3HL3A

2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
AMKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITGKEHMGDVVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVEEFTNQKEGAKVLLQSVDDPERFGVANIQNRKIIEIEEKPKEPKSSYAVTGIYLYDSKVFSYIKELKPSARGELEITDINNWYLKRGVLTYNEMSGWWTDAGTHVSLQRANALARDINFGKQFNGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucose-1-phosphate thymidylyltransferase
publication title 2.76 Angstrom Crystal Structure of a Putative Glucose-1-Phosphate Thymidylyltransferase from Bacillus anthracis in Complex with a Sucrose.
rcsb
source organism Bacillus anthracis
total genus 79
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3hl3A00
1H4CA 3SX7A 4FRQA 4GBPA 1FGXA 1ZJ1A 1VZUA 2AE7A 2ICXA 2PX7A 4BQHA 4HO3A 2I5EA 3V90A 4HO2A 4HOCA 4NANA 2VS4A 5AJNA 3T7OA 4KC4A 4K6RA 2P72A 1VPAA 2X65A 2VXMA 1GWVA 1VGZA 3V0PA 3SXGA 4EVWA 2BO7A 3F1YA 1FO8A 3U2UA 3RMWA 1YP2A 1ZI1A 1MP3A 2JCJA 2MZBA 1G2VA 5FTVA 1WT0A 4B4BA 1ZJ0A 2JCOA 1R7XA 1JYLA 3CKQA 5CQLX 4DE7A 5AJOA 1YP3A 3JUJA 2Y4LA 3PNNA 1NKHB 1VZXA 1O23B 1S4NA 4CJ8A 1H7EA 4B42A 5C36A 1XZ6A 2RJ4A 1FGGA 4MNDA 4Y6NA 2RITA 1ZHJA 3OAMA 1WT2A 4NALA 3ST8A 1H5SB 3OH0A 1G3LA 1LZIA 2WAWA 4ZDQA 1HJJA 1H5RB 5FUHA 3V0QA 5L6VA 1QWJA 1WT3A 2FYAA 2QKXA 1O7OA 1V84A 1G93A 2O1GA 1ZIZA 4AAWA 3IOJA 4ARWA 3OH1A 2VSIA 2W0WA 2Z87A 4Y6UA 2YQHA 3SXBA 3SXEA 5AJPA 4KRVA 4C2SA 2YQSA 2P73A 4L41C 3R2WA 4DECA 4XWIA 1JV3A 4B4GA 2RJ9A 1FG5N 2AECA 1ON6A 1R7UA 1ZJ3A 1H7TA 2FY7A 4B5BA 1H5TB 1O0RA 2RIXA 3I0IX 2YCMA 2O1HA 1R81A 2WVKA 1VGUA 1Z90A 5CMIA 2AM4A 3ZLLA 4E1KA 4KXOA 5FV9A 3ZGFA 2AM5A 4EE3A 2XWNA 4D48A 1FOAA 2D7RA 4FCEA 1R7YA 1HM9A 4FROA 3U0YA 4Y7UA 1FR8A 1NWGB 1WSZA 5CMJA 4D11A 5CMHA 3QVBA 2PGVA 2YQJA 4D0TA 1ZJPA 4HO6A 4Y63A 2BO6A 3NGWA 5FTSA 2A8WA 1JV1A 2V0IA 4EEOA 3SXCA 2D0JA 5CMGX 4AYLA 1VICA 3DJ4A 1INJA 5JQQA 3EE5A 4HCQA 3U0XA 5C38A 4CJCA 3V0OA 1FZWA 3SXDA 1R7VA 2DPWA 3SX5A 5DDTA 1KWSA 2YC5A 2Y4KA 4JD0A 2O1FA 1OQMB 5FYEA 2FYBA 4IRQA 4FRDA 4YS8A 5FU0A 