3IOHA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
283
structure length
283
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Structural and mechanistic basis for a new mode of glycosyltransferase inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 283
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3iohA00
5C47A 2Z87A 1H5TA 4G87A 3USRA 3I0JA 5C48A 1LL2A 1ZHJA 4KPXA 3BRKX 3OAMA 1VZXA 2CU2A 3SPTA 5C1GA 2E3DA 5IFYA 1HV9A 2FYBA 4YS8A 1ZCTA 5FTVA 4BMAA 4M28A 1OMZA 3ZF8A 3E26A 4FRQA 1ZJ1A 1PZYB 2WVLA 3E25A 4NAIA 1OQMB 1JV3A 1LZJA 4ASJA 4E1KA 1H5TB 4B2XA 4EE5A 3IOIA 1MC3A 4Y64A 1LL3A 3Q7UA 1G2VA 4AYJA 1ZJ2A 4FCEA 4CJ8A 5C3DA 4B3UA 4KNXA 1EYRA 1FWYA 1VPAA 4FREA 1LZ0A 2GGOA 2ZU7A 1ZI1A 3SX5A 2I5EA 2RJ6A 1H5SA 2YQSA 4KNRA 3OGZA 4EEMA 5I1FA 2BO7A 2O1FA 1H5SD 2VFZA 5CMFX 2VS4A 1QWJA 3PKPA 2O1HA 4FRLA 2AESA 4XWIA 2Y4JA 4M2AA 1NHEB 2FYCB 3POLA 4HO0A 4B2WA 1HM8A 1G93A 4HO6A 1ZCUA 2NXVA 1HJJA 4L41C 3U2XA 1H5SB 2VS5A 4MNDA 3Q80A 3TZTA 3R3IA 4FCUA 1YROB 4AC3A 1V84A 2VS3A 5CMGX 2QKXA 2V0IA 4ASYA 3I0HA 4FRDA 2YC5A 2YQHA 1ON8A 1G9RA 1GWVA 1LVWA 2AM3A 2Y4MA 3RMVA 1VH1A 3D5NA 1HM0A 2XWMA 2D7IA 3OKRA 1G95A 3U2VA 1S4OA 4FRAA 2GGQA 4Y6UA 3V0PA 1INJA 2FYDB 1H7FA 2XWLA 3IOJA 1VZTA 1H4DA 5C4EA 2XMEA 1G23A 2XMHA 1H7HA 3I0KA 4D11A 2AECA 3U2WA 4Y7UA 3PNNA 5CQPA 4FRBA 1EZIA 4ECMA 1OMXA 1ZJ0A 2X65A 3USQA 2AM4A 3TQDA 1ZIZA 1FOAA 5C4FA 1R7TA 4G3SA 2YC3A 1FR8A 3HL3A 4KXOA 1WT3A 1XZ6A 1JYLA 3U0XA 1WVCA 2RJ8A 2Y6PA 2D0JA 2PGVA 5CQNX 5EJ1A 1R81A 1V82A 3O3PA 3V90A 3SXCA 1QG8A 2UX8A 5JQQA 2BO4A 4UEGA 2JCOA 3RSBA 1R80A 2OEGA 4LW6A 3F1CA 4G3QA 5L6SA 3CKQA 1NKHB 3ZLLA 3I0LA 4EEAA 5L6VA 3JUKA 1W55A 5FV9A 3ZGGA 4B42A 1H5RB 2Y7AA 3Q4SA 4HO4A 4Y7GA 3CU0A 4DECA 3T7MA 4IRPA 4B5BA 4B4GA 1VM8A 5IDTA 1FGXA 3V8YA 1JYKA 1QGSA 4CVHA 1H3MA 4GBPA 2WE9A 2X60A 1FZWA 2OI6A 4EEOA 3V0OA 2X5SA 2VXLA 3OC9A 5FU0A 2YQJA 3OH4A 2ZU8A 3NGWA 4NANA 2AGDA 3CKNA 2XWNA 1FGGA 4KC1A 1G97A 2WVKA 2QH5A 3U2TA 1O7OA 2RJ7A 4KQLA 3U0YA 2RJ5A 5C4BA 4EEGA 1TVYA 4J18A 3FOQA 1K4VA 4AAWA 1R7UA 4NAKA 3V0QA 5C3BA 5CQLX 4BQHA 1NF5B 2RJ4A 1FG5N 4KC2A 3CGXA 2VSIA 5IDSA 5C49A 2YCMA 3DUVA 3R2WA 2MZBA 2V0JA 5AJPA 1ZI5A 2YQCA 3V91A 5DDTA 4D48A 1VGUA 1FXOA 1O23B 2YESA 1MP3A 5HS2A 5FTSA 3JUJA 5FUHA 4Y62A 4FQWA 1MP4A 1H5SC 5CMHA 1H7LA 4KRVA 3T7OA 3SXBA 5EJZA 4CJCA 2RIXA 2ICXA 3GUEA 2AM5A 1W57A 1H7EA 1XHBA 3BCVA 1VICA 3D98A 1NMMB 4HO9A 5C36A 3CKVA 3U2UA 4Y63A 2ICYA 3OH2A 2JCJA 1YP2A 2RJ1A 3SXGA 3V0MA 1WT0A 1R7YA 2WGZA 4EE3A 5BXCA 3T7NA 5CQOA 1GQ9A 4JISA 3IOHA 3K8DA 3I0GA 2AE7A 2QGIA 1FO9A 1YP4A 1H5RA 2ZU9A 5FYEA 1LL0A 5CMIA 3F1YA 1QGQA 2VSHA 3JTJA 5J49A 1VGTA 5C1HA 1WT1A 4DDZA 1R7VA 4CJBA 3ZGFA 1LZ7A 4Y7TA 5C1LA 2V0LA 1ZI3A 1ZJOA 3EE5A 5DDVA 2BO6A 2O1GA 2E8BA 1E5KA 1G1LA 2D7RA 4HO3A 1MP5A 4NALA 1H7TA 1ZDGA 4FRPA 2VXMA 4B4MA 4HO8A 3SX3A 1IINA 4Y9XA 3SXDA 4AYLA 4KPZA 4Y6NA 1HJLA 3I0CA 1ZI4A 1PZTA 4FRHA 3I0DA 3CKOA 2RIYA 4D11C 5AJOA 2PA4A 3OH1A 1H4CA 3SXAA 3SX7A 5AJNA 3SXEA 2OI7A 3OH0A 5C4CA 5CMJA 2WAWA 1VH3A 1G8OA 1JVGA 1TW5A 2A8WA 1ZCYA 1VGZA 3KIAA 2DPWA 4HOCA 4DE7A 4FRMA 1S4PA 2FY7A 1Z90A 1ZCVA 2OEFA 3I0FA 3QVBA 1R7XA 3DK5A 4C2SA 2VD4A 4G3PA 3ZLKA 2RIZA 3OH3A 1V83A 1ON6A 1GX0A 1LZIA 4JD0A 3PKQA 1INIA 1WT2A 1NWGB 1IIMA 2FYAA 2Z86A 1WSZA 4P02A 3RMWA 1R82A 1GWWA 1FRWA 1TZFA 1FXJA 3FWWA 4M4KA 2FFUA 2V0HA 4ZDQA 4HO2A 5C3AA 3K8EA 3D8VA 1JV1A 3ST8A 1YP3A 2X5ZA 3DJ4A 4HO5A 1SS9A 4ARWA 2JCKA 1KWSA 2WEEA 2P73A 2RJ9A 3V0LA 2A8UA 2I5KA 2PX7A 1H4EA 4HG6A 4FROA 5CQMX 1ZDFA 2P72A 1ZJ3A 2AH9A 3SX8A 3V8ZA 4EE4A 2I7BA 3I0EA 5C38A 2RJ0A 1O7QA 2Q4JA 4B4BA 2APCA 1NQIB 1G0RA 1ZJPA 2P6WA 4KC4A 5C4DA 4R7PA 5EIYA 2RITA 4M2BA 4EVWA 1GQCA 4Y7FA 4D0TA 2PGYA 2Y4KA 1GX4A 1FO8A 1FR9A 1S4NA 4KT7A 1O0RA 3I0IX 1VGWA 2WVMA 4HCQA 5FU8A 2W0WA 4K6RA 1GA8A 4LW3A 1G3LA 2OI5A 4D0ZA 2Y4LA 2FFVA 4IRQA 1TW1A 2W0VA 5C8RA 2BO8A 3CKJA 1JVDA 3N9WA 1HM9A 4P00A 1W77A 1H7QA 2V0KA 4MYBA 1I52A 2JCLA 3LW6A 1H7GA 1VZUA 3V0NA 4Y7VA
