2JCOA

Crystal structure of wild type alpha-1,3 galactosyltransferase in the absence of ligands
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
277
structure length
277
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYL TRANSFERASE
publication title Conformational Changes Induced by Binding Udp-2F-Galactose to Alpha-1,3 Galactosyltransferase-Implications for Catalysis.
pubmed doi rcsb
source organism Bos taurus
total genus 89
structure length 277
sequence length 277
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2006-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2jcoA00
2RIXA 4HOCA 3SXGA 1FXJA 4Y6NA 2WEEA 1FO8A 2RJ9A 2YQJA 1HJJA 2RIZA 1ZJ2A 2QH5A 3IOHA 3N9WA 4FRLA 4LW6A 1VGZA 3TZTA 1XHBA 1GQ9A 3OKRA 2AH9A 1MC3A 5AJPA 3U2WA 2YQHA 1K4VA 1G2VA 5CQLX 2WVKA 3DJ4A 4Y7VA 1VZTA 3OC9A 2RITA 1H5RA 2YC3A 1H4DA 1ZHJA 4MYBA 3SPTA 2XMHA 3SX5A 1H4EA 2Y4KA 4HO4A 4BQHA 4KNRA 1FOAA 2BO8A 1ON6A 2AM5A 4ECMA 1WVCA 2A8WA 2VSHA 2Y4LA 2XWMA 3ST8A 4B5BA 2V0JA 5C8RA 4Y6UA 1ZDFA 5FTSA 2NXVA 3U2UA 1V82A 3BRKX 2O1HA 1FXOA 3V0NA 1TZFA 2X5SA 4FRDA 2P72A 3I0LA 1G8OA 3I0JA 3V0LA 4NANA 5CMIA 3V0MA 2Q4JA 1MP3A 3OH2A 1LZ0A 4E1KA 2RJ0A 4G87A 2JCJA 4FROA 4M2AA 4Y7GA 2YCMA 1G95A 1VM8A 3T7OA 4BMAA 1QGSA 5C3BA 2PX7A 1R80A 3Q4SA 3I0HA 4XWIA 1NMMB 4HG6A 3SXBA 3I0FA 1SS9A 1O7OA 5C3DA 3SXEA 1H5SB 2A8UA 2WAWA 2I5KA 4HO6A 1GA8A 4NALA 4GBPA 3SX3A 5C36A 4M2BA 1JVGA 2O1GA 2FFVA 1JVDA 4HO8A 4D11C 3CU0A 2OI5A 3USQA 2Z86A 5FYEA 3EE5A 1VGUA 4KC1A 3R2WA 2X60A 4IRPA 3I0DA 1LZJA 3KIAA 2WVMA 1YP3A 4CJCA 3K8DA 1MP4A 5CMHA 1INJA 3OGZA 3I0GA 1MP5A 1VZUA 3F1YA 2OEFA 2ICXA 4HO2A 4UEGA 4DE7A 2D7RA 2ZU9A 3BCVA 1R7TA 3T7MA 5EJ1A 1NWGB 1G93A 5C1LA 1OMXA 2OI6A 2GGOA 3O3PA 4FRAA 3OH4A 1H5TB 4D11A 1GWVA 2RJ6A 2FYBA 1VICA 4J18A 5C4BA 4M28A 5C4CA 1FO9A 1TVYA 4DDZA 4R7PA 1JV3A 1ZCTA 3RMVA 5EJZA 2V0LA 5C1GA 4B2WA 4Y64A 4FRBA 3T7NA 1YP2A 3ZGFA 2FFUA 5FU8A 5CQNX 4Y9XA 5CMJA 4NAIA 4B2XA 1Z90A 4HO5A 3I0KA 4G3PA 4EEOA 1FZWA 3IOIA 5DDTA 4FRQA 2WVLA 4KC2A 1FG5N 1ZCVA 2AM3A 2X5ZA 3JUJA 1ZI4A 4Y7UA 1VGTA 3TQDA 5C4FA 1R7UA 1QG8A 1H7GA 2X65A 4ZDQA 4D0ZA 1HV9A 4B4BA 1INIA 1VPAA 1QWJA 3FOQA 4EE3A 2ZU7A 2PA4A 1NF5B 3HL3A 3RMWA 4HCQA 4B42A 1R7YA 1TW5A 3ZGGA 1FGXA 1G23A 3RSBA 1WSZA 1HJLA 2FYCB 3Q80A 3CKQA 2MZBA 1OQMB 2JCOA 5CQOA 2PGYA 4CJ8A 2RJ8A 1H7TA 2YC5A 3DUVA 2AESA 2WGZA 1WT1A 5BXCA 2AGDA 2WE9A 3USRA 2VFZA 4K6RA 4LW3A 3JTJA 1GX0A 2ZU8A 4YS8A 4KC4A 2W0WA 4AC3A 4JISA 2Y4MA 4KPZA 2Y4JA 1VZXA 3U2TA 2Y7AA 2XWLA 3POLA 3Q7UA 4FRMA 5C4EA 1W57A 2P73A 4Y63A 4P02A 1H5TA 3U2VA 1ZCYA 1GQCA 2YESA 4EE4A 4KPXA 1NQIB 1ZI5A 1H7HA 1HM8A 1ZI3A 3I0CA 4JD0A 3F1CA 2RIYA 4EEAA 5L6VA 1S4OA 5C4DA 4B4MA 1H5RB 1ZIZA 5C48A 1R7XA 1E5KA 1IIMA 1KWSA 1G0RA 5FV9A 2VS4A 2XMEA 3R3IA 2VS3A 1WT3A 3PKQA 3V90A 1PZYB 4EEGA 2CU2A 1LZ7A 3SXDA 2RJ7A 2UX8A 3PNNA 1WT2A 1YP4A 3NGWA 3D98A 1H7LA 2QGIA 1ZDGA 5C1HA 1H5SC 4Y7FA 5C38A 4EE5A 2YQCA 4D0TA 1IINA 4G3SA 5HS2A 1ZJPA 3U0YA 4AYLA 1G9RA 2PGVA 5CMFX 2BO4A 5J49A 2E8BA 1ZJ0A 1JYKA 5C47A 4FQWA 3U2XA 5FUHA 1FR9A 1VH1A 2O1FA 1JV1A 2YQSA 3LW6A 1GX4A 1GWWA 2VXLA 2AE7A 1O0RA 1ZJ1A 2V0IA 3V8YA 3GUEA 2OI7A 1H4CA 4HO3A 1FRWA 1S4PA 3SXAA 3CKNA 4Y7TA 5C49A 2V0HA 3FWWA 2Z87A 4G3QA 2VD4A 1H5SA 2AECA 3OH3A 1FWYA 5L6SA 4L41C 4KRVA 2QKXA 1NKHB 4HO0A 5AJNA 5DDVA 5JQQA 4M4KA 5IFYA 2AM4A 1G1LA 4B3UA 1EYRA 4KXOA 2RJ5A 1H7FA 5FU0A 2I7BA 4KQLA 4CVHA 4NAKA 1TW1A 4ASJA 3CGXA 5EIYA 1G3LA 2APCA 1H7EA 4FREA 5IDTA 2E3DA 2V0KA 2JCLA 1ZJ3A 4FRPA 5CQPA 1HM0A 3I0IX 2FYAA 1LL3A 1FR8A 2RJ1A 3CKOA 3SX8A 3K8EA 3ZLKA 