3HL3A

2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
AMKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITGKEHMGDVVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVEEFTNQKEGAKVLLQSVDDPERFGVANIQNRKIIEIEEKPKEPKSSYAVTGIYLYDSKVFSYIKELKPSARGELEITDINNWYLKRGVLTYNEMSGWWTDAGTHVSLQRANALARDINFGKQFNGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate thymidylyltransferase
publication title 2.76 Angstrom Crystal Structure of a Putative Glucose-1-Phosphate Thymidylyltransferase from Bacillus anthracis in Complex with a Sucrose.
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 79
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3hl3A00
2XMEA 2Z87A 4Y64A 4HO3A 1VGWA 1R7UA 2RJ8A 4NAIA 3CKQA 1FGGA 1H5SA 4LW3A 3OKRA 3K8EA 3U2UA 1FOAA 4G87A 3SX7A 2RJ6A 4Y62A 2AESA 2FY7A 4FREA 1H3MA 4KC2A 5AJOA 3RMWA 5CMHA 3I0FA 4AYLA 5HS2A 2FYBA 5CQMX 2OEFA 1G2VA 1HM0A 1H5SC 4HO8A 2V0LA 3DJ4A 3D5NA 2XWLA 5C4EA 4EEMA 3F1YA 1LVWA 4JISA 4B4MA 5FU8A 1FGXA 1FZWA 1Z90A 4FRBA 1NMMB 2QH5A 1OMXA 1YP4A 4Y7FA 5FTSA 4EE3A 1H7GA 1LL3A 2Y4MA 4MNDA 4FRHA 5C4CA 1S4NA 2GGOA 3USQA 5CMGX 2QKXA 1ZI5A 2I5EA 5FU0A 5L6VA 1V84A 2ZU9A 2BO6A 3JUJA 5C36A 4IRQA 3RSBA 5JQQA 2WVMA 4D11A 4FCUA 1FXJA 1FG5N 1R81A 1WSZA 1KWSA 1NQIB 1INJA 5L6SA 2P73A 2JCLA 2RIXA 1HM9A 3PKPA 1FR8A 3SXBA 4AAWA 1GX4A 3SXCA 2WE9A 1ZI1A 3CKNA 4D48A 1FWYA 1G1LA 4CJ8A 1ZHJA 1ZCYA 4KNXA 1MP3A 3BCVA 2V0KA 2OI7A 1E5KA 1W57A 2RJ5A 1HV9A 3F1CA 2Y4JA 1IINA 2ZU7A 4FRDA 1R7TA 1ZJPA 3ST8A 2O1HA 4G3QA 2PGVA 1ZI4A 1ZIZA 2P6WA 3N9WA 5C48A 1SS9A 1XHBA 1W55A 1H5SB 5I1FA 2APCA 1ZJ2A 4LW6A 5C1LA 1VZUA 2W0VA 5FV9A 3OC9A 5C4FA 4CVHA 3KIAA 3ZGGA 3TQDA 5FTVA 4HO9A 3V8YA 4GBPA 4M2BA 1H7LA 1PZTA 1QGQA 2X5SA 4B3UA 4L41C 1VZXA 3OH0A 5DDTA 4Y9XA 3OH1A 3T7OA 1XZ6A 1ON6A 1GQCA 4HO0A 2A8UA 2FFUA 2RJ0A 4JD0A 4Y63A 2AECA 4Y7TA 3V8ZA 2D7IA 3U2TA 1ZDFA 2RIYA 3IOJA 3V0LA 4KT7A 1G23A 2YESA 1FXOA 4BMAA 4D0ZA 5C3BA 4KRVA 4Y6UA 4M4KA 1FR9A 1JYLA 1VPAA 1JYKA 4FCEA 4FRMA 1TVYA 3IOIA 3U0YA 4YS8A 1NKHB 1LL0A 5CQNX 1YP3A 1EYRA 1TZFA 5FYEA 1WT2A 3SX5A 1OQMB 1MC3A 2RIZA 5CMIA 2RITA 2RJ7A 2MZBA 5DDVA 3I0GA 3V0OA 4G3SA 5C3DA 1FO9A 4FQWA 5J49A 1G3LA 2AM3A 2FYCB 1K4VA 2OEGA 2RJ4A 4EE5A 2VFZA 3I0HA 2FYAA 2ICYA 3D98A 2WGZA 2RJ1A 2VXLA 3EE5A 1WT1A 1FRWA 3ZLLA 1ON8A 2YC3A 1H4DA 1R7YA 1G95A 1INIA 3Q80A 4C2SA 2VD4A 1WT3A 2VSHA 4Y7VA 1NF5B 2E8BA 4CJCA 3U2WA 4KPZA 4K6RA 2FFVA 3R3IA 1YROB 1G9RA 2VXMA 1H7QA 5AJPA 4J18A 2AGDA 4KXOA 3I0DA 4B42A 5CQPA 3OH3A 3T7MA 1HJLA 3ZF8A 5IFYA 1HM8A 1FO8A 1LZ7A 1H7HA 2NXVA 3V0MA 2VS3A 1O23B 3RMVA 3IOHA 3SPTA 4D11C 4Y7UA 1GQ9A 2E3DA 2OI6A 1ZJ0A 1TW5A 5EJ1A 1ZDGA 2JCJA 4KQLA 2QGIA 1H4CA 4CJBA 4HO4A 1OMZA 5C1HA 1ZCUA 2W0WA 5BXCA 2RJ9A 3OH4A 2O1FA 2AM5A 1H7TA 1GA8A 1H5TB 1S4PA 4M28A 4FRPA 4IRPA 4E1KA 3PKQA 3U0XA 2Z86A 1G0RA 2AE7A 4XWIA 3Q4SA 4D0TA 2BO4A 1MP4A 1NHEB 5CQOA 5C3AA 1WT0A 4EVWA 1R7VA 5CMJA 2ICXA 2P72A 1TW1A 1YP2A 2Y4KA 2ZU8A 2YC5A 2WEEA 5CMFX 1ZI3A 4NALA 3O3PA 2VSIA 3U2VA 3GUEA 2YQCA 4KPXA 4P00A 1LZIA 3CKVA 3OH2A 3V0PA 4ECMA 1V83A 3NGWA 3SXGA 1GWWA 3CKJA 4FRAA 3SX3A 4EE4A 1JV3A 2V0HA 1R7XA 4AYJA 5CQLX 1QG8A 2I7BA 4P02A 4Y7GA 3DUVA 4HO2A 2OI5A 4Y6NA 1WVCA 5C1GA 3ZLKA 3JTJA 4BQHA 2V0IA 5AJNA 3POLA 3SXDA 1H7EA 1ZJ1A 4G3PA 1VICA 4HCQA 4B4GA 3LW6A 1VH1A 1NWGB 4ARWA 2Y6PA 1O7OA 3I0EA 3E26A 5C47A 3V0NA 3V0QA 4UEGA 4B5BA 3FWWA 1R80A 2GGQA 2X65A 5IDTA 3CGXA 1QGSA 2PGYA 4DECA 4FRQA 4AC3A 1VH3A 3ZGFA 2VS4A 4MYBA 4NANA 2X5ZA 1H5RA 2JCOA 3DK5A 5C4DA 1G93A 1H5SD 2AH9A 4KC4A 5EIYA 1GX0A 3USRA 3SXEA 3V90A 2FYDB 1IIMA 1QWJA 