chains in the Genus database with same CATH superfamily
5C47A 2Z87A 1H5TA 4FIXA 4G87A 3USRA 3I0JA 5C48A 1LL2A 1ZHJA 4KPXA 3BRKX 3OAMA 1VZXA 2CU2A 2J0BA 3SPTA 5D92A 5C1GA 2E3DA 5IFYA 1HV9A 2FYBA 4YS8A 1ZCTA 5FTVA 4BMAA 4M28A 1OMZA 3ZF8A 3E26A 4FRQA 1ZJ1A 1PZYB 2WVLA 3E25A 4NAIA 1OQMB 1JV3A 1LZJA 4ASJA 4E1KA 2J0AA 2VK9A 1H5TB 4B2XA 4EE5A 3IOIA 1MC3A 4Y64A 5D91A 1LL3A 3Q7UA 1G2VA 4AYJA 1ZJ2A 4FCEA 4CJ8A 5C3DA 4B3UA 4KNXA 1EYRA 1FWYA 1VPAA 4FREA 1LZ0A 2GGOA 2ZU7A 1ZI1A 3SX5A 2I5EA 2RJ6A 1H5SA 2YQSA 4KNRA 3OGZA 4EEMA 5I1FA 2BO7A 2O1FA 1H5SD 2VFZA 5CMFX 2VS4A 1QWJA 3PKPA 2O1HA 4FRLA 2AESA 4XWIA 2Y4JA 4M2AA 1NHEB 2FYCB 3POLA 4HO0A 4B2WA 1HM8A 1G93A 4HO6A 1ZCUA 2NXVA 1HJJA 4L41C 3U2XA 1H5SB 2VS5A 4MNDA 3Q80A 3TZTA 3R3IA 4FCUA 1YROB 4AC3A 1V84A 2VS3A 5CMGX 2QKXA 2V0IA 4ASYA 3I0HA 4FRDA 2YC5A 2YQHA 1ON8A 1G9RA 1GWVA 1LVWA 2AM3A 2Y4MA 3RMVA 1VH1A 3D5NA 1HM0A 2XWMA 2D7IA 3OKRA 1G95A 3U2VA 1S4OA 4FRAA 2GGQA 4Y6UA 3V0PA 1INJA 2FYDB 1H7FA 2XWLA 3IOJA 1VZTA 1H4DA 5C4EA 2XMEA 1G23A 2XMHA 1H7HA 3I0KA 4D11A 2AECA 3U2WA 4Y7UA 3PNNA 5CQPA 4FRBA 1EZIA 2C0NA 4ECMA 1OMXA 1ZJ0A 2X65A 3USQA 2AM4A 3TQDA 1ZIZA 1FOAA 5C4FA 1R7TA 4G3SA 2YC3A 1FR8A 3HL3A 4KXOA 1WT3A 1XZ6A 1JYLA 3U0XA 1WVCA 2RJ8A 2Y6PA 2D0JA 2PGVA 5CQNX 5EJ1A 1R81A 1V82A 3O3PA 3V90A 3SXCA 1QG8A 2UX8A 5JQQA 2BO4A 4UEGA 2JCOA 3RSBA 1R80A 2OEGA 4LW6A 3F1CA 4G3QA 5L6SA 3CKQA 1NKHB 3ZLLA 3I0LA 4EEAA 4O6NA 5L6VA 3JUKA 1W55A 5FV9A 3ZGGA 4B42A 1H5RB 2Y7AA 3Q4SA 4HO4A 4Y7GA 3CU0A 4DECA 3T7MA 4IRPA 4MIXA 4B5BA 4B4GA 1VM8A 5IDTA 1FGXA 3V8YA 4FIYA 1JYKA 1QGSA 4CVHA 1H3MA 4GBPA 2WE9A 2X60A 1FZWA 2OI6A 4EEOA 3V0OA 2X5SA 2VXLA 3OC9A 5FU0A 2YQJA 3OH4A 2ZU8A 3NGWA 4NANA 2AGDA 3CKNA 2XWNA 1FGGA 4KC1A 1G97A 2WVKA 2QH5A 3U2TA 1O7OA 2RJ7A 4KQLA 3U0YA 2RJ5A 5C4BA 4EEGA 1TVYA 4J18A 3FOQA 1K4VA 4AAWA 1R7UA 4NAKA 3V0QA 5C3BA 5CQLX 4BQHA 1NF5B 2RJ4A 1FG5N 4KC2A 3CGXA 2VSIA 5IDSA 5C49A 2YCMA 3DUVA 3R2WA 2MZBA 2V0JA 5AJPA 1ZI5A 2YQCA 3V91A 5DDTA 4D48A 1VGUA 1FXOA 1O23B 2YESA 1MP3A 5HS2A 5FTSA 3JUJA 5FUHA 4Y62A 4FQWA 1MP4A 1H5SC 5CMHA 1H7LA 4KRVA 3T7OA 3SXBA 5EJZA 4CJCA 2RIXA 2ICXA 3GUEA 2AM5A 1W57A 1H7EA 1XHBA 3BCVA 1VICA 3D98A 1NMMB 4HO9A 5C36A 3CKVA 3U2UA 4Y63A 2ICYA 3OH2A 2JCJA 1YP2A 2RJ1A 3SXGA 3V0MA 1WT0A 1R7YA 2WGZA 4EE3A 5BXCA 3T7NA 5CQOA 1GQ9A 4JISA 3IOHA 3K8DA 3I0GA 2AE7A 2QGIA 1FO9A 1YP4A 1H5RA 2ZU9A 5FYEA 1LL0A 5CMIA 3F1YA 1QGQA 2VSHA 3JTJA 5J49A 1VGTA 5C1HA 1WT1A 4DDZA 1R7VA 4CJBA 3ZGFA 1LZ7A 4Y7TA 5C1LA 2V0LA 1ZI3A 1ZJOA 3EE5A 5DDVA 2BO6A 2O1GA 2E8BA 1E5KA 1G1LA 2D7RA 4HO3A 1MP5A 4NALA 1H7TA 1ZDGA 4FRPA 2VXMA 4B4MA 4HO8A 3SX3A 1IINA 4Y9XA 3SXDA 4AYLA 4KPZA 4Y6NA 1HJLA 3I0CA 1ZI4A 1PZTA 4FRHA 3I0DA 3CKOA 2RIYA 4D11C 5AJOA 2PA4A 3OH1A 1H4CA 3SXAA 3SX7A 5AJNA 3SXEA 2OI7A 3OH0A 5C4CA 5CMJA 2WAWA 1VH3A 1G8OA 1JVGA 1TW5A 2A8WA 1ZCYA 1VGZA 3KIAA 2DPWA 4HOCA 4DE7A 4FRMA 1S4PA 2FY7A 1Z90A 1ZCVA 2OEFA 3I0FA 3QVBA 1R7XA 3DK5A 4O6MA 4C2SA 2VD4A 4G3PA 3ZLKA 2RIZA 3OH3A 1V83A 1ON6A 1GX0A 1LZIA 4JD0A 3PKQA 1INIA 1WT2A 1NWGB 1IIMA 2FYAA 2Z86A 1WSZA 4P02A 3RMWA 1R82A 1GWWA 