1JVGA 5BXCA 2Q4JA 1IIMA 2JCLA 1VH3A 3TZTA 4M4KA 3I0HA 3PKPA 3ZF8A 1W57A 4FCUA 2WEEA 4Y7FA 4IRPA 4B2WA 4B3UA 1S4PA 5IDSA 4HO8A 3SX8A 3OH4A 1XHBA 3OC9A 3Q80A 2V0KA 1I52A 1MP4A 4BMAA 4KC2A 5EJ1A 1LL2A 1TW5A 4CVHA 2BO4A 3U2WA 2RJ5A 3CKJA 3HL3A 4ASJA 4B2XA 1K4VA 3SX3A 1YP4A 1FXJA 5CMFX 3OH3A 4EE5A 4KNXA 4HO4A 3SPTA 1NMMB 1GWWA 2AM3A 5C1GA 1OMZA 4JISA 2Y4MA 2Y4JA 3V8ZA 4Y64A 2XMHA 1VGTA 2D7IA 1ZI4A 5L6SA 1LZ0A 1H7QA 2RJ1A 4P00A 1O7QA 1FXOA 2E8BA 4EE4A 1YROB 4HO9A 1VGWA 4FRMA 1QG8A 2V0LA 4NAKA 5J49A 2X5ZA 3BCVA 2XWLA 2WE9A 5EJZA 3I0CA 3I0LA 1IINA 2Y6PA 4HG6A 1ZCVA 1LZJA 1G0RA 4CJBA 2V0HA 1WT1A 4Y62A 5CQPA 1HJLA 2UX8A 3I0DA 2P6WA 4EEGA 2ZU8A 4EEAA 5CQNX 2FFVA 1H7HA 2VD4A 1EZIA 3O3PA 3D98A 3I0EA 4D11C 2Z86A 4FQWA 5C3BA 1G1LA 3CGXA 1PZTA 2FYDB 3E26A 3FOQA 2PGYA 3V91A 4KQLA 5C48A 2W0VA 5C1LA 3I0FA 1E5KA 1G95A 1S4OA 1ZJ2A 2VS3A 1WVCA 4KT7A 2YQCA 2NXVA 3D8VA 3K8EA 4D0ZA 3RMVA 4J18A 1LL0A 1NF5B 5C4CA 2GGOA 4ECMA 1R80A 3T7MA 1ZCTA 1PZYB 3DUVA 2QH5A 3SXAA 4FRAA 1GA8A 4KNRA 1FRWA 3U2TA 5C4FA 2OEGA 2RJ8A 3PKQA 2XWMA 3V0MA 2I5KA 3K8DA 2AGDA 1ZI5A 1MC3A 1V82A 2WVLA 4M2AA 1TVYA 1GQCA 4KPZA 1G9RA 3KIAA 5FU8A 4DDZA 3Q7UA 1FWYA 3R3IA 3U2XA 3DK5A 4AC3A 5C3DA 3IOHA 2RJ6A 5CQOA 5C8RA 1QGQA 3FWWA 1H4DA 1V83A 3I0GA 2FFUA 5C1HA 3ZGGA 1NHEB 2AH9A 2VSHA 2A8UA 4LW6A 5DDVA 1G23A 1H7LA 3V0NA 2WGZA 3CKVA 4EEMA 1GX4A 1MP5A 3T7NA 4R7PA 2VXLA 4Y7VA 2GGQA 2RJ0A 2QGIA 1HV9A 1R82A 1H4EA 5EIYA 1INIA 3OH2A 1GQ9A 3E25A 2BO8A 2CU2A 5IFYA 2YC3A 4G3SA 1LL3A 1ON8A 1W77A 3N9WA 4G87A 1TZFA 2OI6A 3USQA 4B4MA 1ZDFA 4NAIA 1W55A 3F1CA 4M2BA 4HO0A 3U2VA 1SS9A 4FRBA 1G8OA 1VZTA 2E3DA 4Y7GA 5C4EA 1H7FA 2X60A 2RIYA 4FRLA 3ZLKA 3OKRA 2ICYA 3JUKA 4Y9XA 4M28A 1LVWA 3OGZA 1H3MA 1H5SD 1TW1A 4MYBA 5C49A 2WVMA 2FYCB 1G97A 1H5SC 1ZCYA 4KPXA 2PA4A 1JYKA 4HO5A 2OI5A 3JTJA 1VM8A 1EYRA 4FRHA 2Y7AA 3V8YA 3RSBA 4LW3A 1NQIB 3I0KA 5HS2A 1R7TA 1H7GA 2ZU9A 1VH1A 4UEGA 1OMXA 1ZCUA 1H5SA 4FREA 2JCKA 5I1FA 2V0JA 5C4DA 4P02A 4G3PA 1H5RA 3CKNA 2VFZA 2X5SA 4FRPA 1LZ7A 4KC1A 3LW6A 4G3QA 1GX0A 2RIZA 3POLA 2OI7A 1ZI3A 3CKOA 1ZDGA 3V0LA 5C47A 2ZU7A 1QGSA 1HM0A 3D5NA 2YESA 3BRKX 2AESA 3Q4SA 4Y7TA 3IOIA 5CQMX 5IDTA 3USRA 4AYJA 1FO9A 3CU0A 3I0JA 2RJ7A 1JVDA 1HM8A 2OEFA 1H5TA 2APCA 5C4BA 2VS5A 5C3AA 1FR9A 3TQDA 4ASYA 3GUEA 2XMEA 1ZJOA 2I7BA