3PNNA 3JUKA 2Q4JA 2XWNA 3QVBA 1ZCTA 1MP5A 1VGZA 4FRLA 2I5KA 4ASJA 4KC1A 2BO7A 4EEGA 5C4BA 5C38A 1I52A 2DPWA 2YQJA 5EJZA 2VS5A 3OAMA 4ASYA 1VM8A 1O7QA 1JVDA 3BRKX 5FUHA 4R7PA 4NAKA 3SXAA 1W77A 2V0JA 2PX7A 4EEAA 1ZJ3A 2CU2A 1GWVA 4B4BA 1ZCVA 1H7FA 3T7NA 4B2WA 2D0JA 2Y7AA 4DDZA 3I0LA 3TZTA 2AM4A 1ZJOA 4HG6A 2WVLA 4KNRA 2YQHA 3I0CA 1VGTA 3U2XA 3FOQA 1LZJA 1R82A 2O1GA 3K8DA 2X60A 4DE7A 3V91A 4HO6A 3CU0A 4HOCA 3D8VA 3OGZA 2D7RA 3R2WA 2XMHA 3I0IX 1LL2A 2YCMA 3HL3A 3I0JA 2YQSA 5IDSA 1H4EA 1JVGA 3CKOA 3I0KA 2WAWA 1O0RA 1V82A 2JCKA 1EZIA 1JV1A 2Y4LA 4EEOA 2A8WA 1VZTA 5C8RA 5C49A 1G97A 4ZDQA 3SX8A 2PA4A 3E25A 4B2XA 1H5RB 1HJJA 1LZ0A 2XWMA 4M2AA 1VGUA 1S4OA 1H5TA 2WVKA 2UX8A 1PZYB 1G8OA 3Q7UA 4HO5A 2BO8A 4FROA
chains in the Genus database with same CATH superfamily
2XMEA 2Z87A 4Y64A 4HO3A 1VGWA 1R7UA 2RJ8A 4NAIA 3CKQA 1FGGA 1H5SA 4LW3A 3OKRA 2VK9A 3K8EA 3U2UA 1FOAA 4G87A 3SX7A 2RJ6A 4Y62A 2AESA 2FY7A 4FREA 1H3MA 4KC2A 5AJOA 3RMWA 5CMHA 3I0FA 4AYLA 5HS2A 2FYBA 5CQMX 2OEFA 1G2VA 1HM0A 1H5SC 4HO8A 2V0LA 3DJ4A 3D5NA 2XWLA 5C4EA 4EEMA 3F1YA 1LVWA 4JISA 4B4MA 5FU8A 4O6MA 1FGXA 1FZWA 1Z90A 4FRBA 1NMMB 2QH5A 1OMXA 1YP4A 4Y7FA 5FTSA 4EE3A 1H7GA 1LL3A 2Y4MA 4MNDA 4FRHA 5C4CA 1S4NA 2GGOA 3USQA 5CMGX 2QKXA 1ZI5A 2I5EA 5FU0A 5L6VA 1V84A 2ZU9A 2BO6A 3JUJA 5C36A 4IRQA 3RSBA 5JQQA 2WVMA 4D11A 4FCUA 1FXJA 1FG5N 1R81A 1WSZA 1KWSA 1NQIB 2C0NA 1INJA 5L6SA 2J0AA 2P73A 2JCLA 2RIXA 1HM9A 3PKPA 1FR8A 3SXBA 4AAWA 1GX4A 3SXCA 2WE9A 1ZI1A 3CKNA 4D48A 1FWYA 1G1LA 4CJ8A 1ZHJA 1ZCYA 4KNXA 1MP3A 3BCVA 2V0KA 2OI7A 1E5KA 1W57A 2RJ5A 1HV9A 3F1CA 2Y4JA 1IINA 2ZU7A 4FRDA 1R7TA 1ZJPA 3ST8A 2O1HA 4G3QA 2PGVA 4O6NA 1ZI4A 1ZIZA 2P6WA 3N9WA 5C48A 1SS9A 1XHBA 1W55A 1H5SB 5I1FA 2APCA 1ZJ2A 4LW6A 5C1LA 1VZUA 2W0VA 5FV9A 3OC9A 5C4FA 4CVHA 3KIAA 3ZGGA 3TQDA 5FTVA 4HO9A 3V8YA 4GBPA 4M2BA 1H7LA 1PZTA 1QGQA 2X5SA 4B3UA 4L41C 1VZXA 3OH0A 5DDTA 4Y9XA 3OH1A 3T7OA 1XZ6A 1ON6A 1GQCA 4HO0A 2A8UA 2FFUA 2RJ0A 4JD0A 4Y63A 2AECA 4Y7TA 3V8ZA 2D7IA 3U2TA 1ZDFA 2RIYA 3IOJA 3V0LA 4KT7A 1G23A 2YESA 1FXOA 4BMAA 4D0ZA 5C3BA 4KRVA 4Y6UA 4M4KA 1FR9A 1JYLA 1VPAA 1JYKA 4FCEA 4FRMA 1TVYA 3IOIA 3U0YA 4YS8A 1NKHB 1LL0A 5CQNX 1YP3A 1EYRA 1TZFA 5FYEA 1WT2A 3SX5A 1OQMB 1MC3A 2RIZA 5CMIA 2RITA 2RJ7A 2MZBA 5DDVA 3I0GA 3V0OA 4G3SA 5C3DA 1FO9A 4FQWA 5J49A 1G3LA 2AM3A 2FYCB 1K4VA 2OEGA 2RJ4A 4EE5A 2VFZA 3I0HA 2FYAA 2ICYA 3D98A 2WGZA 2RJ1A 2VXLA 3EE5A 1WT1A 1FRWA 3ZLLA 1ON8A 2YC3A 1H4DA 1R7YA 1G95A 1INIA 3Q80A 4C2SA 2VD4A 1WT3A 2VSHA 4Y7VA 1NF5B 2E8BA 4CJCA 3U2WA 4KPZA 4K6RA 2FFVA 3R3IA 1YROB 1G9RA 2VXMA 1H7QA 5AJPA 4J18A 2AGDA 4KXOA 3I0DA 4B42A 5CQPA 3OH3A 3T7MA 1HJLA 3ZF8A 5IFYA 1HM8A 1FO8A 1LZ7A 1H7HA 2NXVA 3V0MA 2VS3A 1O23B 3RMVA 3IOHA 3SPTA 5D92A 4D11C 4Y7UA 1GQ9A 2E3DA 2OI6A 1ZJ0A 1TW5A 5EJ1A 1ZDGA 2JCJA 4KQLA 2QGIA 1H4CA 4CJBA 4HO4A 1OMZA 5C1HA 1ZCUA 2W0WA 5BXCA 2RJ9A 3OH4A 2O1FA 2AM5A 1H7TA 1GA8A 1H5TB 1S4PA 4M28A 4FRPA 4IRPA 4E1KA 3PKQA 3U0XA 2Z86A 1G0RA 2AE7A 4XWIA 3Q4SA 4D0TA 2BO4A 1MP4A 1NHEB 5CQOA 5C3AA 1WT0A 4EVWA 1R7VA 5CMJA 2ICXA 2J0BA 1TW1A 2P72A 1YP2A 2Y4KA 2ZU8A 2YC5A 2WEEA 5CMFX 1ZI3A 4NALA 3O3PA 2VSIA 3U2VA 3GUEA 2YQCA 4KPXA 4P00A 1LZIA 3CKVA 3OH2A 3V0PA 4ECMA 1V83A 3NGWA 3SXGA 1GWWA 3CKJA 4FRAA 3SX3A 4EE4A 1JV3A 2V0HA 1R7XA 4AYJA 5CQLX 1QG8A 2I7BA 4P02A 4Y7GA 3DUVA 4HO2A 2OI5A 4Y6NA 1WVCA 5C1GA 3ZLKA 3JTJA 4BQHA 2V0IA 5AJNA 3POLA 3SXDA 1H7EA 1ZJ1A 4G3PA 1VICA 4HCQA 4B4GA 3LW6A 1VH1A 1NWGB 4ARWA 2Y6PA 1O7OA 3I0EA 3E26A 5C47A 3V0NA 3V0QA 4UEGA 4B5BA 3FWWA 1R80A 2GGQA 2X65A 5IDTA 3CGXA 1QGSA 2PGYA 4DECA 