2VXMA 3JUKA 4KNXA 1LVWA 2D0JA 4CJBA 1ZJOA 1ON8A 2FYDB 1LZIA 4EVWA 1VH3A 3E26A 4C2SA 4DECA 3SXCA 2D7IA 2DPWA 4KT7A 3QVBA 4P00A 3CKJA 1PZTA 1ZCUA 2BO7A 4Y62A 5C3AA 4EEMA 4FCUA 1V84A 1R81A 4D48A 1XZ6A 4FRHA 3SX7A 2ICYA 3V91A 2XWNA 2FY7A 1EZIA 3V0OA 4FCEA 1QGQA 5CQMX 2P6WA 1LL2A 1W77A 3OH1A 2VS5A 1FGGA 3U0XA 1O23B 5I1FA 5AJOA 4AYJA 2VSIA 5IDSA 1ZI1A 1H7QA 4ARWA 1S4NA 4AAWA 3OH0A 1I52A 1YROB 1W55A 2Y6PA 4IRQA 3CKVA 3D5NA 2JCKA 3V0PA 1R7VA 3E25A 5CMGX 3DK5A 5FTVA 4ASYA 1V83A 2GGQA 2W0VA 3ZLLA 1HM9A 4HO9A 3OAMA 3D8VA 2BO6A 1H3MA 1JYLA 4B4GA 1H5SD 3ZF8A 2I5EA 3V8ZA 1WT0A 1NHEB 1O7QA 3PKPA 3V0QA 2RJ4A 1R82A 1OMZA 4MNDA 3IOJA 1G97A 1VGWA 3I0EA 1LL0A 2OEGA
chains in the Genus database with same CATH superfamily
2RIXA 4HOCA 3SXGA 1FXJA 4Y6NA 2WEEA 1FO8A 2RJ9A 2YQJA 1HJJA 2RIZA 1ZJ2A 2QH5A 3IOHA 3N9WA 4FRLA 4LW6A 1VGZA 3TZTA 1XHBA 1GQ9A 3OKRA 4O6NA 2AH9A 1MC3A 5AJPA 3U2WA 2YQHA 1K4VA 1G2VA 5CQLX 2WVKA 3DJ4A 4Y7VA 1VZTA 3OC9A 2RITA 1H5RA 4Q7CA 2YC3A 1H4DA 1ZHJA 4MYBA 3SPTA 2XMHA 3SX5A 1H4EA 2Y4KA 4HO4A 4BQHA 4KNRA 4FIYA 1FOAA 2BO8A 1ON6A 2AM5A 4ECMA 1WVCA 2A8WA 2VSHA 2Y4LA 2XWMA 3ST8A 4B5BA 2V0JA 5C8RA 4Y6UA 1ZDFA 5FTSA 2NXVA 3U2UA 1V82A 3BRKX 2O1HA 1FXOA 3V0NA 1TZFA 2X5SA 4FRDA 2P72A 3I0LA 1G8OA 3I0JA 3V0LA 4NANA 5CMIA 3V0MA 2Q4JA 1MP3A 3OH2A 1LZ0A 4E1KA 2RJ0A 4G87A 2JCJA 4FROA 4M2AA 4Y7GA 2YCMA 1G95A 1VM8A 3T7OA 4BMAA 1QGSA 5C3BA 2PX7A 1R80A 3Q4SA 3I0HA 4XWIA 1NMMB 4HG6A 3SXBA 3I0FA 1SS9A 1O7OA 5C3DA 3SXEA 1H5SB 2A8UA 2WAWA 2I5KA 4HO6A 4MIXA 1GA8A 4NALA 4GBPA 3SX3A 5C36A 4M2BA 1JVGA 2O1GA 2FFVA 1JVDA 4HO8A 4D11C 3CU0A 2OI5A 4O6MA 3USQA 2Z86A 5FYEA 3EE5A 1VGUA 4KC1A 3R2WA 2X60A 4IRPA 3I0DA 1LZJA 3KIAA 2WVMA 1YP3A 4CJCA 3K8DA 1MP4A 5CMHA 1INJA 3OGZA 3I0GA 1MP5A 1VZUA 3F1YA 2OEFA 2ICXA 4HO2A 4UEGA 4DE7A 2D7RA 2ZU9A 3BCVA 1R7TA 3T7MA 5EJ1A 1NWGB 1G93A 5C1LA 1OMXA 2OI6A 2GGOA 3O3PA 4FRAA 3OH4A 1H5TB 4D11A 1GWVA 2RJ6A 2FYBA 1VICA 4J18A 5C4BA 4M28A 5C4CA 1FO9A 1TVYA 4DDZA 4R7PA 1JV3A 1ZCTA 3RMVA 5EJZA 2V0LA 5C1GA 4B2WA 4Y64A 4FRBA 3T7NA 1YP2A 3ZGFA 2FFUA 2VK9A 5CQNX 5FU8A 4Y9XA 5CMJA 4NAIA 4B2XA 1Z90A 4HO5A 3I0KA 4G3PA 4EEOA 1FZWA 3IOIA 5DDTA 2J0BA 4FRQA 2WVLA 4KC2A 1FG5N 1ZCVA 2AM3A 2X5ZA 3JUJA 1ZI4A 4Y7UA 1VGTA 3TQDA 5C4FA 1R7UA 1QG8A 1H7GA 2X65A 4ZDQA 4D0ZA 1HV9A 4B4BA 1INIA 1VPAA 1QWJA 3FOQA 4EE3A 2ZU7A 2PA4A 1NF5B 3HL3A 3RMWA 4HCQA 4B42A 1R7YA 1TW5A 3ZGGA 1FGXA 1G23A 3RSBA 1WSZA 1HJLA 2FYCB 3Q80A 3CKQA 2MZBA 1OQMB 2JCOA 5CQOA 2PGYA 4CJ8A 2RJ8A 1H7TA 2YC5A 3DUVA 2AESA 2C0NA 2WGZA 1WT1A 5BXCA 2AGDA 2WE9A 3USRA 2VFZA 4K6RA 4LW3A 3JTJA 1GX0A 2ZU8A 4YS8A 4KC4A 2W0WA 4AC3A 4JISA 2Y4MA 4KPZA 2Y4JA 1VZXA 3U2TA 2Y7AA 2XWLA 3POLA 3Q7UA 4FRMA 5C4EA 1W57A 2P73A 4Y63A 4P02A 1H5TA 3U2VA 1ZCYA 1GQCA 2YESA 4EE4A 4KPXA 1NQIB 1ZI5A 1H7HA 1HM8A 1ZI3A 3I0CA 4JD0A 3F1CA 2RIYA 4EEAA 5L6VA 1S4OA 5C4DA 4B4MA 1H5RB 1ZIZA 5C48A 1R7XA 1E5KA 1IIMA 1KWSA 1G0RA 5FV9A 2VS4A 2XMEA 3R3IA 2VS3A 1WT3A 3PKQA 3V90A 1PZYB 4EEGA 2CU2A 1LZ7A 3SXDA 2RJ7A 2UX8A 3PNNA 1WT2A 1YP4A 3NGWA 3D98A 1H7LA 2QGIA 1ZDGA 5C1HA 1H5SC 4Y7FA 5C38A 4EE5A 2YQCA 4D0TA 1IINA 4G3SA 5HS2A 1ZJPA 3U0YA 4AYLA 1G9RA 2PGVA 5CMFX 2BO4A 5J49A 2E8BA 1ZJ0A 1JYKA 5C47A 4FQWA 3U2XA 5FUHA 1FR9A 1VH1A 2O1FA 1JV1A 2YQSA 3LW6A 1GX4A 1GWWA 2VXLA 2AE7A 1O0RA 1ZJ1A 2V0IA 3V8YA 3GUEA 2OI7A 1H4CA 4HO3A 1FRWA 1S4PA 3SXAA 3CKNA 4Y7TA 5C49A 2V0HA 3FWWA 2Z87A 4G3QA 2VD4A 1H5SA 2AECA 3OH3A 1FWYA 5L6SA 4L41C 4KRVA 2QKXA 1NKHB 4HO0A 5AJNA 5DDVA 5JQQA 4M4KA 5IFYA 2AM4A 1G1LA 4B3UA 1EYRA 4KXOA 2RJ5A 1H7FA 5FU0A 2I7BA 4KQLA 