1FRWA 1TZFA 1FXJA 3FWWA 4M4KA 2FFUA 2V0HA 4ZDQA 4HO2A 5C3AA 3K8EA 3D8VA 1JV1A 3ST8A 1YP3A 2X5ZA 3DJ4A 4HO5A 1SS9A 4ARWA 2JCKA 1KWSA 2WEEA 2P73A 2RJ9A 3V0LA 2A8UA 2I5KA 2PX7A 1H4EA 4HG6A 4FROA 5CQMX 1ZDFA 2P72A 1ZJ3A 2AH9A 3SX8A 3V8ZA 4EE4A 2I7BA 3I0EA 5C38A 2RJ0A 1O7QA 2Q4JA 4B4BA 2APCA 1NQIB 1G0RA 1ZJPA 2P6WA 4KC4A 5C4DA 4R7PA 5EIYA 4Q7CA 2RITA 4M2BA 4EVWA 1GQCA 4Y7FA 4D0TA 2PGYA 2Y4KA 1GX4A 1FO8A 1FR9A 1S4NA 4KT7A 1O0RA 3I0IX 1VGWA 2WVMA 4HCQA 5FU8A 2W0WA 4K6RA 1GA8A 4LW3A 1G3LA 2OI5A 4D0ZA 2Y4LA 2FFVA 4IRQA 1TW1A 2W0VA 5C8RA 2BO8A 3CKJA 1JVDA 3N9WA 1HM9A 4P00A 1W77A 1H7QA 2V0KA 4MYBA 1I52A 2JCLA 3LW6A 1H7GA 1VZUA 3V0NA 4Y7VA
chains in the Genus database with same CATH topology
5C47A 2Z87A 1H5TA 4FIXA 4G87A 3USRA 3I0JA 5C48A 1LL2A 1ZHJA 4KPXA 3BRKX 3OAMA 1VZXA 2CU2A 2J0BA 3SPTA 5D92A 5C1GA 2E3DA 5IFYA 1HV9A 2FYBA 4YS8A 1ZCTA 5FTVA 4BMAA 4M28A 1OMZA 3ZF8A 3E26A 4FRQA 1ZJ1A 1PZYB 2WVLA 3E25A 4NAIA 1OQMB 1JV3A 1LZJA 4ASJA 4E1KA 2J0AA 2VK9A 1H5TB 4B2XA 4EE5A 3IOIA 1MC3A 4Y64A 5D91A 1LL3A 3Q7UA 1G2VA 4AYJA 1ZJ2A 4FCEA 4CJ8A 5C3DA 4B3UA 4KNXA 1EYRA 1FWYA 1VPAA 4FREA 1LZ0A 2GGOA 2ZU7A 1ZI1A 3SX5A 2I5EA 2RJ6A 1H5SA 2YQSA 4KNRA 3OGZA 4EEMA 5I1FA 2BO7A 2O1FA 1H5SD 2VFZA 5CMFX 2VS4A 1QWJA 3PKPA 2O1HA 4FRLA 2AESA 4XWIA 2Y4JA 4M2AA 1NHEB 2FYCB 3POLA 4HO0A 4B2WA 1HM8A 1G93A 4HO6A 1ZCUA 2NXVA 1HJJA 4L41C 3U2XA 1H5SB 2VS5A 4MNDA 3Q80A 3TZTA 3R3IA 4FCUA 1YROB 4AC3A 1V84A 2VS3A 5CMGX 2QKXA 2V0IA 4ASYA 3I0HA 4FRDA 2YC5A 2YQHA 1ON8A 1G9RA 1GWVA 1LVWA 2AM3A 2Y4MA 3RMVA 1VH1A 3D5NA 1HM0A 2XWMA 2D7IA 3OKRA 1G95A 3U2VA 1S4OA 4FRAA 2GGQA 4Y6UA 3V0PA 1INJA 2FYDB 1H7FA 2XWLA 3IOJA 1VZTA 1H4DA 5C4EA 2XMEA 1G23A 2XMHA 1H7HA 3I0KA 4D11A 2AECA 3U2WA 4Y7UA 3PNNA 5CQPA 4FRBA 1EZIA 2C0NA 4ECMA 1OMXA 1ZJ0A 2X65A 3USQA 2AM4A 3TQDA 1ZIZA 1FOAA 5C4FA 1R7TA 4G3SA 2YC3A 1FR8A 3HL3A 4KXOA 1WT3A 1XZ6A 1JYLA 3U0XA 1WVCA 2RJ8A 2Y6PA 2D0JA 2PGVA 5CQNX 5EJ1A 1R81A 1V82A 3O3PA 3V90A 3SXCA 1QG8A 2UX8A 5JQQA 2BO4A 4UEGA 2JCOA 3RSBA 1R80A 2OEGA 4LW6A 3F1CA 4G3QA 5L6SA 3CKQA 1NKHB 3ZLLA 3I0LA 4EEAA 4O6NA 5L6VA 3JUKA 1W55A 5FV9A 3ZGGA 4B42A 1H5RB 2Y7AA 3Q4SA 4HO4A 4Y7GA 3CU0A 4DECA 3T7MA 4IRPA 4MIXA 4B5BA 4B4GA 1VM8A 5IDTA 1FGXA 3V8YA 4FIYA 1JYKA 1QGSA 4CVHA 1H3MA 4GBPA 2WE9A 2X60A 1FZWA 2OI6A 4EEOA 3V0OA 2X5SA 2VXLA 3OC9A 5FU0A 2YQJA 3OH4A 2ZU8A 3NGWA 4NANA 2AGDA 3CKNA 2XWNA 1FGGA 4KC1A 1G97A 2WVKA 2QH5A 3U2TA 1O7OA 2RJ7A 4KQLA 3U0YA 2RJ5A 5C4BA 4EEGA 1TVYA 4J18A 3FOQA 1K4VA 4AAWA 1R7UA 4NAKA 3V0QA 5C3BA 5CQLX 4BQHA 1NF5B 2RJ4A 1FG5N 4KC2A 3CGXA 2VSIA 5IDSA 5C49A 2YCMA 3DUVA 3R2WA 2MZBA 2V0JA 5AJPA 1ZI5A 2YQCA 3V91A 5DDTA 4D48A 1VGUA 1FXOA 1O23B 2YESA 1MP3A 5HS2A 5FTSA 3JUJA 5FUHA 4Y62A 4FQWA 1MP4A 1H5SC 5CMHA 1H7LA 4KRVA 3T7OA 3SXBA 5EJZA 4CJCA 2RIXA 2ICXA 3GUEA 2AM5A 1W57A 1H7EA 1XHBA 3BCVA 1VICA 3D98A 1NMMB 4HO9A 5C36A 3CKVA 3U2UA 4Y63A 2ICYA 3OH2A 2JCJA 1YP2A 2RJ1A 3SXGA 3V0MA 1WT0A 1R7YA 2WGZA 4EE3A 5BXCA 3T7NA 5CQOA 1GQ9A 4JISA 3IOHA 3K8DA 3I0GA 2AE7A 2QGIA 1FO9A 1YP4A 1H5RA 2ZU9A 5FYEA 1LL0A 5CMIA 3F1YA 1QGQA 2VSHA 3JTJA 5J49A 1VGTA 5C1HA 1WT1A 4DDZA 1R7VA 4CJBA 3ZGFA 1LZ7A 4Y7TA 5C1LA 2V0LA 1ZI3A 1ZJOA 3EE5A 5DDVA 2BO6A 2O1GA 2E8BA 1E5KA 1G1LA 2D7RA 4HO3A 1MP5A 4NALA 1H7TA 1ZDGA 4FRPA 2VXMA 4B4MA 4HO8A 3SX3A 1IINA 4Y9XA 3SXDA 4AYLA 4KPZA 4Y6NA 1HJLA 3I0CA 1ZI4A 1PZTA 4FRHA 3I0DA 3CKOA 2RIYA 4D11C 5AJOA 2PA4A 3OH1A 1H4CA 3SXAA 3SX7A 5AJNA 3SXEA 2OI7A 3OH0A 5C4CA 5CMJA 2WAWA 1VH3A 1G8OA 1JVGA 1TW5A 2A8WA 1ZCYA 1VGZA 3KIAA 2DPWA 