4FRQA 5D91A 4AC3A 1VH3A 3ZGFA 2VS4A 4MYBA 4NANA 2X5ZA 1H5RA 2JCOA 3DK5A 5C4DA 1G93A 1H5SD 2AH9A 4KC4A 5EIYA 1GX0A 3USRA 3SXEA 4FIYA 3V90A 2FYDB 1IIMA 4Q7CA 1QWJA 3PNNA 3JUKA 2Q4JA 2XWNA 3QVBA 4FIXA 1ZCTA 1MP5A 1VGZA 4FRLA 2I5KA 4ASJA 4KC1A 2BO7A 4EEGA 5C4BA 5C38A 1I52A 2DPWA 2YQJA 5EJZA 2VS5A 3OAMA 4ASYA 1VM8A 1O7QA 1JVDA 3BRKX 5FUHA 4R7PA 4NAKA 3SXAA 1W77A 2V0JA 2PX7A 4EEAA 1ZJ3A 2CU2A 1GWVA 4B4BA 1ZCVA 1H7FA 3T7NA 4B2WA 2D0JA 2Y7AA 4DDZA 3I0LA 3TZTA 2AM4A 1ZJOA 4HG6A 2WVLA 4KNRA 2YQHA 3I0CA 1VGTA 3U2XA 3FOQA 1LZJA 1R82A 2O1GA 3K8DA 2X60A 4DE7A 3V91A 4HO6A 3CU0A 4HOCA 3D8VA 3OGZA 2D7RA 3R2WA 2XMHA 3I0IX 1LL2A 2YCMA 3HL3A 3I0JA 2YQSA 5IDSA 1H4EA 1JVGA 3CKOA 3I0KA 2WAWA 1O0RA 1V82A 2JCKA 1EZIA 1JV1A 2Y4LA 4EEOA 2A8WA 1VZTA 5C8RA 5C49A 1G97A 4ZDQA 3SX8A 2PA4A 3E25A 4B2XA 1H5RB 1HJJA 1LZ0A 2XWMA 4M2AA 4MIXA 1VGUA 1S4OA 1H5TA 2WVKA 2UX8A 1PZYB 1G8OA 3Q7UA 4HO5A 2BO8A 4FROA
chains in the Genus database with same CATH topology
2XMEA 2Z87A 4Y64A 4HO3A 1VGWA 1R7UA 2RJ8A 4NAIA 3CKQA 1FGGA 1H5SA 4LW3A 3OKRA 2VK9A 3K8EA 3U2UA 1FOAA 4G87A 3SX7A 2RJ6A 4Y62A 2AESA 2FY7A 4FREA 1H3MA 4KC2A 5AJOA 3RMWA 5CMHA 3I0FA 4AYLA 5HS2A 2FYBA 5CQMX 2OEFA 1G2VA 1HM0A 1H5SC 4HO8A 2V0LA 3DJ4A 3D5NA 2XWLA 5C4EA 4EEMA 3F1YA 1LVWA 4JISA 4B4MA 5FU8A 4O6MA 1FGXA 1FZWA 1Z90A 4FRBA 1NMMB 2QH5A 1OMXA 1YP4A 4Y7FA 5FTSA 4EE3A 1H7GA 1LL3A 2Y4MA 4MNDA 4FRHA 5C4CA 1S4NA 2GGOA 3USQA 5CMGX 2QKXA 1ZI5A 2I5EA 5FU0A 5L6VA 1V84A 2ZU9A 2BO6A 3JUJA 5C36A 4IRQA 3RSBA 5JQQA 2WVMA 4D11A 4FCUA 1FXJA 1FG5N 1R81A 1WSZA 1KWSA 1NQIB 2C0NA 1INJA 5L6SA 2J0AA 2P73A 2JCLA 2RIXA 1HM9A 3PKPA 1FR8A 3SXBA 4AAWA 1GX4A 3SXCA 2WE9A 1ZI1A 3CKNA 4D48A 1FWYA 1G1LA 4CJ8A 1ZHJA 1ZCYA 4KNXA 1MP3A 3BCVA 2V0KA 2OI7A 1E5KA 1W57A 2RJ5A 1HV9A 3F1CA 2Y4JA 1IINA 2ZU7A 4FRDA 1R7TA 1ZJPA 3ST8A 2O1HA 4G3QA 2PGVA 4O6NA 1ZI4A 1ZIZA 2P6WA 3N9WA 5C48A 1SS9A 1XHBA 1W55A 1H5SB 5I1FA 2APCA 1ZJ2A 4LW6A 5C1LA 1VZUA 2W0VA 5FV9A 3OC9A 5C4FA 4CVHA 3KIAA 3ZGGA 3TQDA 5FTVA 4HO9A 3V8YA 4GBPA 4M2BA 1H7LA 1PZTA 1QGQA 2X5SA 4B3UA 4L41C 1VZXA 3OH0A 5DDTA 4Y9XA 3OH1A 3T7OA 1XZ6A 1ON6A 1GQCA 4HO0A 2A8UA 2FFUA 2RJ0A 4JD0A 4Y63A 2AECA 4Y7TA 3V8ZA 2D7IA 3U2TA 1ZDFA 2RIYA 3IOJA 3V0LA 4KT7A 1G23A 2YESA 1FXOA 4BMAA 4D0ZA 5C3BA 4KRVA 4Y6UA 4M4KA 1FR9A 1JYLA 1VPAA 1JYKA 4FCEA 4FRMA 1TVYA 3IOIA 3U0YA 4YS8A 1NKHB 1LL0A 5CQNX 1YP3A 1EYRA 1TZFA 5FYEA 1WT2A 3SX5A 1OQMB 1MC3A 2RIZA 5CMIA 2RITA 2RJ7A 2MZBA 5DDVA 3I0GA 3V0OA 4G3SA 5C3DA 1FO9A 4FQWA 5J49A 1G3LA 2AM3A 2FYCB 1K4VA 2OEGA 2RJ4A 4EE5A 2VFZA 3I0HA 2FYAA 2ICYA 3D98A 2WGZA 2RJ1A 2VXLA 3EE5A 1WT1A 1FRWA 3ZLLA 1ON8A 2YC3A 1H4DA 1R7YA 1G95A 1INIA 3Q80A 4C2SA 2VD4A 1WT3A 2VSHA 4Y7VA 1NF5B 2E8BA 4CJCA 3U2WA 4KPZA 4K6RA 2FFVA 3R3IA 1YROB 1G9RA 2VXMA 1H7QA 5AJPA 4J18A 2AGDA 4KXOA 3I0DA 4B42A 5CQPA 3OH3A 3T7MA 1HJLA 3ZF8A 5IFYA 1HM8A 1FO8A 1LZ7A 1H7HA 2NXVA 3V0MA 2VS3A 1O23B 3RMVA 3IOHA 3SPTA 5D92A 4D11C 4Y7UA 1GQ9A 2E3DA 2OI6A 1ZJ0A 1TW5A 5EJ1A 1ZDGA 2JCJA 4KQLA 2QGIA 1H4CA 4CJBA 4HO4A 1OMZA 5C1HA 1ZCUA 2W0WA 5BXCA 2RJ9A 3OH4A 2O1FA 2AM5A 1H7TA 1GA8A 1H5TB 1S4PA 4M28A 4FRPA 4IRPA 4E1KA 3PKQA 3U0XA 2Z86A 1G0RA 2AE7A 4XWIA 3Q4SA 4D0TA 2BO4A 1MP4A 1NHEB 5CQOA 5C3AA 1WT0A 4EVWA 1R7VA 5CMJA 2ICXA 2J0BA 1TW1A 2P72A 1YP2A 2Y4KA 2ZU8A 2YC5A 2WEEA 5CMFX 1ZI3A 4NALA 3O3PA 2VSIA 3U2VA 3GUEA 2YQCA 4KPXA 4P00A 1LZIA 3CKVA 3OH2A 3V0PA 4ECMA 1V83A 3NGWA 3SXGA 1GWWA 3CKJA 4FRAA 3SX3A 4EE4A 1JV3A 2V0HA 1R7XA 4AYJA 5CQLX 1QG8A 2I7BA 4P02A 4Y7GA 3DUVA 4HO2A 2OI5A 4Y6NA 1WVCA 5C1GA 3ZLKA 3JTJA 4BQHA 2V0IA 5AJNA 3POLA 