chains in the Genus database with same CATH superfamily
1H4CA 3SX7A 4FRQA 4GBPA 1FGXA 1ZJ1A 1VZUA 2AE7A 2ICXA 2PX7A 4BQHA 4HO3A 2I5EA 3V90A 4HO2A 4HOCA 4NANA 2VS4A 5AJNA 3T7OA 4FIYA 4KC4A 4K6RA 2P72A 1VPAA 2X65A 2VXMA 1GWVA 1VGZA 4MIXA 3SXGA 3V0PA 4EVWA 2BO7A 3F1YA 1FO8A 3U2UA 3RMWA 1YP2A 1ZI1A 1MP3A 2JCJA 2MZBA 1G2VA 5FTVA 1WT0A 4B4BA 1ZJ0A 2JCOA 1R7XA 1JYLA 2VK9A 3CKQA 5CQLX 4DE7A 5AJOA 1YP3A 3JUJA 2Y4LA 3PNNA 1NKHB 1VZXA 1O23B 1S4NA 4CJ8A 1H7EA 4B42A 5C36A 1XZ6A 2RJ4A 1FGGA 4MNDA 4Y6NA 2RITA 1ZHJA 3OAMA 1WT2A 4NALA 3ST8A 1H5SB 3OH0A 1G3LA 1LZIA 2WAWA 4ZDQA 1HJJA 1H5RB 5FUHA 3V0QA 5L6VA 1QWJA 1WT3A 2FYAA 2QKXA 1O7OA 4O6MA 1V84A 1G93A 2O1GA 1ZIZA 4AAWA 3IOJA 4ARWA 3OH1A 2VSIA 2W0WA 2Z87A 4Y6UA 2YQHA 3SXBA 3SXEA 5AJPA 4KRVA 4C2SA 2YQSA 2P73A 4L41C 3R2WA 4DECA 4XWIA 1JV3A 4B4GA 2RJ9A 1FG5N 2AECA 1ON6A 1R7UA 1ZJ3A 1H7TA 2FY7A 4B5BA 1H5TB 1O0RA 2RIXA 3I0IX 2YCMA 2O1HA 1R81A 2WVKA 1VGUA 1Z90A 5CMIA 2AM4A 3ZLLA 4E1KA 4KXOA 5FV9A 3ZGFA 2AM5A 4EE3A 2XWNA 4D48A 1FOAA 2D7RA 4FCEA 1R7YA 1HM9A 4FROA 3U0YA 4Y7UA 1FR8A 1NWGB 1WSZA 5CMJA 4D11A 5CMHA 3QVBA 2PGVA 2YQJA 4D0TA 1ZJPA 4HO6A 4Y63A 2BO6A 3NGWA 5FTSA 2A8WA 1JV1A 2V0IA 4EEOA 3SXCA 2D0JA 5CMGX 4AYLA 1VICA 3DJ4A 1INJA 5JQQA 3EE5A 4HCQA 3U0XA 5C38A 4CJCA 3V0OA 1FZWA 3SXDA 1R7VA 2DPWA 3SX5A 5DDTA 1KWSA 2YC5A 2Y4KA 4JD0A 2O1FA 1OQMB 5FYEA 2FYBA 4IRQA 4FRDA 4YS8A 5FU0A 1JVGA 5BXCA 2C0NA 2Q4JA 1IIMA 2JCLA 1VH3A 2J0AA 3TZTA 4M4KA 3I0HA 3PKPA 3ZF8A 1W57A 4FCUA 2WEEA 4Y7FA 4IRPA 4B2WA 4B3UA 1S4PA 5IDSA 4HO8A 3SX8A 3OH4A 1XHBA 3OC9A 3Q80A 2V0KA 1I52A 1MP4A 4BMAA 4KC2A 5EJ1A 1LL2A 4Q7CA 1TW5A 4CVHA 2BO4A 3U2WA 2RJ5A 3CKJA 3HL3A 4ASJA 4B2XA 1K4VA 3SX3A 1YP4A 1FXJA 5CMFX 3OH3A 4EE5A 4KNXA 