4CVHA 4NAKA 1TW1A 4ASJA 3CGXA 5EIYA 1G3LA 2APCA 1H7EA 4FREA 5IDTA 2E3DA 2V0KA 2JCLA 1ZJ3A 4FRPA 5CQPA 1HM0A 3I0IX 2FYAA 1LL3A 1FR8A 2RJ1A 3CKOA 3SX8A 3K8EA 3ZLKA 2VXMA 3JUKA 4KNXA 1LVWA 2D0JA 4CJBA 1ZJOA 1ON8A 2FYDB 1LZIA 4EVWA 1VH3A 3E26A 4C2SA 4DECA 3SXCA 5D91A 2D7IA 2DPWA 4KT7A 3QVBA 4P00A 3CKJA 1PZTA 1ZCUA 2BO7A 4Y62A 5C3AA 4EEMA 4FCUA 1V84A 1R81A 4D48A 1XZ6A 4FRHA 3SX7A 2ICYA 3V91A 2XWNA 2FY7A 1EZIA 3V0OA 4FCEA 1QGQA 5CQMX 2P6WA 1LL2A 1W77A 3OH1A 4FIXA 2VS5A 1FGGA 2J0AA 3U0XA 1O23B 5I1FA 5AJOA 4AYJA 2VSIA 5IDSA 1ZI1A 1H7QA 4ARWA 1S4NA 4AAWA 3OH0A 1I52A 1YROB 1W55A 2Y6PA 4IRQA 3CKVA 3D5NA 2JCKA 5D92A 3V0PA 1R7VA 3E25A 5CMGX 3DK5A 5FTVA 4ASYA 1V83A 2GGQA 2W0VA 3ZLLA 1HM9A 4HO9A 3OAMA 3D8VA 2BO6A 1H3MA 1JYLA 4B4GA 1H5SD 3ZF8A 2I5EA 3V8ZA 1WT0A 1NHEB 1O7QA 3PKPA 3V0QA 2RJ4A 1R82A 1OMZA 4MNDA 3IOJA 1G97A 1VGWA 3I0EA 1LL0A 2OEGA
chains in the Genus database with same CATH topology
2RIXA 4HOCA 3SXGA 1FXJA 4Y6NA 2WEEA 1FO8A 2RJ9A 2YQJA 1HJJA 2RIZA 1ZJ2A 2QH5A 3IOHA 3N9WA 4FRLA 4LW6A 1VGZA 3TZTA 1XHBA 1GQ9A 3OKRA 4O6NA 2AH9A 1MC3A 5AJPA 3U2WA 2YQHA 1K4VA 1G2VA 5CQLX 2WVKA 3DJ4A 4Y7VA 1VZTA 3OC9A 2RITA 1H5RA 4Q7CA 2YC3A 1H4DA 1ZHJA 4MYBA 3SPTA 2XMHA 3SX5A 1H4EA 2Y4KA 4HO4A 4BQHA 4KNRA 4FIYA 1FOAA 2BO8A 1ON6A 2AM5A 4ECMA 1WVCA 2A8WA 2VSHA 2Y4LA 2XWMA 3ST8A 4B5BA 2V0JA 5C8RA 4Y6UA 1ZDFA 5FTSA 2NXVA 3U2UA 1V82A 3BRKX 2O1HA 1FXOA 3V0NA 1TZFA 2X5SA 4FRDA 2P72A 3I0LA 1G8OA 3I0JA 3V0LA 4NANA 5CMIA 3V0MA 2Q4JA 1MP3A 3OH2A 1LZ0A 4E1KA 2RJ0A 4G87A 2JCJA 4FROA 4M2AA 4Y7GA 2YCMA 1G95A 1VM8A 3T7OA 4BMAA 1QGSA 5C3BA 2PX7A 1R80A 3Q4SA 3I0HA 4XWIA 1NMMB 4HG6A 3SXBA 3I0FA 1SS9A 1O7OA 5C3DA 3SXEA 1H5SB 2A8UA 2WAWA 2I5KA 4HO6A 4MIXA 1GA8A 4NALA 4GBPA 3SX3A 5C36A 4M2BA 1JVGA 2O1GA 2FFVA 1JVDA 4HO8A 4D11C 3CU0A 2OI5A 4O6MA 3USQA 2Z86A 5FYEA 3EE5A 1VGUA 4KC1A 3R2WA 2X60A 4IRPA 3I0DA 1LZJA 3KIAA 2WVMA 1YP3A 4CJCA 3K8DA 1MP4A 5CMHA 1INJA 3OGZA 3I0GA 1MP5A 1VZUA 3F1YA 2OEFA 2ICXA 4HO2A 4UEGA 4DE7A 2D7RA 2ZU9A 3BCVA 1R7TA 3T7MA 5EJ1A 1NWGB 1G93A 5C1LA 1OMXA 2OI6A 2GGOA 3O3PA 4FRAA 3OH4A 1H5TB 4D11A 1GWVA 2RJ6A 2FYBA 1VICA 4J18A 5C4BA 4M28A 5C4CA 1FO9A 1TVYA 4DDZA 4R7PA 1JV3A 1ZCTA 3RMVA 5EJZA 2V0LA 5C1GA 4B2WA 4Y64A 4FRBA 3T7NA 1YP2A 3ZGFA 2FFUA 2VK9A 5CQNX 5FU8A 4Y9XA 5CMJA 4NAIA 4B2XA 1Z90A 4HO5A 3I0KA 4G3PA 4EEOA 1FZWA 3IOIA 5DDTA 2J0BA 4FRQA 2WVLA 4KC2A 1FG5N 1ZCVA 2AM3A 2X5ZA 3JUJA 1ZI4A 4Y7UA 1VGTA 3TQDA 5C4FA 1R7UA 1QG8A 1H7GA 2X65A 4ZDQA 4D0ZA 1HV9A 4B4BA 1INIA 1VPAA 1QWJA 3FOQA 4EE3A 2ZU7A 2PA4A 1NF5B 3HL3A 3RMWA 4HCQA 4B42A 1R7YA 1TW5A 3ZGGA 1FGXA 1G23A 3RSBA 1WSZA 1HJLA 2FYCB 3Q80A 3CKQA 2MZBA 1OQMB 2JCOA 5CQOA 2PGYA 4CJ8A 2RJ8A 1H7TA 2YC5A 3DUVA 2AESA 2C0NA 2WGZA 1WT1A 5BXCA 2AGDA 2WE9A 3USRA 2VFZA 4K6RA 4LW3A 3JTJA 1GX0A 2ZU8A 4YS8A 4KC4A 2W0WA 4AC3A 4JISA 2Y4MA 4KPZA 2Y4JA 1VZXA 3U2TA 2Y7AA 2XWLA 3POLA 3Q7UA 4FRMA 5C4EA 1W57A 2P73A 4Y63A 4P02A 1H5TA 3U2VA 1ZCYA 1GQCA 2YESA 4EE4A 4KPXA 1NQIB 1ZI5A 1H7HA 1HM8A 1ZI3A 3I0CA 4JD0A 3F1CA 2RIYA 4EEAA 5L6VA 1S4OA 5C4DA 4B4MA 1H5RB 1ZIZA 5C48A 1R7XA 1E5KA 1IIMA 1KWSA 1G0RA 5FV9A 2VS4A 2XMEA 3R3IA 2VS3A 1WT3A 3PKQA 3V90A 1PZYB 4EEGA 2CU2A 1LZ7A 3SXDA 2RJ7A 2UX8A 3PNNA 1WT2A 1YP4A 3NGWA 3D98A 1H7LA 2QGIA 1ZDGA 5C1HA 1H5SC 4Y7FA 5C38A 4EE5A 2YQCA 4D0TA 1IINA 4G3SA 5HS2A 1ZJPA 3U0YA 4AYLA 1G9RA 2PGVA 5CMFX 2BO4A 5J49A 2E8BA 1ZJ0A 1JYKA 5C47A 4FQWA 3U2XA 5FUHA 1FR9A 1VH1A 2O1FA 1JV1A 2YQSA 3LW6A 1GX4A 1GWWA 2VXLA 2AE7A 1O0RA 1ZJ1A 2V0IA 3V8YA 3GUEA 2OI7A 1H4CA 4HO3A 1FRWA 1S4PA 3SXAA 3CKNA 4Y7TA 5C49A 