3SXDA 1H7EA 1ZJ1A 4G3PA 1VICA 4HCQA 4B4GA 3LW6A 1VH1A 1NWGB 4ARWA 2Y6PA 1O7OA 3I0EA 3E26A 5C47A 3V0NA 3V0QA 4UEGA 4B5BA 3FWWA 1R80A 2GGQA 2X65A 5IDTA 3CGXA 1QGSA 2PGYA 4DECA 4FRQA 5D91A 4AC3A 1VH3A 3ZGFA 2VS4A 4MYBA 4NANA 2X5ZA 1H5RA 2JCOA 3DK5A 5C4DA 1G93A 1H5SD 2AH9A 4KC4A 5EIYA 1GX0A 3USRA 3SXEA 4FIYA 3V90A 2FYDB 1IIMA 4Q7CA 1QWJA 3PNNA 3JUKA 2Q4JA 2XWNA 3QVBA 4FIXA 1ZCTA 1MP5A 1VGZA 4FRLA 2I5KA 4ASJA 4KC1A 2BO7A 4EEGA 5C4BA 5C38A 1I52A 2DPWA 2YQJA 5EJZA 2VS5A 3OAMA 4ASYA 1VM8A 1O7QA 1JVDA 3BRKX 5FUHA 4R7PA 4NAKA 3SXAA 1W77A 2V0JA 2PX7A 4EEAA 1ZJ3A 2CU2A 1GWVA 4B4BA 1ZCVA 1H7FA 3T7NA 4B2WA 2D0JA 2Y7AA 4DDZA 3I0LA 3TZTA 2AM4A 1ZJOA 4HG6A 2WVLA 4KNRA 2YQHA 3I0CA 1VGTA 3U2XA 3FOQA 1LZJA 1R82A 2O1GA 3K8DA 2X60A 4DE7A 3V91A 4HO6A 3CU0A 4HOCA 3D8VA 3OGZA 2D7RA 3R2WA 2XMHA 3I0IX 1LL2A 2YCMA 3HL3A 3I0JA 2YQSA 5IDSA 1H4EA 1JVGA 3CKOA 3I0KA 2WAWA 1O0RA 1V82A 2JCKA 1EZIA 1JV1A 2Y4LA 4EEOA 2A8WA 1VZTA 5C8RA 5C49A 1G97A 4ZDQA 3SX8A 2PA4A 3E25A 4B2XA 1H5RB 1HJJA 1LZ0A 2XWMA 4M2AA 4MIXA 1VGUA 1S4OA 1H5TA 2WVKA 2UX8A 1PZYB 1G8OA 3Q7UA 4HO5A 2BO8A 4FROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XME A;  2Z87 A;  4Y64 A;  4HO3 A;  1VGW A;  1R7U A;  2RJ8 A;  4NAI A;  3CKQ A;  1FGG A;  1H5S A;  4LW3 A;  3OKR A;  3K8E A;  3U2U A;  1FOA A;  4G87 A;  3SX7 A;  2RJ6 A;  4Y62 A;  2AES A;  2FY7 A;  4FRE A;  1H3M A;  4KC2 A;  5AJO A;  3RMW A;  5CMH A;  3I0F A;  4AYL A;  5HS2 A;  2FYB A;  5CQM X;  2OEF A;  1G2V A;  1HM0 A;  1H5S C;  4HO8 A;  2V0L A;  3DJ4 A;  3D5N A;  2XWL A;  5C4E A;  4EEM A;  3F1Y A;  1LVW A;  4JIS A;  4B4M A;  5FU8 A;  1FGX A;  1FZW A;  1Z90 A;  4FRB A;  1NMM B;  2QH5 A;  1OMX A;  1YP4 A;  4Y7F A;  5FTS A;  4EE3 A;  1H7G A;  1LL3 A;  2Y4M A;  4MND A;  4FRH A;  5C4C A;  1S4N A;  2GGO A;  3USQ A;  5CMG X;  2QKX A;  1ZI5 A;  2I5E A;  5FU0 A;  5L6V A;  1V84 A;  2ZU9 A;  2BO6 A;  3JUJ A;  5C36 A;  4IRQ A;  3RSB A;  5JQQ A;  2WVM A;  4D11 A;  4FCU A;  1FXJ A;  1FG5 N;  1R81 A;  1WSZ A;  1KWS A;  1NQI B;  1INJ A;  5L6S A;  2P73 A;  2JCL A;  2RIX A;  1HM9 A;  3PKP A;  1FR8 A;  3SXB A;  4AAW A;  1GX4 A;  3SXC A;  2WE9 A;  1ZI1 A;  3CKN A;  4D48 A;  1FWY A;  1G1L A;  4CJ8 A;  1ZHJ A;  1ZCY A;  4KNX A;  1MP3 A;  3BCV A;  2V0K A;  2OI7 A;  1E5K A;  1W57 A;  2RJ5 A;  1HV9 A;  3F1C A;  2Y4J A;  1IIN A;  2ZU7 A;  4FRD A;  1R7T A;  1ZJP A;  3ST8 A;  2O1H A;  4G3Q A;  2PGV A;  1ZI4 A;  1ZIZ A;  2P6W A;  3N9W A;  5C48 A;  1SS9 A;  1XHB A;  1W55 A;  1H5S B;  5I1F A;  2APC A;  1ZJ2 A;  4LW6 A;  5C1L A;  1VZU A;  2W0V A;  5FV9 A;  3OC9 A;  5C4F A;  4CVH A;  3KIA A;  3ZGG A;  3TQD A;  5FTV A;  4HO9 A;  3V8Y A;  4GBP A;  4M2B A;  1H7L A;  1PZT A;  1QGQ A;  2X5S A;  4B3U A;  4L41 C;  1VZX A;  3OH0 A;  5DDT A;  4Y9X A;  3OH1 A;  3T7O A;  1XZ6 A;  1ON6 A;  1GQC A;  4HO0 A;  2A8U A;  2FFU A;  2RJ0 A;  4JD0 A;  4Y63 A;  2AEC A;  4Y7T A;  3V8Z A;  2D7I A;  3U2T A;  1ZDF A;  2RIY A;  3IOJ A;  3V0L A;  4KT7 A;  1G23 A;  2YES A;  1FXO A;  4BMA A;  4D0Z A;  5C3B A;  4KRV A;  4Y6U A;  4M4K A;  1FR9 A;  1JYL A;  1VPA A;  1JYK A;  4FCE A;  4FRM A;  1TVY A;  3IOI A;  3U0Y A;  4YS8 A;  1NKH B;  1LL0 A;  5CQN X;  1YP3 A;  1EYR A;  1TZF A;  5FYE A;  1WT2 A;  3SX5 A;  1OQM B;  1MC3 A;  2RIZ A;  5CMI A;  2RIT A;  2RJ7 A;  2MZB A;  5DDV A;  3I0G A;  3V0O A;  4G3S A;  5C3D A;  1FO9 A;  4FQW A;  5J49 A;  1G3L A;  2AM3 A;  2FYC B;  1K4V A;  2OEG A;  2RJ4 A;  4EE5 A;  2VFZ A;  3I0H A;  2FYA A;  2ICY A;  3D98 A;  2WGZ A;  2RJ1 A;  2VXL A;  3EE5 A;  1WT1 A;  1FRW A;  3ZLL