4HOCA 4DE7A 4FRMA 1S4PA 2FY7A 1Z90A 1ZCVA 2OEFA 3I0FA 3QVBA 1R7XA 3DK5A 4O6MA 4C2SA 2VD4A 4G3PA 3ZLKA 2RIZA 3OH3A 1V83A 1ON6A 1GX0A 1LZIA 4JD0A 3PKQA 1INIA 1WT2A 1NWGB 1IIMA 2FYAA 2Z86A 1WSZA 4P02A 3RMWA 1R82A 1GWWA 1FRWA 1TZFA 1FXJA 3FWWA 4M4KA 2FFUA 2V0HA 4ZDQA 4HO2A 5C3AA 3K8EA 3D8VA 1JV1A 3ST8A 1YP3A 2X5ZA 3DJ4A 4HO5A 1SS9A 4ARWA 2JCKA 1KWSA 2WEEA 2P73A 2RJ9A 3V0LA 2A8UA 2I5KA 2PX7A 1H4EA 4HG6A 4FROA 5CQMX 1ZDFA 2P72A 1ZJ3A 2AH9A 3SX8A 3V8ZA 4EE4A 2I7BA 3I0EA 5C38A 2RJ0A 1O7QA 2Q4JA 4B4BA 2APCA 1NQIB 1G0RA 1ZJPA 2P6WA 4KC4A 5C4DA 4R7PA 5EIYA 4Q7CA 2RITA 4M2BA 4EVWA 1GQCA 4Y7FA 4D0TA 2PGYA 2Y4KA 1GX4A 1FO8A 1FR9A 1S4NA 4KT7A 1O0RA 3I0IX 1VGWA 2WVMA 4HCQA 5FU8A 2W0WA 4K6RA 1GA8A 4LW3A 1G3LA 2OI5A 4D0ZA 2Y4LA 2FFVA 4IRQA 1TW1A 2W0VA 5C8RA 2BO8A 3CKJA 1JVDA 3N9WA 1HM9A 4P00A 1W77A 1H7QA 2V0KA 4MYBA 1I52A 2JCLA 3LW6A 1H7GA 1VZUA 3V0NA 4Y7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C47 A;  2Z87 A;  1H5T A;  4G87 A;  3USR A;  3I0J A;  5C48 A;  1LL2 A;  1ZHJ A;  4KPX A;  3BRK X;  3OAM A;  1VZX A;  2CU2 A;  3SPT A;  5C1G A;  2E3D A;  5IFY A;  1HV9 A;  2FYB A;  4YS8 A;  1ZCT A;  5FTV A;  4BMA A;  4M28 A;  1OMZ A;  3ZF8 A;  3E26 A;  4FRQ A;  1ZJ1 A;  1PZY B;  2WVL A;  3E25 A;  4NAI A;  1OQM B;  1JV3 A;  1LZJ A;  4ASJ A;  4E1K A;  1H5T B;  4B2X A;  4EE5 A;  3IOI A;  1MC3 A;  4Y64 A;  1LL3 A;  3Q7U A;  1G2V A;  4AYJ A;  1ZJ2 A;  4FCE A;  4CJ8 A;  5C3D A;  4B3U A;  4KNX A;  1EYR A;  1FWY A;  1VPA A;  4FRE A;  1LZ0 A;  2GGO A;  2ZU7 A;  1ZI1 A;  3SX5 A;  2I5E A;  2RJ6 A;  1H5S A;  2YQS A;  4KNR A;  3OGZ A;  4EEM A;  5I1F A;  2BO7 A;  2O1F A;  1H5S D;  2VFZ A;  5CMF X;  2VS4 A;  1QWJ A;  3PKP A;  2O1H A;  4FRL A;  2AES A;  4XWI A;  2Y4J A;  4M2A A;  1NHE B;  2FYC B;  3POL A;  4HO0 A;  4B2W A;  1HM8 A;  1G93 A;  4HO6 A;  1ZCU A;  2NXV A;  1HJJ A;  4L41 C;  3U2X A;  1H5S B;  2VS5 A;  4MND A;  3Q80 A;  3TZT A;  3R3I A;  4FCU A;  1YRO B;  4AC3 A;  1V84 A;  2VS3 A;  5CMG X;  2QKX A;  2V0I A;  4ASY A;  3I0H A;  4FRD A;  2YC5 A;  2YQH A;  1ON8 A;  1G9R A;  1GWV A;  1LVW A;  2AM3 A;  2Y4M A;  3RMV A;  1VH1 A;  3D5N A;  1HM0 A;  2XWM A;  2D7I A;  3OKR A;  1G95 A;  3U2V A;  1S4O A;  4FRA A;  2GGQ A;  4Y6U A;  3V0P A;  1INJ A;  2FYD B;  1H7F A;  2XWL A;  3IOJ A;  1VZT A;  1H4D A;  5C4E A;  2XME A;  1G23 A;  2XMH A;  1H7H A;  3I0K A;  4D11 A;  2AEC A;  3U2W A;  4Y7U A;  3PNN A;  5CQP A;  4FRB A;  1EZI A;  4ECM A;  1OMX A;  1ZJ0 A;  2X65 A;  3USQ A;  2AM4 A;  3TQD A;  1ZIZ A;  1FOA A;  5C4F A;  1R7T A;  4G3S A;  2YC3 A;  1FR8 A;  3HL3 A;  4KXO A;  1WT3 A;  1XZ6 A;  1JYL A;  3U0X A;  1WVC A;  2RJ8 A;  2Y6P A;  2D0J A;  2PGV A;  5CQN X;  5EJ1 A;  1R81 A;  1V82 A;  3O3P A;  3V90 A;  3SXC A;  1QG8 A;  2UX8 A;  5JQQ A;  2BO4 A;  4UEG A;  2JCO A;  3RSB A;  1R80 A;  2OEG A;  4LW6 A;  3F1C A;  4G3Q A;  5L6S A;  3CKQ A;  1NKH B;  3ZLL A;  3I0L A;  4EEA A;  5L6V A;  3JUK A;  1W55 A;  5FV9 A;  3ZGG A;  4B42 A;  1H5R B;  2Y7A A;  3Q4S A;  4HO4 A;  4Y7G A;  3CU0 A;  4DEC A;  3T7M A;  4IRP A;  4B5B A;  4B4G A;  1VM8 A;  5IDT A;  1FGX A;  3V8Y A;  1JYK A;  1QGS A;  4CVH A;  1H3M A;  4GBP A;  2WE9 A;  2X60 A;  1FZW A;  2OI6 A;  4EEO A;  3V0O A;  2X5S A;  2VXL A;  3OC9 A;  5FU0 A;  2YQJ A;  3OH4 A;  2ZU8 A;  3NGW A;  4NAN A;  2AGD A;  3CKN A;  2XWN A;  1FGG A;  4KC1 A;  1G97 A;  2WVK A;  2QH5 A;  3U2T A;  1O7O A;  2RJ7 A;  4KQL A;  3U0Y A;  2RJ5 A;  5C4B A;  4EEG A;  1TVY A;  4J18 A;  3FOQ A;  1K4V A;  4AAW A;  1R7U A;  4NAK