2V0HA 3FWWA 2Z87A 4G3QA 2VD4A 1H5SA 2AECA 3OH3A 1FWYA 5L6SA 4L41C 4KRVA 2QKXA 1NKHB 4HO0A 5AJNA 5DDVA 5JQQA 4M4KA 5IFYA 2AM4A 1G1LA 4B3UA 1EYRA 4KXOA 2RJ5A 1H7FA 5FU0A 2I7BA 4KQLA 4CVHA 4NAKA 1TW1A 4ASJA 3CGXA 5EIYA 1G3LA 2APCA 1H7EA 4FREA 5IDTA 2E3DA 2V0KA 2JCLA 1ZJ3A 4FRPA 5CQPA 1HM0A 3I0IX 2FYAA 1LL3A 1FR8A 2RJ1A 3CKOA 3SX8A 3K8EA 3ZLKA 2VXMA 3JUKA 4KNXA 1LVWA 2D0JA 4CJBA 1ZJOA 1ON8A 2FYDB 1LZIA 4EVWA 1VH3A 3E26A 4C2SA 4DECA 3SXCA 5D91A 2D7IA 2DPWA 4KT7A 3QVBA 4P00A 3CKJA 1PZTA 1ZCUA 2BO7A 4Y62A 5C3AA 4EEMA 4FCUA 1V84A 1R81A 4D48A 1XZ6A 4FRHA 3SX7A 2ICYA 3V91A 2XWNA 2FY7A 1EZIA 3V0OA 4FCEA 1QGQA 5CQMX 2P6WA 1LL2A 1W77A 3OH1A 4FIXA 2VS5A 1FGGA 2J0AA 3U0XA 1O23B 5I1FA 5AJOA 4AYJA 2VSIA 5IDSA 1ZI1A 1H7QA 4ARWA 1S4NA 4AAWA 3OH0A 1I52A 1YROB 1W55A 2Y6PA 4IRQA 3CKVA 3D5NA 2JCKA 5D92A 3V0PA 1R7VA 3E25A 5CMGX 3DK5A 5FTVA 4ASYA 1V83A 2GGQA 2W0VA 3ZLLA 1HM9A 4HO9A 3OAMA 3D8VA 2BO6A 1H3MA 1JYLA 4B4GA 1H5SD 3ZF8A 2I5EA 3V8ZA 1WT0A 1NHEB 1O7QA 3PKPA 3V0QA 2RJ4A 1R82A 1OMZA 4MNDA 3IOJA 1G97A 1VGWA 3I0EA 1LL0A 2OEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIX A;  4HOC A;  3SXG A;  1FXJ A;  4Y6N A;  2WEE A;  1FO8 A;  2RJ9 A;  2YQJ A;  1HJJ A;  2RIZ A;  1ZJ2 A;  2QH5 A;  3IOH A;  3N9W A;  4FRL A;  4LW6 A;  1VGZ A;  3TZT A;  1XHB A;  1GQ9 A;  3OKR A;  2AH9 A;  1MC3 A;  5AJP A;  3U2W A;  2YQH A;  1K4V A;  1G2V A;  5CQL X;  2WVK A;  3DJ4 A;  4Y7V A;  1VZT A;  3OC9 A;  2RIT A;  1H5R A;  2YC3 A;  1H4D A;  1ZHJ A;  4MYB A;  3SPT A;  2XMH A;  3SX5 A;  1H4E A;  2Y4K A;  4HO4 A;  4BQH A;  4KNR A;  1FOA A;  2BO8 A;  1ON6 A;  2AM5 A;  4ECM A;  1WVC A;  2A8W A;  2VSH A;  2Y4L A;  2XWM A;  3ST8 A;  4B5B A;  2V0J A;  5C8R A;  4Y6U A;  1ZDF A;  5FTS A;  2NXV A;  3U2U A;  1V82 A;  3BRK X;  2O1H A;  1FXO A;  3V0N A;  1TZF A;  2X5S A;  4FRD A;  2P72 A;  3I0L A;  1G8O A;  3I0J A;  3V0L A;  4NAN A;  5CMI A;  3V0M A;  2Q4J A;  1MP3 A;  3OH2 A;  1LZ0 A;  4E1K A;  2RJ0 A;  4G87 A;  2JCJ A;  4FRO A;  4M2A A;  4Y7G A;  2YCM A;  1G95 A;  1VM8 A;  3T7O A;  4BMA A;  1QGS A;  5C3B A;  2PX7 A;  1R80 A;  3Q4S A;  3I0H A;  4XWI A;  1NMM B;  4HG6 A;  3SXB A;  3I0F A;  1SS9 A;  1O7O A;  5C3D A;  3SXE A;  1H5S B;  2A8U A;  2WAW A;  2I5K A;  4HO6 A;  1GA8 A;  4NAL A;  4GBP A;  3SX3 A;  5C36 A;  4M2B A;  1JVG A;  2O1G A;  2FFV A;  1JVD A;  4HO8 A;  4D11 C;  3CU0 A;  2OI5 A;  3USQ A;  2Z86 A;  5FYE A;  3EE5 A;  1VGU A;  4KC1 A;  3R2W A;  2X60 A;  4IRP A;  3I0D A;  1LZJ A;  3KIA A;  2WVM A;  1YP3 A;  4CJC A;  3K8D A;  1MP4 A;  5CMH A;  1INJ A;  3OGZ A;  3I0G A;  1MP5 A;  1VZU A;  3F1Y A;  2OEF A;  2ICX A;  4HO2 A;  4UEG A;  4DE7 A;  2D7R A;  2ZU9 A;  3BCV A;  1R7T A;  3T7M A;  5EJ1 A;  1NWG B;  1G93 A;  5C1L A;  1OMX A;  2OI6 A;  2GGO A;  3O3P A;  4FRA A;  3OH4 A;  1H5T B;  4D11 A;  1GWV A;  2RJ6 A;  2FYB A;  1VIC A;  4J18 A;  5C4B A;  4M28 A;  5C4C A;  1FO9 A;  1TVY A;  4DDZ A;  4R7P A;  1JV3 A;  1ZCT A;  3RMV A;  5EJZ A;  2V0L A;  5C1G A;  4B2W A;  4Y64 A;  4FRB A;  3T7N A;  1YP2 A;  3ZGF A;  2FFU A;  5FU8 A;  5CQN X;  4Y9X A;  5CMJ A;  4NAI A;  4B2X A;  1Z90 A;  4HO5 A;  3I0K A;  4G3P A;  4EEO A;  1FZW A;  3IOI A;  5DDT A;  4FRQ A;  2WVL A;  4KC2 A;  1FG5 N;  1ZCV A;  2AM3 A;  2X5Z A;  3JUJ A;  1ZI4 A;  4Y7U A;  1VGT A;  3TQD A;  5C4F A;  1R7U A;  1QG8 A;  1H7G A;  2X65 A;  4ZDQ A;  4D0Z A;  1HV9 A;  4B4B A;  1INI A;  1VPA A;  1QWJ A;  3FOQ A;  4EE3 A;  2ZU7 A;  2PA4 A;  1NF5 B;  3HL3 A;  3RMW A;  4HCQ A;  4B42 A;  1R7Y A;  1TW5 A;  3ZGG A;  1FGX A;  1G23 A;  