A;  1ON8 A;  2YC3 A;  1H4D A;  1R7Y A;  1G95 A;  1INI A;  3Q80 A;  4C2S A;  2VD4 A;  1WT3 A;  2VSH A;  4Y7V A;  1NF5 B;  2E8B A;  4CJC A;  3U2W A;  4KPZ A;  4K6R A;  2FFV A;  3R3I A;  1YRO B;  1G9R A;  2VXM A;  1H7Q A;  5AJP A;  4J18 A;  2AGD A;  4KXO A;  3I0D A;  4B42 A;  5CQP A;  3OH3 A;  3T7M A;  1HJL A;  3ZF8 A;  5IFY A;  1HM8 A;  1FO8 A;  1LZ7 A;  1H7H A;  2NXV A;  3V0M A;  2VS3 A;  1O23 B;  3RMV A;  3IOH A;  3SPT A;  4D11 C;  4Y7U A;  1GQ9 A;  2E3D A;  2OI6 A;  1ZJ0 A;  1TW5 A;  5EJ1 A;  1ZDG A;  2JCJ A;  4KQL A;  2QGI A;  1H4C A;  4CJB A;  4HO4 A;  1OMZ A;  5C1H A;  1ZCU A;  2W0W A;  5BXC A;  2RJ9 A;  3OH4 A;  2O1F A;  2AM5 A;  1H7T A;  1GA8 A;  1H5T B;  1S4P A;  4M28 A;  4FRP A;  4IRP A;  4E1K A;  3PKQ A;  3U0X A;  2Z86 A;  1G0R A;  2AE7 A;  4XWI A;  3Q4S A;  4D0T A;  2BO4 A;  1MP4 A;  1NHE B;  5CQO A;  5C3A A;  1WT0 A;  4EVW A;  1R7V A;  5CMJ A;  2ICX A;  2P72 A;  1TW1 A;  1YP2 A;  2Y4K A;  2ZU8 A;  2YC5 A;  2WEE A;  5CMF X;  1ZI3 A;  4NAL A;  3O3P A;  2VSI A;  3U2V A;  3GUE A;  2YQC A;  4KPX A;  4P00 A;  1LZI A;  3CKV A;  3OH2 A;  3V0P A;  4ECM A;  1V83 A;  3NGW A;  3SXG A;  1GWW A;  3CKJ A;  4FRA A;  3SX3 A;  4EE4 A;  1JV3 A;  2V0H A;  1R7X A;  4AYJ A;  5CQL X;  1QG8 A;  2I7B A;  4P02 A;  4Y7G A;  3DUV A;  4HO2 A;  2OI5 A;  4Y6N A;  1WVC A;  5C1G A;  3ZLK A;  3JTJ A;  4BQH A;  2V0I A;  5AJN A;  3POL A;  3SXD A;  1H7E A;  1ZJ1 A;  4G3P A;  1VIC A;  4HCQ A;  4B4G A;  3LW6 A;  1VH1 A;  1NWG B;  4ARW A;  2Y6P A;  1O7O A;  3I0E A;  3E26 A;  5C47 A;  3V0N A;  3V0Q A;  4UEG A;  4B5B A;  3FWW A;  1R80 A;  2GGQ A;  2X65 A;  5IDT A;  3CGX A;  1QGS A;  2PGY A;  4DEC A;  4FRQ A;  4AC3 A;  1VH3 A;  3ZGF A;  2VS4 A;  4MYB A;  4NAN A;  2X5Z A;  1H5R A;  2JCO A;  3DK5 A;  5C4D A;  1G93 A;  1H5S D;  2AH9 A;  4KC4 A;  5EIY A;  1GX0 A;  3USR A;  3SXE A;  3V90 A;  2FYD B;  1IIM A;  1QWJ A;  3PNN A;  3JUK A;  2Q4J A;  2XWN A;  3QVB A;  1ZCT A;  1MP5 A;  1VGZ A;  4FRL A;  2I5K A;  4ASJ A;  4KC1 A;  2BO7 A;  4EEG A;  5C4B A;  5C38 A;  1I52 A;  2DPW A;  2YQJ A;  5EJZ A;  2VS5 A;  3OAM A;  4ASY A;  1VM8 A;  1O7Q A;  1JVD A;  3BRK X;  5FUH A;  4R7P A;  4NAK A;  3SXA A;  1W77 A;  2V0J A;  2PX7 A;  4EEA A;  1ZJ3 A;  2CU2 A;  1GWV A;  4B4B A;  1ZCV A;  1H7F A;  3T7N A;  4B2W A;  2D0J A;  2Y7A A;  4DDZ A;  3I0L A;  3TZT A;  2AM4 A;  1ZJO A;  4HG6 A;  2WVL A;  4KNR A;  2YQH A;  3I0C A;  1VGT A;  3U2X A;  3FOQ A;  1LZJ A;  1R82 A;  2O1G A;  3K8D A;  2X60 A;  4DE7 A;  3V91 A;  4HO6 A;  3CU0 A;  4HOC A;  3D8V A;  3OGZ A;  2D7R A;  3R2W A;  2XMH A;  3I0I X;  1LL2 A;  2YCM A;  3HL3 A;  3I0J A;  2YQS A;  5IDS A;  1H4E A;  1JVG A;  3CKO A;  3I0K A;  2WAW A;  1O0R A;  1V82 A;  2JCK A;  1EZI A;  1JV1 A;  2Y4L A;  4EEO A;  2A8W A;  1VZT A;  5C8R A;  5C49 A;  1G97 A;  4ZDQ A;  3SX8 A;  2PA4 A;  3E25 A;  4B2X A;  1H5R B;  1HJJ A;  1LZ0 A;  2XWM A;  4M2A A;  1VGU A;  1S4O A;  1H5T A;  2WVK A;  2UX8 A;  1PZY B;  1G8O A;  3Q7U A;  4HO5 A;  2BO8 A;  4FRO A; 
#chains in the Genus database with same CATH topology