A;  3V0Q A;  5C3B A;  5CQL X;  4BQH A;  1NF5 B;  2RJ4 A;  1FG5 N;  4KC2 A;  3CGX A;  2VSI A;  5IDS A;  5C49 A;  2YCM A;  3DUV A;  3R2W A;  2MZB A;  2V0J A;  5AJP A;  1ZI5 A;  2YQC A;  3V91 A;  5DDT A;  4D48 A;  1VGU A;  1FXO A;  1O23 B;  2YES A;  1MP3 A;  5HS2 A;  5FTS A;  3JUJ A;  5FUH A;  4Y62 A;  4FQW A;  1MP4 A;  1H5S C;  5CMH A;  1H7L A;  4KRV A;  3T7O A;  3SXB A;  5EJZ A;  4CJC A;  2RIX A;  2ICX A;  3GUE A;  2AM5 A;  1W57 A;  1H7E A;  1XHB A;  3BCV A;  1VIC A;  3D98 A;  1NMM B;  4HO9 A;  5C36 A;  3CKV A;  3U2U A;  4Y63 A;  2ICY A;  3OH2 A;  2JCJ A;  1YP2 A;  2RJ1 A;  3SXG A;  3V0M A;  1WT0 A;  1R7Y A;  2WGZ A;  4EE3 A;  5BXC A;  3T7N A;  5CQO A;  1GQ9 A;  4JIS A;  3IOH A;  3K8D A;  3I0G A;  2AE7 A;  2QGI A;  1FO9 A;  1YP4 A;  1H5R A;  2ZU9 A;  5FYE A;  1LL0 A;  5CMI A;  3F1Y A;  1QGQ A;  2VSH A;  3JTJ A;  5J49 A;  1VGT A;  5C1H A;  1WT1 A;  4DDZ A;  1R7V A;  4CJB A;  3ZGF A;  1LZ7 A;  4Y7T A;  5C1L A;  2V0L A;  1ZI3 A;  1ZJO A;  3EE5 A;  5DDV A;  2BO6 A;  2O1G A;  2E8B A;  1E5K A;  1G1L A;  2D7R A;  4HO3 A;  1MP5 A;  4NAL A;  1H7T A;  1ZDG A;  4FRP A;  2VXM A;  4B4M A;  4HO8 A;  3SX3 A;  1IIN A;  4Y9X A;  3SXD A;  4AYL A;  4KPZ A;  4Y6N A;  1HJL A;  3I0C A;  1ZI4 A;  1PZT A;  4FRH A;  3I0D A;  3CKO A;  2RIY A;  4D11 C;  5AJO A;  2PA4 A;  3OH1 A;  1H4C A;  3SXA A;  3SX7 A;  5AJN A;  3SXE A;  2OI7 A;  3OH0 A;  5C4C A;  5CMJ A;  2WAW A;  1VH3 A;  1G8O A;  1JVG A;  1TW5 A;  2A8W A;  1ZCY A;  1VGZ A;  3KIA A;  2DPW A;  4HOC A;  4DE7 A;  4FRM A;  1S4P A;  2FY7 A;  1Z90 A;  1ZCV A;  2OEF A;  3I0F A;  3QVB A;  1R7X A;  3DK5 A;  4C2S A;  2VD4 A;  4G3P A;  3ZLK A;  2RIZ A;  3OH3 A;  1V83 A;  1ON6 A;  1GX0 A;  1LZI A;  4JD0 A;  3PKQ A;  1INI A;  1WT2 A;  1NWG B;  1IIM A;  2FYA A;  2Z86 A;  1WSZ A;  4P02 A;  3RMW A;  1R82 A;  1GWW A;  1FRW A;  1TZF A;  1FXJ A;  3FWW A;  4M4K A;  2FFU A;  2V0H A;  4ZDQ A;  4HO2 A;  5C3A A;  3K8E A;  3D8V A;  1JV1 A;  3ST8 A;  1YP3 A;  2X5Z A;  3DJ4 A;  4HO5 A;  1SS9 A;  4ARW A;  2JCK A;  1KWS A;  2WEE A;  2P73 A;  2RJ9 A;  3V0L A;  2A8U A;  2I5K A;  2PX7 A;  1H4E A;  4HG6 A;  4FRO A;  5CQM X;  1ZDF A;  2P72 A;  1ZJ3 A;  2AH9 A;  3SX8 A;  3V8Z A;  4EE4 A;  2I7B A;  3I0E A;  5C38 A;  2RJ0 A;  1O7Q A;  2Q4J A;  4B4B A;  2APC A;  1NQI B;  1G0R A;  1ZJP A;  2P6W A;  4KC4 A;  5C4D A;  4R7P A;  5EIY A;  2RIT A;  4M2B A;  4EVW A;  1GQC A;  4Y7F A;  4D0T A;  2PGY A;  2Y4K A;  1GX4 A;  1FO8 A;  1FR9 A;  1S4N A;  4KT7 A;  1O0R A;  3I0I X;  1VGW A;  2WVM A;  4HCQ A;  5FU8 A;  2W0W A;  4K6R A;  1GA8 A;  4LW3 A;  1G3L A;  2OI5 A;  4D0Z A;  2Y4L A;  2FFV A;  4IRQ A;  1TW1 A;  2W0V A;  5C8R A;  2BO8 A;  3CKJ A;  1JVD A;  3N9W A;  1HM9 A;  4P00 A;  1W77 A;  1H7Q A;  2V0K A;  4MYB A;  1I52 A;  2JCL A;  3LW6 A;  1H7G A;  1VZU A;  3V0N A;  4Y7V A; 
#chains in the Genus database with same CATH topology
 5C47 A;  2Z87 A;  1H5T A;  4FIX A;  4G87 A;  3USR A;  3I0J A;  5C48 A;  1LL2 A;  1ZHJ A;  4KPX A;  3BRK X;  3OAM A;  1VZX A;  2CU2 A;  2J0B A;  3SPT A;  5D92 A;  5C1G A;  2E3D A;  5IFY A;  1HV9 A;  2FYB A;  4YS8 A;  1ZCT A;  5FTV A;  4BMA A;  4M28 A;  1OMZ A;  3ZF8 A;  3E26 A;  4FRQ A;  1ZJ1 A;  1PZY B;  2WVL A;  3E25 A;  4NAI A;  1OQM B;  1JV3 A;  1LZJ A;  4ASJ A;  4E1K A;  2J0A A;  2VK9 A;  1H5T B;  4B2X A;  4EE5 A;  3IOI A;  1MC3 A;  4Y64 A;  5D91 A;  1LL3 A;  3Q7U A;  1G2V A;  4AYJ A;  1ZJ2 A;  4FCE A;  4CJ8 A;  5C3D A;  4B3U A;  4KNX A;  1EYR A;  1FWY A;  1VPA A;  4FRE A;  1LZ0 