3RSB A;  1WSZ A;  1HJL A;  2FYC B;  3Q80 A;  3CKQ A;  2MZB A;  1OQM B;  2JCO A;  5CQO A;  2PGY A;  4CJ8 A;  2RJ8 A;  1H7T A;  2YC5 A;  3DUV A;  2AES A;  2WGZ A;  1WT1 A;  5BXC A;  2AGD A;  2WE9 A;  3USR A;  2VFZ A;  4K6R A;  4LW3 A;  3JTJ A;  1GX0 A;  2ZU8 A;  4YS8 A;  4KC4 A;  2W0W A;  4AC3 A;  4JIS A;  2Y4M A;  4KPZ A;  2Y4J A;  1VZX A;  3U2T A;  2Y7A A;  2XWL A;  3POL A;  3Q7U A;  4FRM A;  5C4E A;  1W57 A;  2P73 A;  4Y63 A;  4P02 A;  1H5T A;  3U2V A;  1ZCY A;  1GQC A;  2YES A;  4EE4 A;  4KPX A;  1NQI B;  1ZI5 A;  1H7H A;  1HM8 A;  1ZI3 A;  3I0C A;  4JD0 A;  3F1C A;  2RIY A;  4EEA A;  5L6V A;  1S4O A;  5C4D A;  4B4M A;  1H5R B;  1ZIZ A;  5C48 A;  1R7X A;  1E5K A;  1IIM A;  1KWS A;  1G0R A;  5FV9 A;  2VS4 A;  2XME A;  3R3I A;  2VS3 A;  1WT3 A;  3PKQ A;  3V90 A;  1PZY B;  4EEG A;  2CU2 A;  1LZ7 A;  3SXD A;  2RJ7 A;  2UX8 A;  3PNN A;  1WT2 A;  1YP4 A;  3NGW A;  3D98 A;  1H7L A;  2QGI A;  1ZDG A;  5C1H A;  1H5S C;  4Y7F A;  5C38 A;  4EE5 A;  2YQC A;  4D0T A;  1IIN A;  4G3S A;  5HS2 A;  1ZJP A;  3U0Y A;  4AYL A;  1G9R A;  2PGV A;  5CMF X;  2BO4 A;  5J49 A;  2E8B A;  1ZJ0 A;  1JYK A;  5C47 A;  4FQW A;  3U2X A;  5FUH A;  1FR9 A;  1VH1 A;  2O1F A;  1JV1 A;  2YQS A;  3LW6 A;  1GX4 A;  1GWW A;  2VXL A;  2AE7 A;  1O0R A;  1ZJ1 A;  2V0I A;  3V8Y A;  3GUE A;  2OI7 A;  1H4C A;  4HO3 A;  1FRW A;  1S4P A;  3SXA A;  3CKN A;  4Y7T A;  5C49 A;  2V0H A;  3FWW A;  2Z87 A;  4G3Q A;  2VD4 A;  1H5S A;  2AEC A;  3OH3 A;  1FWY A;  5L6S A;  4L41 C;  4KRV A;  2QKX A;  1NKH B;  4HO0 A;  5AJN A;  5DDV A;  5JQQ A;  4M4K A;  5IFY A;  2AM4 A;  1G1L A;  4B3U A;  1EYR A;  4KXO A;  2RJ5 A;  1H7F A;  5FU0 A;  2I7B A;  4KQL A;  4CVH A;  4NAK A;  1TW1 A;  4ASJ A;  3CGX A;  5EIY A;  1G3L A;  2APC A;  1H7E A;  4FRE A;  5IDT A;  2E3D A;  2V0K A;  2JCL A;  1ZJ3 A;  4FRP A;  5CQP A;  1HM0 A;  3I0I X;  2FYA A;  1LL3 A;  1FR8 A;  2RJ1 A;  3CKO A;  3SX8 A;  3K8E A;  3ZLK A;  2VXM A;  3JUK A;  4KNX A;  1LVW A;  2D0J A;  4CJB A;  1ZJO A;  1ON8 A;  2FYD B;  1LZI A;  4EVW A;  1VH3 A;  3E26 A;  4C2S A;  4DEC A;  3SXC A;  2D7I A;  2DPW A;  4KT7 A;  3QVB A;  4P00 A;  3CKJ A;  1PZT A;  1ZCU A;  2BO7 A;  4Y62 A;  5C3A A;  4EEM A;  4FCU A;  1V84 A;  1R81 A;  4D48 A;  1XZ6 A;  4FRH A;  3SX7 A;  2ICY A;  3V91 A;  2XWN A;  2FY7 A;  1EZI A;  3V0O A;  4FCE A;  1QGQ A;  5CQM X;  2P6W A;  1LL2 A;  1W77 A;  3OH1 A;  2VS5 A;  1FGG A;  3U0X A;  1O23 B;  5I1F A;  5AJO A;  4AYJ A;  2VSI A;  5IDS A;  1ZI1 A;  1H7Q A;  4ARW A;  1S4N A;  4AAW A;  3OH0 A;  1I52 A;  1YRO B;  1W55 A;  2Y6P A;  4IRQ A;  3CKV A;  3D5N A;  2JCK A;  3V0P A;  1R7V A;  3E25 A;  5CMG X;  3DK5 A;  5FTV A;  4ASY A;  1V83 A;  2GGQ A;  2W0V A;  3ZLL A;  1HM9 A;  4HO9 A;  3OAM A;  3D8V A;  2BO6 A;  1H3M A;  1JYL A;  4B4G A;  1H5S D;  3ZF8 A;  2I5E A;  3V8Z A;  1WT0 A;  1NHE B;  1O7Q A;  3PKP A;  3V0Q A;  2RJ4 A;  1R82 A;  1OMZ A;  4MND A;  3IOJ A;  1G97 A;  1VGW A;  3I0E A;  1LL0 A;  2OEG A; 
#chains in the Genus database with same CATH topology