 2XME A;  2Z87 A;  4Y64 A;  4HO3 A;  1VGW A;  1R7U A;  2RJ8 A;  4NAI A;  3CKQ A;  1FGG A;  1H5S A;  4LW3 A;  3OKR A;  2VK9 A;  3K8E A;  3U2U A;  1FOA A;  4G87 A;  3SX7 A;  2RJ6 A;  4Y62 A;  2AES A;  2FY7 A;  4FRE A;  1H3M A;  4KC2 A;  5AJO A;  3RMW A;  5CMH A;  3I0F A;  4AYL A;  5HS2 A;  2FYB A;  5CQM X;  2OEF A;  1G2V A;  1HM0 A;  1H5S C;  4HO8 A;  2V0L A;  3DJ4 A;  3D5N A;  2XWL A;  5C4E A;  4EEM A;  3F1Y A;  1LVW A;  4JIS A;  4B4M A;  5FU8 A;  4O6M A;  1FGX A;  1FZW A;  1Z90 A;  4FRB A;  1NMM B;  2QH5 A;  1OMX A;  1YP4 A;  4Y7F A;  5FTS A;  4EE3 A;  1H7G A;  1LL3 A;  2Y4M A;  4MND A;  4FRH A;  5C4C A;  1S4N A;  2GGO A;  3USQ A;  5CMG X;  2QKX A;  1ZI5 A;  2I5E A;  5FU0 A;  5L6V A;  1V84 A;  2ZU9 A;  2BO6 A;  3JUJ A;  5C36 A;  4IRQ A;  3RSB A;  5JQQ A;  2WVM A;  4D11 A;  4FCU A;  1FXJ A;  1FG5 N;  1R81 A;  1WSZ A;  1KWS A;  1NQI B;  2C0N A;  1INJ A;  5L6S A;  2J0A A;  2P73 A;  2JCL A;  2RIX A;  1HM9 A;  3PKP A;  1FR8 A;  3SXB A;  4AAW A;  1GX4 A;  3SXC A;  2WE9 A;  1ZI1 A;  3CKN A;  4D48 A;  1FWY A;  1G1L A;  4CJ8 A;  1ZHJ A;  1ZCY A;  4KNX A;  1MP3 A;  3BCV A;  2V0K A;  2OI7 A;  1E5K A;  1W57 A;  2RJ5 A;  1HV9 A;  3F1C A;  2Y4J A;  1IIN A;  2ZU7 A;  4FRD A;  1R7T A;  1ZJP A;  3ST8 A;  2O1H A;  4G3Q A;  2PGV A;  4O6N A;  1ZI4 A;  1ZIZ A;  2P6W A;  3N9W A;  5C48 A;  1SS9 A;  1XHB A;  1W55 A;  1H5S B;  5I1F A;  2APC A;  1ZJ2 A;  4LW6 A;  5C1L A;  1VZU A;  2W0V A;  5FV9 A;  3OC9 A;  5C4F A;  4CVH A;  3KIA A;  3ZGG A;  3TQD A;  5FTV A;  4HO9 A;  3V8Y A;  4GBP A;  4M2B A;  1H7L A;  1PZT A;  1QGQ A;  2X5S A;  4B3U A;  4L41 C;  1VZX A;  3OH0 A;  5DDT A;  4Y9X A;  3OH1 A;  3T7O A;  1XZ6 A;  1ON6 A;  1GQC A;  4HO0 A;  2A8U A;  2FFU A;  2RJ0 A;  4JD0 A;  4Y63 A;  2AEC A;  4Y7T A;  3V8Z A;  2D7I A;  3U2T A;  1ZDF A;  2RIY A;  3IOJ A;  3V0L A;  4KT7 A;  1G23 A;  2YES A;  1FXO A;  4BMA A;  4D0Z A;  5C3B A;  4KRV A;  4Y6U A;  4M4K A;  1FR9 A;  1JYL A;  1VPA A;  1JYK A;  4FCE A;  4FRM A;  1TVY A;  3IOI A;  3U0Y A;  4YS8 A;  1NKH B;  1LL0 A;  5CQN X;  1YP3 A;  1EYR A;  1TZF A;  5FYE A;  1WT2 A;  3SX5 A;  1OQM B;  1MC3 A;  2RIZ A;  5CMI A;  2RIT A;  2RJ7 A;  2MZB A;  5DDV A;  3I0G A;  3V0O A;  4G3S A;  5C3D A;  1FO9 A;  4FQW A;  5J49 A;  1G3L A;  2AM3 A;  2FYC B;  1K4V A;  2OEG A;  2RJ4 A;  4EE5 A;  2VFZ A;  3I0H A;  2FYA A;  2ICY A;  3D98 A;  2WGZ A;  2RJ1 A;  2VXL A;  3EE5 A;  1WT1 A;  1FRW A;  3ZLL A;  1ON8 A;  2YC3 A;  1H4D A;  1R7Y A;  1G95 A;  1INI A;  3Q80 A;  4C2S A;  2VD4 A;  1WT3 A;  2VSH A;  4Y7V A;  1NF5 B;  2E8B A;  4CJC A;  3U2W A;  4KPZ A;  4K6R A;  2FFV A;  3R3I A;  1YRO B;  1G9R A;  2VXM A;  1H7Q A;  5AJP A;  4J18 A;  2AGD A;  4KXO A;  3I0D A;  4B42 A;  5CQP A;  3OH3 A;  3T7M A;  1HJL A;  3ZF8 A;  5IFY A;  1HM8 A;  1FO8 A;  1LZ7 A;  1H7H A;  2NXV A;  3V0M A;  2VS3 A;  1O23 B;  3RMV A;  3IOH A;  3SPT A;  5D92 A;  4D11 C;  4Y7U A;  1GQ9 A;  2E3D A;  2OI6 A;  1ZJ0 A;  1TW5 A;  5EJ1 A;  1ZDG A;  2JCJ A;  4KQL A;  2QGI A;  1H4C A;  4CJB A;  4HO4 A;  1OMZ A;  5C1H A;  1ZCU A;  2W0W A;  5BXC A;  2RJ9 A;  3OH4 A;  2O1F A;  2AM5 A;  1H7T A;  1GA8 A;  1H5T B;  1S4P A;  4M28 A;  4FRP A;  4IRP A;  4E1K A;  3PKQ A;  3U0X A;  2Z86 A;  1G0R A;  2AE7 A;  4XWI A;  3Q4S A;  4D0T A;  2BO4 A;  1MP4 A;  1NHE B;  5CQO A;  5C3A A;  1WT0 A;  4EVW A;  1R7V A;  5CMJ A;  2ICX A;  2J0B A;  1TW1 A;  2P72 A;  1YP2 A;  2Y4K A;  2ZU8 A;  2YC5 A;  2WEE A;  5CMF X;  1ZI3 A;  4NAL A;  3O3P A;  2VSI A;  3U2V A;  3GUE A;  2YQC A;  4KPX A;  4P00 A;  1LZI A;  3CKV A;  3OH2 A;  3V0P A;  4ECM A;  1V83 A;  3NGW A;  3SXG A;  1GWW A;  3CKJ A;  4FRA A;  3SX3 A;  4EE4 A;  1JV3 A;  2V0H A;  1R7X A;  4AYJ A;  5CQL X;  1QG8 A;  2I7B A;  4P02 A;  4Y7G A;  3DUV A;  4HO2 A;  2OI5 A;  4Y6N A;  1WVC A;  5C1G A;  3ZLK A;  3JTJ A;  4BQH A;  2V0I A;  5AJN A;  3POL A;  3SXD A;  1H7E A;  1ZJ1 A;  4G3P A;  1VIC A;  4HCQ A;  4B4G A;  3LW6 A;  1VH1 A;  1NWG B;  4ARW A;  2Y6P A;  1O7O A;  3I0E A;  3E26 A;  5C47 A;  3V0N A;  3V0Q A;  4UEG A;  