A;  2GGO A;  2ZU7 A;  1ZI1 A;  3SX5 A;  2I5E A;  2RJ6 A;  1H5S A;  2YQS A;  4KNR A;  3OGZ A;  4EEM A;  5I1F A;  2BO7 A;  2O1F A;  1H5S D;  2VFZ A;  5CMF X;  2VS4 A;  1QWJ A;  3PKP A;  2O1H A;  4FRL A;  2AES A;  4XWI A;  2Y4J A;  4M2A A;  1NHE B;  2FYC B;  3POL A;  4HO0 A;  4B2W A;  1HM8 A;  1G93 A;  4HO6 A;  1ZCU A;  2NXV A;  1HJJ A;  4L41 C;  3U2X A;  1H5S B;  2VS5 A;  4MND A;  3Q80 A;  3TZT A;  3R3I A;  4FCU A;  1YRO B;  4AC3 A;  1V84 A;  2VS3 A;  5CMG X;  2QKX A;  2V0I A;  4ASY A;  3I0H A;  4FRD A;  2YC5 A;  2YQH A;  1ON8 A;  1G9R A;  1GWV A;  1LVW A;  2AM3 A;  2Y4M A;  3RMV A;  1VH1 A;  3D5N A;  1HM0 A;  2XWM A;  2D7I A;  3OKR A;  1G95 A;  3U2V A;  1S4O A;  4FRA A;  2GGQ A;  4Y6U A;  3V0P A;  1INJ A;  2FYD B;  1H7F A;  2XWL A;  3IOJ A;  1VZT A;  1H4D A;  5C4E A;  2XME A;  1G23 A;  2XMH A;  1H7H A;  3I0K A;  4D11 A;  2AEC A;  3U2W A;  4Y7U A;  3PNN A;  5CQP A;  4FRB A;  1EZI A;  2C0N A;  4ECM A;  1OMX A;  1ZJ0 A;  2X65 A;  3USQ A;  2AM4 A;  3TQD A;  1ZIZ A;  1FOA A;  5C4F A;  1R7T A;  4G3S A;  2YC3 A;  1FR8 A;  3HL3 A;  4KXO A;  1WT3 A;  1XZ6 A;  1JYL A;  3U0X A;  1WVC A;  2RJ8 A;  2Y6P A;  2D0J A;  2PGV A;  5CQN X;  5EJ1 A;  1R81 A;  1V82 A;  3O3P A;  3V90 A;  3SXC A;  1QG8 A;  2UX8 A;  5JQQ A;  2BO4 A;  4UEG A;  2JCO A;  3RSB A;  1R80 A;  2OEG A;  4LW6 A;  3F1C A;  4G3Q A;  5L6S A;  3CKQ A;  1NKH B;  3ZLL A;  3I0L A;  4EEA A;  4O6N A;  5L6V A;  3JUK A;  1W55 A;  5FV9 A;  3ZGG A;  4B42 A;  1H5R B;  2Y7A A;  3Q4S A;  4HO4 A;  4Y7G A;  3CU0 A;  4DEC A;  3T7M A;  4IRP A;  4MIX A;  4B5B A;  4B4G A;  1VM8 A;  5IDT A;  1FGX A;  3V8Y A;  4FIY A;  1JYK A;  1QGS A;  4CVH A;  1H3M A;  4GBP A;  2WE9 A;  2X60 A;  1FZW A;  2OI6 A;  4EEO A;  3V0O A;  2X5S A;  2VXL A;  3OC9 A;  5FU0 A;  2YQJ A;  3OH4 A;  2ZU8 A;  3NGW A;  4NAN A;  2AGD A;  3CKN A;  2XWN A;  1FGG A;  4KC1 A;  1G97 A;  2WVK A;  2QH5 A;  3U2T A;  1O7O A;  2RJ7 A;  4KQL A;  3U0Y A;  2RJ5 A;  5C4B A;  4EEG A;  1TVY A;  4J18 A;  3FOQ A;  1K4V A;  4AAW A;  1R7U A;  4NAK A;  3V0Q A;  5C3B A;  5CQL X;  4BQH A;  1NF5 B;  2RJ4 A;  1FG5 N;  4KC2 A;  3CGX A;  2VSI A;  5IDS A;  5C49 A;  2YCM A;  3DUV A;  3R2W A;  2MZB A;  2V0J A;  5AJP A;  1ZI5 A;  2YQC A;  3V91 A;  5DDT A;  4D48 A;  1VGU A;  1FXO A;  1O23 B;  2YES A;  1MP3 A;  5HS2 A;  5FTS A;  3JUJ A;  5FUH A;  4Y62 A;  4FQW A;  1MP4 A;  1H5S C;  5CMH A;  1H7L A;  4KRV A;  3T7O A;  3SXB A;  5EJZ A;  4CJC A;  2RIX A;  2ICX A;  3GUE A;  2AM5 A;  1W57 A;  1H7E A;  1XHB A;  3BCV A;  1VIC A;  3D98 A;  1NMM B;  4HO9 A;  5C36 A;  3CKV A;  3U2U A;  4Y63 A;  2ICY A;  3OH2 A;  2JCJ A;  1YP2 A;  2RJ1 A;  3SXG A;  3V0M A;  1WT0 A;  1R7Y A;  2WGZ A;  4EE3 A;  5BXC A;  3T7N A;  5CQO A;  1GQ9 A;  4JIS A;  3IOH A;  3K8D A;  3I0G A;  2AE7 A;  2QGI A;  1FO9 A;  1YP4 A;  1H5R A;  2ZU9 A;  5FYE A;  1LL0 A;  5CMI A;  3F1Y A;  1QGQ A;  2VSH A;  3JTJ A;  5J49 A;  1VGT A;  5C1H A;  1WT1 A;  4DDZ A;  1R7V A;  4CJB A;  3ZGF A;  1LZ7 A;  4Y7T A;  5C1L A;  2V0L A;  1ZI3 A;  1ZJO A;  3EE5 A;  5DDV A;  2BO6 A;  2O1G A;  2E8B A;  1E5K A;  1G1L A;  2D7R A;  4HO3 A;  1MP5 A;  4NAL A;  1H7T A;  1ZDG A;  4FRP A;  2VXM A;  4B4M A;  4HO8 A;  3SX3 A;  1IIN A;  4Y9X A;  3SXD A;  4AYL A;  4KPZ A;  4Y6N A;  1HJL A;  3I0C A;  1ZI4 A;  1PZT A;  4FRH A;  3I0D A;  3CKO A;  2RIY A;  4D11 C;  5AJO A;  2PA4 A;  3OH1 A;  1H4C A;  3SXA A;  3SX7 A;  5AJN A;  3SXE A;  2OI7 A;  3OH0 A;  5C4C A;  5CMJ A;  2WAW A;  1VH3 A;  1G8O A;  1JVG A;  1TW5 