 2RIX A;  4HOC A;  3SXG A;  1FXJ A;  4Y6N A;  2WEE A;  1FO8 A;  2RJ9 A;  2YQJ A;  1HJJ A;  2RIZ A;  1ZJ2 A;  2QH5 A;  3IOH A;  3N9W A;  4FRL A;  4LW6 A;  1VGZ A;  3TZT A;  1XHB A;  1GQ9 A;  3OKR A;  4O6N A;  2AH9 A;  1MC3 A;  5AJP A;  3U2W A;  2YQH A;  1K4V A;  1G2V A;  5CQL X;  2WVK A;  3DJ4 A;  4Y7V A;  1VZT A;  3OC9 A;  2RIT A;  1H5R A;  4Q7C A;  2YC3 A;  1H4D A;  1ZHJ A;  4MYB A;  3SPT A;  2XMH A;  3SX5 A;  1H4E A;  2Y4K A;  4HO4 A;  4BQH A;  4KNR A;  4FIY A;  1FOA A;  2BO8 A;  1ON6 A;  2AM5 A;  4ECM A;  1WVC A;  2A8W A;  2VSH A;  2Y4L A;  2XWM A;  3ST8 A;  4B5B A;  2V0J A;  5C8R A;  4Y6U A;  1ZDF A;  5FTS A;  2NXV A;  3U2U A;  1V82 A;  3BRK X;  2O1H A;  1FXO A;  3V0N A;  1TZF A;  2X5S A;  4FRD A;  2P72 A;  3I0L A;  1G8O A;  3I0J A;  3V0L A;  4NAN A;  5CMI A;  3V0M A;  2Q4J A;  1MP3 A;  3OH2 A;  1LZ0 A;  4E1K A;  2RJ0 A;  4G87 A;  2JCJ A;  4FRO A;  4M2A A;  4Y7G A;  2YCM A;  1G95 A;  1VM8 A;  3T7O A;  4BMA A;  1QGS A;  5C3B A;  2PX7 A;  1R80 A;  3Q4S A;  3I0H A;  4XWI A;  1NMM B;  4HG6 A;  3SXB A;  3I0F A;  1SS9 A;  1O7O A;  5C3D A;  3SXE A;  1H5S B;  2A8U A;  2WAW A;  2I5K A;  4HO6 A;  4MIX A;  1GA8 A;  4NAL A;  4GBP A;  3SX3 A;  5C36 A;  4M2B A;  1JVG A;  2O1G A;  2FFV A;  1JVD A;  4HO8 A;  4D11 C;  3CU0 A;  2OI5 A;  4O6M A;  3USQ A;  2Z86 A;  5FYE A;  3EE5 A;  1VGU A;  4KC1 A;  3R2W A;  2X60 A;  4IRP A;  3I0D A;  1LZJ A;  3KIA A;  2WVM A;  1YP3 A;  4CJC A;  3K8D A;  1MP4 A;  5CMH A;  1INJ A;  3OGZ A;  3I0G A;  1MP5 A;  1VZU A;  3F1Y A;  2OEF A;  2ICX A;  4HO2 A;  4UEG A;  4DE7 A;  2D7R A;  2ZU9 A;  3BCV A;  1R7T A;  3T7M A;  5EJ1 A;  1NWG B;  1G93 A;  5C1L A;  1OMX A;  2OI6 A;  2GGO A;  3O3P A;  4FRA A;  3OH4 A;  1H5T B;  4D11 A;  1GWV A;  2RJ6 A;  2FYB A;  1VIC A;  4J18 A;  5C4B A;  4M28 A;  5C4C A;  1FO9 A;  1TVY A;  4DDZ A;  4R7P A;  1JV3 A;  1ZCT A;  3RMV A;  5EJZ A;  2V0L A;  5C1G A;  4B2W A;  4Y64 A;  4FRB A;  3T7N A;  1YP2 A;  3ZGF A;  2FFU A;  2VK9 A;  5CQN X;  5FU8 A;  4Y9X A;  5CMJ A;  4NAI A;  4B2X A;  1Z90 A;  4HO5 A;  3I0K A;  4G3P A;  4EEO A;  1FZW A;  3IOI A;  5DDT A;  2J0B A;  4FRQ A;  2WVL A;  4KC2 A;  1FG5 N;  1ZCV A;  2AM3 A;  2X5Z A;  3JUJ A;  1ZI4 A;  4Y7U A;  1VGT A;  3TQD A;  5C4F A;  1R7U A;  1QG8 A;  1H7G A;  2X65 A;  4ZDQ A;  4D0Z A;  1HV9 A;  4B4B A;  1INI A;  1VPA A;  1QWJ A;  3FOQ A;  4EE3 A;  2ZU7 A;  2PA4 A;  1NF5 B;  3HL3 A;  3RMW A;  4HCQ A;  4B42 A;  1R7Y A;  1TW5 A;  3ZGG A;  1FGX A;  1G23 A;  3RSB A;  1WSZ A;  1HJL A;  2FYC B;  3Q80 A;  3CKQ A;  2MZB A;  1OQM B;  2JCO A;  5CQO A;  2PGY A;  4CJ8 A;  2RJ8 A;  1H7T A;  2YC5 A;  3DUV A;  2AES A;  2C0N A;  2WGZ A;  1WT1 A;  5BXC A;  2AGD A;  2WE9 A;  3USR A;  2VFZ A;  4K6R A;  4LW3 A;  3JTJ A;  1GX0 A;  2ZU8 A;  4YS8 A;  4KC4 A;  2W0W A;  4AC3 A;  4JIS A;  2Y4M A;  4KPZ A;  2Y4J A;  1VZX A;  3U2T A;  2Y7A A;  2XWL A;  3POL A;  3Q7U A;  4FRM A;  5C4E A;  1W57 A;  2P73 A;  4Y63 A;  4P02 A;  1H5T A;  3U2V A;  1ZCY A;  1GQC A;  2YES A;  4EE4 A;  4KPX A;  1NQI B;  1ZI5 A;  1H7H A;  1HM8 A;  1ZI3 A;  3I0C A;  4JD0 A;  3F1C A;  2RIY A;  4EEA A;  5L6V A;  1S4O A;  5C4D A;  4B4M A;  1H5R B;  1ZIZ A;  5C48 A;  1R7X A;  1E5K A;  1IIM A;  1KWS A;  1G0R A;  5FV9 A;  2VS4 A;  2XME A;  3R3I A;  2VS3 A;  1WT3 A;  3PKQ A;  3V90 A;  1PZY B;  4EEG A;  2CU2 A;  1LZ7 A;  3SXD A;  2RJ7 A;  2UX8 A;  3PNN A;  1WT2 A;  1YP4 A;  3NGW A;  3D98 A;  1H7L A;  2QGI A;  1ZDG A;  5C1H A;  1H5S C;  4Y7F A;  5C38 A;  4EE5 A;  2YQC A;  4D0T A;  1IIN A;  4G3S A;  5HS2 A;  1ZJP A;  3U0Y A;  4AYL A;  1G9R A;  2PGV A;  5CMF X;  2BO4 A;  5J49 A;  2E8B A;  1ZJ0 A;  1JYK A;  5C47 A;  4FQW A;  3U2X A;  5FUH A;  1FR9 A;  1VH1 A;  2O1F A;  1JV1 A;  2YQS A;  3LW6 A;  1GX4 A;  1GWW A;  2VXL A;  2AE7 A;  1O0R A;  1ZJ1 A;  2V0I A;  3V8Y A;  3GUE A;  2OI7 A;  1H4C A;  4HO3 A;  1FRW A;  1S4P A;  3SXA A;  3CKN A;  4Y7T A;  5C49 A;  2V0H A;  3FWW A;  2Z87 A;  4G3Q A;  2VD4 A;  1H5S A;  2AEC A;  3OH3 A;  1FWY A;  5L6S A;  4L41 C;  4KRV A;  2QKX A;  1NKH B;  4HO0 A;  