4B5B A;  3FWW A;  1R80 A;  2GGQ A;  2X65 A;  5IDT A;  3CGX A;  1QGS A;  2PGY A;  4DEC A;  4FRQ A;  5D91 A;  4AC3 A;  1VH3 A;  3ZGF A;  2VS4 A;  4MYB A;  4NAN A;  2X5Z A;  1H5R A;  2JCO A;  3DK5 A;  5C4D A;  1G93 A;  1H5S D;  2AH9 A;  4KC4 A;  5EIY A;  1GX0 A;  3USR A;  3SXE A;  4FIY A;  3V90 A;  2FYD B;  1IIM A;  4Q7C A;  1QWJ A;  3PNN A;  3JUK A;  2Q4J A;  2XWN A;  3QVB A;  4FIX A;  1ZCT A;  1MP5 A;  1VGZ A;  4FRL A;  2I5K A;  4ASJ A;  4KC1 A;  2BO7 A;  4EEG A;  5C4B A;  5C38 A;  1I52 A;  2DPW A;  2YQJ A;  5EJZ A;  2VS5 A;  3OAM A;  4ASY A;  1VM8 A;  1O7Q A;  1JVD A;  3BRK X;  5FUH A;  4R7P A;  4NAK A;  3SXA A;  1W77 A;  2V0J A;  2PX7 A;  4EEA A;  1ZJ3 A;  2CU2 A;  1GWV A;  4B4B A;  1ZCV A;  1H7F A;  3T7N A;  4B2W A;  2D0J A;  2Y7A A;  4DDZ A;  3I0L A;  3TZT A;  2AM4 A;  1ZJO A;  4HG6 A;  2WVL A;  4KNR A;  2YQH A;  3I0C A;  1VGT A;  3U2X A;  3FOQ A;  1LZJ A;  1R82 A;  2O1G A;  3K8D A;  2X60 A;  4DE7 A;  3V91 A;  4HO6 A;  3CU0 A;  4HOC A;  3D8V A;  3OGZ A;  2D7R A;  3R2W A;  2XMH A;  3I0I X;  1LL2 A;  2YCM A;  3HL3 A;  3I0J A;  2YQS A;  5IDS A;  1H4E A;  1JVG A;  3CKO A;  3I0K A;  2WAW A;  1O0R A;  1V82 A;  2JCK A;  1EZI A;  1JV1 A;  2Y4L A;  4EEO A;  2A8W A;  1VZT A;  5C8R A;  5C49 A;  1G97 A;  4ZDQ A;  3SX8 A;  2PA4 A;  3E25 A;  4B2X A;  1H5R B;  1HJJ A;  1LZ0 A;  2XWM A;  4M2A A;  4MIX A;  1VGU A;  1S4O A;  1H5T A;  2WVK A;  2UX8 A;  1PZY B;  1G8O A;  3Q7U A;  4HO5 A;  2BO8 A;  4FRO A; 
#chains in the Genus database with same CATH homology
 2XME A;  2Z87 A;  4Y64 A;  4HO3 A;  1VGW A;  1R7U A;  2RJ8 A;  4NAI A;  3CKQ A;  1FGG A;  1H5S A;  4LW3 A;  3OKR A;  2VK9 A;  3K8E A;  3U2U A;  1FOA A;  4G87 A;  3SX7 A;  2RJ6 A;  4Y62 A;  2AES A;  2FY7 A;  4FRE A;  1H3M A;  4KC2 A;  5AJO A;  3RMW A;  5CMH A;  3I0F A;  4AYL A;  5HS2 A;  2FYB A;  5CQM X;  2OEF A;  1G2V A;  1HM0 A;  1H5S C;  4HO8 A;  2V0L A;  3DJ4 A;  3D5N A;  2XWL A;  5C4E A;  4EEM A;  3F1Y A;  1LVW A;  4JIS A;  4B4M A;  5FU8 A;  4O6M A;  1FGX A;  1FZW A;  1Z90 A;  4FRB A;  1NMM B;  2QH5 A;  1OMX A;  1YP4 A;  4Y7F A;  5FTS A;  4EE3 A;  1H7G A;  1LL3 A;  2Y4M A;  4MND A;  4FRH A;  5C4C A;  1S4N A;  2GGO A;  3USQ A;  5CMG X;  2QKX A;  1ZI5 A;  2I5E A;  5FU0 A;  5L6V A;  1V84 A;  2ZU9 A;  2BO6 A;  3JUJ A;  5C36 A;  4IRQ A;  3RSB A;  5JQQ A;  2WVM A;  4D11 A;  4FCU A;  1FXJ A;  1FG5 N;  1R81 A;  1WSZ A;  1KWS A;  1NQI B;  2C0N A;  1INJ A;  5L6S A;  2J0A A;  2P73 A;  2JCL A;  2RIX A;  1HM9 A;  3PKP A;  1FR8 A;  3SXB A;  4AAW A;  1GX4 A;  3SXC A;  2WE9 A;  1ZI1 A;  3CKN A;  4D48 A;  1FWY A;  1G1L A;  4CJ8 A;  1ZHJ A;  1ZCY A;  4KNX A;  1MP3 A;  3BCV A;  2V0K A;  2OI7 A;  1E5K A;  1W57 A;  2RJ5 A;  1HV9 A;  3F1C A;  2Y4J A;  1IIN A;  2ZU7 A;  4FRD A;  1R7T A;  1ZJP A;  3ST8 A;  2O1H A;  4G3Q A;  2PGV A;  4O6N A;  1ZI4 A;  1ZIZ A;  2P6W A;  3N9W A;  5C48 A;  1SS9 A;  1XHB A;  1W55 A;  1H5S B;  5I1F A;  2APC A;  1ZJ2 A;  4LW6 A;  5C1L A;  1VZU A;  2W0V A;  5FV9 A;  3OC9 A;  5C4F A;  4CVH A;  3KIA A;  3ZGG A;  3TQD A;  5FTV A;  4HO9 A;  3V8Y A;  4GBP A;  4M2B A;  1H7L A;  1PZT A;  1QGQ A;  2X5S A;  4B3U A;  4L41 C;  1VZX A;  3OH0 A;  5DDT A;  4Y9X A;  3OH1 A;  3T7O A;  1XZ6 A;  1ON6 A;  1GQC A;  4HO0 A;  2A8U A;  2FFU A;  2RJ0 A;  4JD0 A;  4Y63 A;  2AEC A;  4Y7T A;  3V8Z A;  2D7I A;  3U2T A;  1ZDF A;  2RIY A;  3IOJ A;  3V0L A;  4KT7 A;  1G23 A;  2YES A;  1FXO A;  4BMA A;  4D0Z A;  5C3B A;  4KRV A;  4Y6U A;  4M4K A;  1FR9 A;  1JYL A;  1VPA A;  1JYK A;  4FCE A;  4FRM A;  1TVY A;  3IOI A;  