A;  2A8W A;  1ZCY A;  1VGZ A;  3KIA A;  2DPW A;  4HOC A;  4DE7 A;  4FRM A;  1S4P A;  2FY7 A;  1Z90 A;  1ZCV A;  2OEF A;  3I0F A;  3QVB A;  1R7X A;  3DK5 A;  4O6M A;  4C2S A;  2VD4 A;  4G3P A;  3ZLK A;  2RIZ A;  3OH3 A;  1V83 A;  1ON6 A;  1GX0 A;  1LZI A;  4JD0 A;  3PKQ A;  1INI A;  1WT2 A;  1NWG B;  1IIM A;  2FYA A;  2Z86 A;  1WSZ A;  4P02 A;  3RMW A;  1R82 A;  1GWW A;  1FRW A;  1TZF A;  1FXJ A;  3FWW A;  4M4K A;  2FFU A;  2V0H A;  4ZDQ A;  4HO2 A;  5C3A A;  3K8E A;  3D8V A;  1JV1 A;  3ST8 A;  1YP3 A;  2X5Z A;  3DJ4 A;  4HO5 A;  1SS9 A;  4ARW A;  2JCK A;  1KWS A;  2WEE A;  2P73 A;  2RJ9 A;  3V0L A;  2A8U A;  2I5K A;  2PX7 A;  1H4E A;  4HG6 A;  4FRO A;  5CQM X;  1ZDF A;  2P72 A;  1ZJ3 A;  2AH9 A;  3SX8 A;  3V8Z A;  4EE4 A;  2I7B A;  3I0E A;  5C38 A;  2RJ0 A;  1O7Q A;  2Q4J A;  4B4B A;  2APC A;  1NQI B;  1G0R A;  1ZJP A;  2P6W A;  4KC4 A;  5C4D A;  4R7P A;  5EIY A;  4Q7C A;  2RIT A;  4M2B A;  4EVW A;  1GQC A;  4Y7F A;  4D0T A;  2PGY A;  2Y4K A;  1GX4 A;  1FO8 A;  1FR9 A;  1S4N A;  4KT7 A;  1O0R A;  3I0I X;  1VGW A;  2WVM A;  4HCQ A;  5FU8 A;  2W0W A;  4K6R A;  1GA8 A;  4LW3 A;  1G3L A;  2OI5 A;  4D0Z A;  2Y4L A;  2FFV A;  4IRQ A;  1TW1 A;  2W0V A;  5C8R A;  2BO8 A;  3CKJ A;  1JVD A;  3N9W A;  1HM9 A;  4P00 A;  1W77 A;  1H7Q A;  2V0K A;  4MYB A;  1I52 A;  2JCL A;  3LW6 A;  1H7G A;  1VZU A;  3V0N A;  4Y7V A; 
#chains in the Genus database with same CATH homology
 5C47 A;  2Z87 A;  1H5T A;  4FIX A;  4G87 A;  3USR A;  3I0J A;  5C48 A;  1LL2 A;  1ZHJ A;  4KPX A;  3BRK X;  3OAM A;  1VZX A;  2CU2 A;  2J0B A;  3SPT A;  5D92 A;  5C1G A;  2E3D A;  5IFY A;  1HV9 A;  2FYB A;  4YS8 A;  1ZCT A;  5FTV A;  4BMA A;  4M28 A;  1OMZ A;  3ZF8 A;  3E26 A;  4FRQ A;  1ZJ1 A;  1PZY B;  2WVL A;  3E25 A;  4NAI A;  1OQM B;  1JV3 A;  1LZJ A;  4ASJ A;  4E1K A;  2J0A A;  2VK9 A;  1H5T B;  4B2X A;  4EE5 A;  3IOI A;  1MC3 A;  4Y64 A;  5D91 A;  1LL3 A;  3Q7U A;  1G2V A;  4AYJ A;  1ZJ2 A;  4FCE A;  4CJ8 A;  5C3D A;  4B3U A;  4KNX A;  1EYR A;  1FWY A;  1VPA A;  4FRE A;  1LZ0 A;  2GGO A;  2ZU7 A;  1ZI1 A;  3SX5 A;  2I5E A;  2RJ6 A;  1H5S A;  2YQS A;  4KNR A;  3OGZ A;  4EEM A;  5I1F A;  2BO7 A;  2O1F A;  1H5S D;  2VFZ A;  5CMF X;  2VS4 A;  1QWJ A;  3PKP A;  2O1H A;  4FRL A;  2AES A;  4XWI A;  2Y4J A;  4M2A A;  1NHE B;  2FYC B;  3POL A;  4HO0 A;  4B2W A;  1HM8 A;  1G93 A;  4HO6 A;  1ZCU A;  2NXV A;  1HJJ A;  4L41 C;  3U2X A;  1H5S B;  2VS5 A;  4MND A;  3Q80 A;  3TZT A;  3R3I A;  4FCU A;  1YRO B;  4AC3 A;  1V84 A;  2VS3 A;  5CMG X;  2QKX A;  2V0I A;  4ASY A;  3I0H A;  4FRD A;  2YC5 A;  2YQH A;  1ON8 A;  1G9R A;  1GWV A;  1LVW A;  2AM3 A;  2Y4M A;  3RMV A;  1VH1 A;  3D5N A;  1HM0 A;  2XWM A;  2D7I A;  3OKR A;  1G95 A;  3U2V A;  1S4O A;  4FRA A;  2GGQ A;  4Y6U A;  3V0P A;  1INJ A;  2FYD B;  1H7F A;  2XWL A;  3IOJ A;  1VZT A;  1H4D A;  5C4E A;  2XME A;  1G23 A;  2XMH A;  1H7H A;  3I0K A;  4D11 A;  2AEC A;  3U2W A;  4Y7U A;  3PNN A;  5CQP A;  4FRB A;  1EZI A;  2C0N A;  4ECM A;  1OMX A;  1ZJ0 A;  2X65 A;  3USQ A;  2AM4 A;  3TQD A;  1ZIZ A;  1FOA A;  5C4F A;  1R7T A;  4G3S A;  2YC3 A;  1FR8 A;  3HL3 A;  4KXO A;  1WT3 A;  1XZ6 A;  1JYL A;  3U0X A;  1WVC A;  2RJ8 A;  2Y6P A;  2D0J A;  2PGV A;  5CQN X;  5EJ1 A;  1R81 A;  1V82 A;  3O3P A;  3V90 A;  3SXC A;  1QG8 A;  2UX8 A;  5JQQ A;  2BO4 A;  4UEG A;  2JCO A;  3RSB A;  1R80 A;  2OEG A;  4LW6 A;  3F1C A;  4G3Q A;  5L6S A;  3CKQ A;  1NKH B;  3ZLL A;  3I0L A;  4EEA A;  4O6N A;  5L6V A;  3JUK