A;  2YES A;  4KNX A;  5CMG X;  3SXE A;  5C4F A;  4KNR A;  1O7O A;  4HG6 A;  4D0T A;  4D11 A;  2Q4J A;  4FRQ A;  4B4M A;  1R7Y A;  1FWY A;  5DDV A;  2XWM A;  4C2S A;  1GA8 A;  4BMA A;  2V0I A;  1GQC A;  1ZHJ A;  2WVL A;  2MZB A;  3ST8 A;  2YCM A;  5FTV A;  4FRE A;  4Q7C A;  2YQJ A;  1G97 A;  3OKR A;  1WT2 A;  5C47 A;  2RJ0 A;  3I0E A;  3SXG A;  4FRH A;  2UX8 A;  2GGO A;  1G9R A;  4FRO A;  2XMH A;  4M4K A;  2RIY A;  2AM5 A;  1GX0 A;  5CMI A;  4AYJ A;  4HOC A;  1G95 A;  2BO4 A;  2WAW A;  5EJ1 A;  3BCV A;  2RJ6 A;  3OAM A;  3RMV A;  3I0K A;  4R7P A;  2FFV A;  1EYR A;  1H7G A;  2ZU8 A;  4HO9 A;  1ON8 A;  4FRB A;  5AJP A;  2AE7 A;  2VXL A;  3V0M A;  1JYL A;  3V8Z A;  5DDT A;  4EEO A;  2BO7 A;  1LL0 A;  2I5K A;  4HO5 A;  3T7O A;  3IOJ A;  2V0H A;  2QKX A;  3I0L A;  5C4C A;  4NAK A;  1H7Q A;  4B3U A;  5C48 A;  2FYC B;  2O1H A;  4CVH A;  1VIC A;  1O0R A;  3PKP A;  2RJ4 A;  2XWL A;  1SS9 A;  3DUV A;  4MIX A;  1VPA A;  1FO9 A;  3I0G A;  3D8V A;  3F1C A;  1GWV A;  4ZDQ A;  4IRQ A;  1R80 A;  3R3I A;  4LW3 A;  1H5S B;  3V8Y A;  2A8U A;  4HO3 A;  3OH0 A;  1H5S D;  4Y6U A;  1VZX A;  5FUH A;  3V90 A;  1WVC A;  2P73 A;  2YC5 A;  2FFU A;  3K8E A;  2PA4 A;  3RMW A;  2YQH A;  3F1Y A;  2VFZ A;  1R7T A;  2BO8 A;  5FYE A;  1NKH B;  1YP3 A;  3V0O A;  4EVW A;  1LZ7 A;  4KPX A;  3JUK A;  3U2V A;  1FZW A;  3V0N A;  4CJ8 A;  1ZJ3 A;  4BQH A;  4M2B A;  1FR9 A;  2W0W A;  3TQD A;  3OH4 A;  1H5R B;  1ZI5 A;  2OI6 A;  4D48 A;  4JD0 A;  1ZIZ A;  4GBP A;  2C0N A;  3USR A;  1ZDG A;  2YQS A;  1ZDF A;  5CQO A;  3U2T A;  1VZU A;  2AEC A;  4KC4 A;  1H7L A;  4B2W A;  4O6M A;  2V0K A;  2I5E A;  1YRO B;  1FG5 N;  3PNN A;  2V0J A;  3OC9 A;  3POL A;  3V0L A;  5C3B A;  4HO0 A;  2P6W A;  5C38 A;  4G3P A;  3K8D A;  2X65 A;  3I0F A;  1ZI1 A;  2WVK A;  2XME A;  1TW5 A;  1TW1 A;  1H4D A;  3KIA A;  1FGX A;  4ASJ A;  1HM9 A;  2Y6P A;  1V82 A;  4KXO A;  4CJB A;  4XWI A;  4EEA A;  4O6N A;  2CU2 A;  1FXJ A;  4FIY A;  1MP3 A;  4MND A;  2OI7 A;  4K6R A;  4KPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...