3U0Y A;  4YS8 A;  1NKH B;  1LL0 A;  5CQN X;  1YP3 A;  1EYR A;  1TZF A;  5FYE A;  1WT2 A;  3SX5 A;  1OQM B;  1MC3 A;  2RIZ A;  5CMI A;  2RIT A;  2RJ7 A;  2MZB A;  5DDV A;  3I0G A;  3V0O A;  4G3S A;  5C3D A;  1FO9 A;  4FQW A;  5J49 A;  1G3L A;  2AM3 A;  2FYC B;  1K4V A;  2OEG A;  2RJ4 A;  4EE5 A;  2VFZ A;  3I0H A;  2FYA A;  2ICY A;  3D98 A;  2WGZ A;  2RJ1 A;  2VXL A;  3EE5 A;  1WT1 A;  1FRW A;  3ZLL A;  1ON8 A;  2YC3 A;  1H4D A;  1R7Y A;  1G95 A;  1INI A;  3Q80 A;  4C2S A;  2VD4 A;  1WT3 A;  2VSH A;  4Y7V A;  1NF5 B;  2E8B A;  4CJC A;  3U2W A;  4KPZ A;  4K6R A;  2FFV A;  3R3I A;  1YRO B;  1G9R A;  2VXM A;  1H7Q A;  5AJP A;  4J18 A;  2AGD A;  4KXO A;  3I0D A;  4B42 A;  5CQP A;  3OH3 A;  3T7M A;  1HJL A;  3ZF8 A;  5IFY A;  1HM8 A;  1FO8 A;  1LZ7 A;  1H7H A;  2NXV A;  3V0M A;  2VS3 A;  1O23 B;  3RMV A;  3IOH A;  3SPT A;  5D92 A;  4D11 C;  4Y7U A;  1GQ9 A;  2E3D A;  2OI6 A;  1ZJ0 A;  1TW5 A;  5EJ1 A;  1ZDG A;  2JCJ A;  4KQL A;  2QGI A;  1H4C A;  4CJB A;  4HO4 A;  1OMZ A;  5C1H A;  1ZCU A;  2W0W A;  5BXC A;  2RJ9 A;  3OH4 A;  2O1F A;  2AM5 A;  1H7T A;  1GA8 A;  1H5T B;  1S4P A;  4M28 A;  4FRP A;  4IRP A;  4E1K A;  3PKQ A;  3U0X A;  2Z86 A;  1G0R A;  2AE7 A;  4XWI A;  3Q4S A;  4D0T A;  2BO4 A;  1MP4 A;  1NHE B;  5CQO A;  5C3A A;  1WT0 A;  4EVW A;  1R7V A;  5CMJ A;  2ICX A;  2J0B A;  1TW1 A;  2P72 A;  1YP2 A;  2Y4K A;  2ZU8 A;  2YC5 A;  2WEE A;  5CMF X;  1ZI3 A;  4NAL A;  3O3P A;  2VSI A;  3U2V A;  3GUE A;  2YQC A;  4KPX A;  4P00 A;  1LZI A;  3CKV A;  3OH2 A;  3V0P A;  4ECM A;  1V83 A;  3NGW A;  3SXG A;  1GWW A;  3CKJ A;  4FRA A;  3SX3 A;  4EE4 A;  1JV3 A;  2V0H A;  1R7X A;  4AYJ A;  5CQL X;  1QG8 A;  2I7B A;  4P02 A;  4Y7G A;  3DUV A;  4HO2 A;  2OI5 A;  4Y6N A;  1WVC A;  5C1G A;  3ZLK A;  3JTJ A;  4BQH A;  2V0I A;  5AJN A;  3POL A;  3SXD A;  1H7E A;  1ZJ1 A;  4G3P A;  1VIC A;  4HCQ A;  4B4G A;  3LW6 A;  1VH1 A;  1NWG B;  4ARW A;  2Y6P A;  1O7O A;  3I0E A;  3E26 A;  5C47 A;  3V0N A;  3V0Q A;  4UEG A;  4B5B A;  3FWW A;  1R80 A;  2GGQ A;  2X65 A;  5IDT A;  3CGX A;  1QGS A;  2PGY A;  4DEC A;  4FRQ A;  5D91 A;  4AC3 A;  1VH3 A;  3ZGF A;  2VS4 A;  4MYB A;  4NAN A;  2X5Z A;  1H5R A;  2JCO A;  3DK5 A;  5C4D A;  1G93 A;  1H5S D;  2AH9 A;  4KC4 A;  5EIY A;  1GX0 A;  3USR A;  3SXE A;  4FIY A;  3V90 A;  2FYD B;  1IIM A;  4Q7C A;  1QWJ A;  3PNN A;  3JUK A;  2Q4J A;  2XWN A;  3QVB A;  4FIX A;  1ZCT A;  1MP5 A;  1VGZ A;  4FRL A;  2I5K A;  4ASJ A;  4KC1 A;  2BO7 A;  4EEG A;  5C4B A;  5C38 A;  1I52 A;  2DPW A;  2YQJ A;  5EJZ A;  2VS5 A;  3OAM A;  4ASY A;  1VM8 A;  1O7Q A;  1JVD A;  3BRK X;  5FUH A;  4R7P A;  4NAK A;  3SXA A;  1W77 A;  2V0J A;  2PX7 A;  4EEA A;  1ZJ3 A;  2CU2 A;  1GWV A;  4B4B A;  1ZCV A;  1H7F A;  3T7N A;  4B2W A;  2D0J A;  2Y7A A;  4DDZ A;  3I0L A;  3TZT A;  2AM4 A;  1ZJO A;  4HG6 A;  2WVL A;  4KNR A;  2YQH A;  3I0C A;  1VGT A;  3U2X A;  3FOQ A;  1LZJ A;  1R82 A;  2O1G A;  3K8D A;  2X60 A;  4DE7 A;  3V91 A;  4HO6 A;  3CU0 A;  4HOC A;  3D8V A;  3OGZ A;  2D7R A;  3R2W A;  2XMH A;  3I0I X;  1LL2 A;  2YCM A;  3HL3 A;  3I0J A;  2YQS A;  5IDS A;  1H4E A;  1JVG A;  3CKO A;  3I0K A;  2WAW A;  1O0R A;  1V82 A;  2JCK A;  1EZI A;  1JV1 A;  2Y4L A;  4EEO A;  2A8W A;  1VZT A;  5C8R A;  5C49 A;  1G97 A;  4ZDQ A;  3SX8 A;  2PA4 A;  3E25 A;  4B2X A;  1H5R B;  1HJJ A;  1LZ0 A;  2XWM A;  4M2A A;  4MIX A;  1VGU A;  1S4O A;  1H5T A;  2WVK A;  2UX8 A;  1PZY B;  1G8O A;  3Q7U A;  4HO5 A;  2BO8 A;  4FRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...