A;  1W55 A;  5FV9 A;  3ZGG A;  4B42 A;  1H5R B;  2Y7A A;  3Q4S A;  4HO4 A;  4Y7G A;  3CU0 A;  4DEC A;  3T7M A;  4IRP A;  4MIX A;  4B5B A;  4B4G A;  1VM8 A;  5IDT A;  1FGX A;  3V8Y A;  4FIY A;  1JYK A;  1QGS A;  4CVH A;  1H3M A;  4GBP A;  2WE9 A;  2X60 A;  1FZW A;  2OI6 A;  4EEO A;  3V0O A;  2X5S A;  2VXL A;  3OC9 A;  5FU0 A;  2YQJ A;  3OH4 A;  2ZU8 A;  3NGW A;  4NAN A;  2AGD A;  3CKN A;  2XWN A;  1FGG A;  4KC1 A;  1G97 A;  2WVK A;  2QH5 A;  3U2T A;  1O7O A;  2RJ7 A;  4KQL A;  3U0Y A;  2RJ5 A;  5C4B A;  4EEG A;  1TVY A;  4J18 A;  3FOQ A;  1K4V A;  4AAW A;  1R7U A;  4NAK A;  3V0Q A;  5C3B A;  5CQL X;  4BQH A;  1NF5 B;  2RJ4 A;  1FG5 N;  4KC2 A;  3CGX A;  2VSI A;  5IDS A;  5C49 A;  2YCM A;  3DUV A;  3R2W A;  2MZB A;  2V0J A;  5AJP A;  1ZI5 A;  2YQC A;  3V91 A;  5DDT A;  4D48 A;  1VGU A;  1FXO A;  1O23 B;  2YES A;  1MP3 A;  5HS2 A;  5FTS A;  3JUJ A;  5FUH A;  4Y62 A;  4FQW A;  1MP4 A;  1H5S C;  5CMH A;  1H7L A;  4KRV A;  3T7O A;  3SXB A;  5EJZ A;  4CJC A;  2RIX A;  2ICX A;  3GUE A;  2AM5 A;  1W57 A;  1H7E A;  1XHB A;  3BCV A;  1VIC A;  3D98 A;  1NMM B;  4HO9 A;  5C36 A;  3CKV A;  3U2U A;  4Y63 A;  2ICY A;  3OH2 A;  2JCJ A;  1YP2 A;  2RJ1 A;  3SXG A;  3V0M A;  1WT0 A;  1R7Y A;  2WGZ A;  4EE3 A;  5BXC A;  3T7N A;  5CQO A;  1GQ9 A;  4JIS A;  3IOH A;  3K8D A;  3I0G A;  2AE7 A;  2QGI A;  1FO9 A;  1YP4 A;  1H5R A;  2ZU9 A;  5FYE A;  1LL0 A;  5CMI A;  3F1Y A;  1QGQ A;  2VSH A;  3JTJ A;  5J49 A;  1VGT A;  5C1H A;  1WT1 A;  4DDZ A;  1R7V A;  4CJB A;  3ZGF A;  1LZ7 A;  4Y7T A;  5C1L A;  2V0L A;  1ZI3 A;  1ZJO A;  3EE5 A;  5DDV A;  2BO6 A;  2O1G A;  2E8B A;  1E5K A;  1G1L A;  2D7R A;  4HO3 A;  1MP5 A;  4NAL A;  1H7T A;  1ZDG A;  4FRP A;  2VXM A;  4B4M A;  4HO8 A;  3SX3 A;  1IIN A;  4Y9X A;  3SXD A;  4AYL A;  4KPZ A;  4Y6N A;  1HJL A;  3I0C A;  1ZI4 A;  1PZT A;  4FRH A;  3I0D A;  3CKO A;  2RIY A;  4D11 C;  5AJO A;  2PA4 A;  3OH1 A;  1H4C A;  3SXA A;  3SX7 A;  5AJN A;  3SXE A;  2OI7 A;  3OH0 A;  5C4C A;  5CMJ A;  2WAW A;  1VH3 A;  1G8O A;  1JVG A;  1TW5 A;  2A8W A;  1ZCY A;  1VGZ A;  3KIA A;  2DPW A;  4HOC A;  4DE7 A;  4FRM A;  1S4P A;  2FY7 A;  1Z90 A;  1ZCV A;  2OEF A;  3I0F A;  3QVB A;  1R7X A;  3DK5 A;  4O6M A;  4C2S A;  2VD4 A;  4G3P A;  3ZLK A;  2RIZ A;  3OH3 A;  1V83 A;  1ON6 A;  1GX0 A;  1LZI A;  4JD0 A;  3PKQ A;  1INI A;  1WT2 A;  1NWG B;  1IIM A;  2FYA A;  2Z86 A;  1WSZ A;  4P02 A;  3RMW A;  1R82 A;  1GWW A;  1FRW A;  1TZF A;  1FXJ A;  3FWW A;  4M4K A;  2FFU A;  2V0H A;  4ZDQ A;  4HO2 A;  5C3A A;  3K8E A;  3D8V A;  1JV1 A;  3ST8 A;  1YP3 A;  2X5Z A;  3DJ4 A;  4HO5 A;  1SS9 A;  4ARW A;  2JCK A;  1KWS A;  2WEE A;  2P73 A;  2RJ9 A;  3V0L A;  2A8U A;  2I5K A;  2PX7 A;  1H4E A;  4HG6 A;  4FRO A;  5CQM X;  1ZDF A;  2P72 A;  1ZJ3 A;  2AH9 A;  3SX8 A;  3V8Z A;  4EE4 A;  2I7B A;  3I0E A;  5C38 A;  2RJ0 A;  1O7Q A;  2Q4J A;  4B4B A;  2APC A;  1NQI B;  1G0R A;  1ZJP A;  2P6W A;  4KC4 A;  5C4D A;  4R7P A;  5EIY A;  4Q7C A;  2RIT A;  4M2B A;  4EVW A;  1GQC A;  4Y7F A;  4D0T A;  2PGY A;  2Y4K A;  1GX4 A;  1FO8 A;  1FR9 A;  1S4N A;  4KT7 A;  1O0R A;  3I0I X;  1VGW A;  2WVM A;  4HCQ A;  5FU8 A;  2W0W A;  4K6R A;  1GA8 A;  4LW3 A;  1G3L A;  2OI5 A;  4D0Z A;  2Y4L A;  2FFV A;  4IRQ A;  1TW1 A;  2W0V A;  5C8R A;  2BO8 A;  3CKJ A;  1JVD A;  3N9W A;  1HM9 A;  4P00 A;  1W77 A;  1H7Q A;  2V0K A;  4MYB A;  1I52 A;  2JCL A;  3LW6 A;  1H7G A;  1VZU A;  3V0N A;  4Y7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...