5AJN A;  5DDV A;  5JQQ A;  4M4K A;  5IFY A;  2AM4 A;  1G1L A;  4B3U A;  1EYR A;  4KXO A;  2RJ5 A;  1H7F A;  5FU0 A;  2I7B A;  4KQL A;  4CVH A;  4NAK A;  1TW1 A;  4ASJ A;  3CGX A;  5EIY A;  1G3L A;  2APC A;  1H7E A;  4FRE A;  5IDT A;  2E3D A;  2V0K A;  2JCL A;  1ZJ3 A;  4FRP A;  5CQP A;  1HM0 A;  3I0I X;  2FYA A;  1LL3 A;  1FR8 A;  2RJ1 A;  3CKO A;  3SX8 A;  3K8E A;  3ZLK A;  2VXM A;  3JUK A;  4KNX A;  1LVW A;  2D0J A;  4CJB A;  1ZJO A;  1ON8 A;  2FYD B;  1LZI A;  4EVW A;  1VH3 A;  3E26 A;  4C2S A;  4DEC A;  3SXC A;  5D91 A;  2D7I A;  2DPW A;  4KT7 A;  3QVB A;  4P00 A;  3CKJ A;  1PZT A;  1ZCU A;  2BO7 A;  4Y62 A;  5C3A A;  4EEM A;  4FCU A;  1V84 A;  1R81 A;  4D48 A;  1XZ6 A;  4FRH A;  3SX7 A;  2ICY A;  3V91 A;  2XWN A;  2FY7 A;  1EZI A;  3V0O A;  4FCE A;  1QGQ A;  5CQM X;  2P6W A;  1LL2 A;  1W77 A;  3OH1 A;  4FIX A;  2VS5 A;  1FGG A;  2J0A A;  3U0X A;  1O23 B;  5I1F A;  5AJO A;  4AYJ A;  2VSI A;  5IDS A;  1ZI1 A;  1H7Q A;  4ARW A;  1S4N A;  4AAW A;  3OH0 A;  1I52 A;  1YRO B;  1W55 A;  2Y6P A;  4IRQ A;  3CKV A;  3D5N A;  2JCK A;  5D92 A;  3V0P A;  1R7V A;  3E25 A;  5CMG X;  3DK5 A;  5FTV A;  4ASY A;  1V83 A;  2GGQ A;  2W0V A;  3ZLL A;  1HM9 A;  4HO9 A;  3OAM A;  3D8V A;  2BO6 A;  1H3M A;  1JYL A;  4B4G A;  1H5S D;  3ZF8 A;  2I5E A;  3V8Z A;  1WT0 A;  1NHE B;  1O7Q A;  3PKP A;  3V0Q A;  2RJ4 A;  1R82 A;  1OMZ A;  4MND A;  3IOJ A;  1G97 A;  1VGW A;  3I0E A;  1LL0 A;  2OEG A; 
#chains in the Genus database with same CATH homology
 2RIX A;  4HOC A;  3SXG A;  1FXJ A;  4Y6N A;  2WEE A;  1FO8 A;  2RJ9 A;  2YQJ A;  1HJJ A;  2RIZ A;  1ZJ2 A;  2QH5 A;  3IOH A;  3N9W A;  4FRL A;  4LW6 A;  1VGZ A;  3TZT A;  1XHB A;  1GQ9 A;  3OKR A;  4O6N A;  2AH9 A;  1MC3 A;  5AJP A;  3U2W A;  2YQH A;  1K4V A;  1G2V A;  5CQL X;  2WVK A;  3DJ4 A;  4Y7V A;  1VZT A;  3OC9 A;  2RIT A;  1H5R A;  4Q7C A;  2YC3 A;  1H4D A;  1ZHJ A;  4MYB A;  3SPT A;  2XMH A;  3SX5 A;  1H4E A;  2Y4K A;  4HO4 A;  4BQH A;  4KNR A;  4FIY A;  1FOA A;  2BO8 A;  1ON6 A;  2AM5 A;  4ECM A;  1WVC A;  2A8W A;  2VSH A;  2Y4L A;  2XWM A;  3ST8 A;  4B5B A;  2V0J A;  5C8R A;  4Y6U A;  1ZDF A;  5FTS A;  2NXV A;  3U2U A;  1V82 A;  3BRK X;  2O1H A;  1FXO A;  3V0N A;  1TZF A;  2X5S A;  4FRD A;  2P72 A;  3I0L A;  1G8O A;  3I0J A;  3V0L A;  4NAN A;  5CMI A;  3V0M A;  2Q4J A;  1MP3 A;  3OH2 A;  1LZ0 A;  4E1K A;  2RJ0 A;  4G87 A;  2JCJ A;  4FRO A;  4M2A A;  4Y7G A;  2YCM A;  1G95 A;  1VM8 A;  3T7O A;  4BMA A;  1QGS A;  5C3B A;  2PX7 A;  1R80 A;  3Q4S A;  3I0H A;  4XWI A;  1NMM B;  4HG6 A;  3SXB A;  3I0F A;  1SS9 A;  1O7O A;  5C3D A;  3SXE A;  1H5S B;  2A8U A;  2WAW A;  2I5K A;  4HO6 A;  4MIX A;  1GA8 A;  4NAL A;  4GBP A;  3SX3 A;  5C36 A;  4M2B A;  1JVG A;  2O1G A;  2FFV A;  1JVD A;  4HO8 A;  4D11 C;  3CU0 A;  2OI5 A;  4O6M A;  3USQ A;  2Z86 A;  5FYE A;  3EE5 A;  1VGU A;  4KC1 A;  3R2W A;  2X60 A;  4IRP A;  3I0D A;  1LZJ A;  3KIA A;  2WVM A;  1YP3 A;  4CJC A;  3K8D A;  1MP4 A;  5CMH A;  1INJ A;  3OGZ A;  3I0G A;  1MP5 A;  1VZU A;  3F1Y A;  2OEF A;  2ICX A;  4HO2 A;  4UEG A;  4DE7 A;  2D7R A;  2ZU9 A;  3BCV A;  1R7T A;  3T7M A;  5EJ1 A;  1NWG B;  1G93 A;  5C1L A;  1OMX A;  2OI6 A;  2GGO A;  3O3P A;  4FRA A;  3OH4 A;  1H5T B;  4D11 A;  1GWV A;  2RJ6 A;  2FYB A;  1VIC A;  4J18 A;  5C4B A;  4M28 A;  5C4C A;  1FO9 A;  1TVY A;  4DDZ A;  4R7P A;  1JV3 A;  1ZCT A;  3RMV A;  5EJZ A;  2V0L A;  5C1G A;  4B2W A;  4Y64 A;  4FRB A;  3T7N A;  1YP2 A;  3ZGF A;  2FFU A;  2VK9 A;  5CQN X;  5FU8 A;  4Y9X A;  5CMJ A;  4NAI A;  4B2X A;  1Z90 A;  4HO5 A;  3I0K A;  4G3P A;  4EEO A;  1FZW A;  3IOI A;  5DDT A;  2J0B A;  4FRQ A;  2WVL A;  4KC2 A;  1FG5 N;  1ZCV A;  2AM3 A;  2X5Z A;  3JUJ A;  1ZI4 A;  4Y7U A;  1VGT A;  3TQD A;  5C4F A;  1R7U A;  1QG8 A;  1H7G A;  2X65 A;  4ZDQ A;  4D0Z A;  1HV9 A;  4B4B A;  1INI A;  1VPA A;  1QWJ A;  3FOQ A;  4EE3 A;  2ZU7 A;  2PA4 A;  1NF5 B;  3HL3 A;  3RMW A;  4HCQ A;  4B42 A;  1R7Y A;  1TW5 A;  3ZGG A;  1FGX A;  1G23 A;  3RSB A;  1WSZ A;  1HJL A;  2FYC B;  3Q80 A;  3CKQ A;  2MZB A;  1OQM B;  2JCO A;  5CQO A;  2PGY A;  4CJ8 A;  2RJ8 A;  1H7T A;  2YC5 A;  3DUV A;  2AES A;  2C0N A;  2WGZ A;  1WT1 A;  5BXC A;  2AGD A;  2WE9 A;  3USR A;  2VFZ A;  4K6R A;  4LW3 A;  3JTJ A;  1GX0 A;  2ZU8 A;  4YS8 A;  4KC4 A;  2W0W A;  4AC3 A;  4JIS A;  2Y4M A;  4KPZ A;  2Y4J A;  1VZX A;  3U2T A;  2Y7A A;  2XWL A;  3POL A;  3Q7U A;  4FRM A;  5C4E A;  1W57 A;  2P73 A;  4Y63 A;  4P02 A;  1H5T A;  3U2V A;  1ZCY A;  1GQC A;  2YES A;  4EE4 A;  4KPX A;  1NQI B;  1ZI5 A;  1H7H A;  1HM8 A;  1ZI3 A;  3I0C A;  4JD0 A;  3F1C A;  2RIY A;  4EEA A;  5L6V A;  1S4O A;  5C4D A;  4B4M A;  1H5R B;  1ZIZ A;  5C48 A;  1R7X A;  1E5K A;  1IIM A;  1KWS A;  1G0R A;  5FV9 A;  2VS4 A;  2XME A;  3R3I A;  2VS3 A;  1WT3 A;  3PKQ A;  3V90 A;  1PZY B;  4EEG A;  2CU2 A;  1LZ7 A;  3SXD A;  2RJ7 A;  2UX8 A;  3PNN A;  1WT2 A;  1YP4 A;  3NGW A;  3D98 A;  1H7L A;  2QGI A;  1ZDG A;  5C1H A;  1H5S C;  4Y7F A;  5C38 A;  4EE5 A;  2YQC A;  4D0T A;  1IIN A;  4G3S A;  5HS2 A;  1ZJP A;  3U0Y A;  4AYL A;  1G9R A;  2PGV A;  5CMF X;  2BO4 A;  5J49 A;  2E8B A;  1ZJ0 A;  1JYK A;  5C47 A;  4FQW A;  3U2X A;  5FUH A;  1FR9 A;  1VH1 A;  2O1F A;  1JV1 A;  2YQS A;  3LW6 A;  1GX4 A;  1GWW A;  2VXL A;  2AE7 A;  1O0R A;  1ZJ1 A;  2V0I A;  3V8Y A;  3GUE A;  2OI7 A;  1H4C A;  4HO3 A;  1FRW A;  1S4P A;  3SXA A;  3CKN A;  4Y7T A;  5C49 A;  2V0H A;  3FWW A;  2Z87 A;  4G3Q A;  2VD4 A;  1H5S A;  2AEC A;  3OH3 A;  1FWY A;  5L6S A;  4L41 C;  4KRV A;  2QKX A;  1NKH B;  4HO0 A;  5AJN A;  5DDV A;  5JQQ A;  4M4K A;  5IFY A;  2AM4 A;  1G1L A;  4B3U A;  1EYR A;  4KXO A;  2RJ5 A;  1H7F A;  5FU0 A;  2I7B A;  4KQL A;  4CVH A;  4NAK A;  1TW1 A;  4ASJ A;  3CGX A;  5EIY A;  1G3L A;  2APC A;  1H7E A;  4FRE A;  5IDT A;  2E3D A;  2V0K A;  2JCL A;  1ZJ3 A;  4FRP A;  5CQP A;  1HM0 A;  3I0I X;  2FYA A;  1LL3 A;  1FR8 A;  2RJ1 A;  3CKO A;  3SX8 A;  3K8E A;  3ZLK A;  2VXM A;  3JUK A;  4KNX A;  1LVW A;  2D0J A;  4CJB A;  1ZJO A;  1ON8 A;  2FYD B;  1LZI A;  4EVW A;  1VH3 A;  3E26 A;  4C2S A;  4DEC A;  3SXC A;  5D91 A;  2D7I A;  2DPW A;  4KT7 A;  3QVB A;  4P00 A;  3CKJ A;  1PZT A;  1ZCU A;  2BO7 A;  4Y62 A;  5C3A A;  4EEM A;  4FCU A;  1V84 A;  1R81 A;  4D48 A;  1XZ6 A;  4FRH A;  3SX7 A;  2ICY A;  3V91 A;  2XWN A;  2FY7 A;  1EZI A;  3V0O A;  4FCE A;  1QGQ A;  5CQM X;  2P6W A;  1LL2 A;  1W77 A;  3OH1 A;  4FIX A;  2VS5 A;  1FGG A;  2J0A A;  3U0X A;  1O23 B;  5I1F A;  5AJO A;  4AYJ A;  2VSI A;  5IDS A;  1ZI1 A;  1H7Q A;  4ARW A;  1S4N A;  4AAW A;  3OH0 A;  1I52 A;  1YRO B;  1W55 A;  2Y6P A;  4IRQ A;  3CKV A;  3D5N A;  2JCK A;  5D92 A;  3V0P A;  1R7V A;  3E25 A;  5CMG X;  3DK5 A;  5FTV A;  4ASY A;  1V83 A;  2GGQ A;  2W0V A;  3ZLL A;  1HM9 A;  4HO9 A;  3OAM A;  3D8V A;  2BO6 A;  1H3M A;  1JYL A;  4B4G A;  1H5S D;  3ZF8 A;  2I5E A;  3V8Z A;  1WT0 A;  1NHE B;  1O7Q A;  3PKP A;  3V0Q A;  2RJ4 A;  1R82 A;  1OMZ A;  4MND A;  3IOJ A;  1G97 A;  1VGW A;  3I0E A;  1LL0 A;  2OEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...