4HO4A 3SPTA 1NMMB 1GWWA 2AM3A 5C1GA 1OMZA 4JISA 2Y4MA 2Y4JA 3V8ZA 4Y64A 2XMHA 1VGTA 2D7IA 1ZI4A 5L6SA 1LZ0A 1H7QA 2RJ1A 4P00A 1O7QA 1FXOA 2E8BA 4EE4A 1YROB 4HO9A 1VGWA 4FRMA 1QG8A 2V0LA 4NAKA 5J49A 2X5ZA 3BCVA 2XWLA 2WE9A 5EJZA 3I0CA 3I0LA 1IINA 2Y6PA 4HG6A 1ZCVA 5D92A 1LZJA 1G0RA 4CJBA 2V0HA 1WT1A 4Y62A 5CQPA 2J0BA 1HJLA 2UX8A 3I0DA 2P6WA 4EEGA 2ZU8A 4EEAA 5CQNX 2FFVA 1H7HA 2VD4A 1EZIA 3O3PA 3D98A 3I0EA 4D11C 2Z86A 4FQWA 5C3BA 1G1LA 3CGXA 1PZTA 2FYDB 3E26A 4FIXA 3FOQA 2PGYA 3V91A 4KQLA 5C48A 2W0VA 5C1LA 3I0FA 1E5KA 1G95A 1S4OA 1ZJ2A 2VS3A 1WVCA 4KT7A 2YQCA 2NXVA 3D8VA 3K8EA 4D0ZA 3RMVA 4J18A 1LL0A 1NF5B 5C4CA 2GGOA 4ECMA 1R80A 3T7MA 1ZCTA 1PZYB 3DUVA 2QH5A 3SXAA 4FRAA 1GA8A 4KNRA 1FRWA 3U2TA 5C4FA 2OEGA 2RJ8A 3PKQA 2XWMA 3V0MA 2I5KA 3K8DA 2AGDA 1ZI5A 1MC3A 1V82A 2WVLA 4M2AA 1TVYA 1GQCA 4KPZA 1G9RA 3KIAA 5FU8A 4DDZA 3Q7UA 1FWYA 3R3IA 3U2XA 3DK5A 4AC3A 5C3DA 3IOHA 2RJ6A 5CQOA 5C8RA 1QGQA 3FWWA 1H4DA 1V83A 3I0GA 2FFUA 5C1HA 3ZGGA 1NHEB 2AH9A 2VSHA 2A8UA 4LW6A 5DDVA 1G23A 1H7LA 3V0NA 2WGZA 3CKVA 4EEMA 1GX4A 1MP5A 3T7NA 4R7PA 2VXLA 4Y7VA 2GGQA 2RJ0A 2QGIA 1HV9A 1R82A 1H4EA 5EIYA 1INIA 3OH2A 1GQ9A 3E25A 2BO8A 2CU2A 5IFYA 2YC3A 4G3SA 1LL3A 1ON8A 1W77A 3N9WA 4G87A 1TZFA 2OI6A 3USQA 4B4MA 1ZDFA 4NAIA 1W55A 3F1CA 4M2BA 4HO0A 3U2VA 1SS9A 4FRBA 1G8OA 1VZTA 2E3DA 4Y7GA 5C4EA 1H7FA 2X60A 2RIYA 4FRLA 3ZLKA 3OKRA 2ICYA 3JUKA 4Y9XA 4M28A 1LVWA 3OGZA 1H3MA 1H5SD 1TW1A 4MYBA 5C49A 2WVMA 2FYCB 1G97A 1H5SC 1ZCYA 4KPXA 2PA4A 1JYKA 4HO5A 2OI5A 3JTJA 1VM8A 1EYRA 4FRHA 2Y7AA 3V8YA 3RSBA 4LW3A 1NQIB 3I0KA 5HS2A 1R7TA 1H7GA 2ZU9A 1VH1A 4UEGA 4O6NA 1OMXA 1ZCUA 1H5SA 4FREA 2JCKA 5I1FA 2V0JA 5C4DA 4P02A 4G3PA 1H5RA 3CKNA 2VFZA 2X5SA 4FRPA 1LZ7A 4KC1A 3LW6A 4G3QA 1GX0A 2RIZA 3POLA 2OI7A 1ZI3A 3CKOA 1ZDGA 3V0LA 5C47A 2ZU7A 1QGSA 1HM0A 3D5NA 2YESA 3BRKX 2AESA 3Q4SA 4Y7TA 3IOIA 5CQMX 5IDTA 3USRA 4AYJA 1FO9A 3CU0A 3I0JA 2RJ7A 1JVDA 1HM8A 2OEFA 1H5TA 2APCA 5C4BA 2VS5A 5D91A 5C3AA 1FR9A 3TQDA 4ASYA 3GUEA 2XMEA 1ZJOA 2I7BA
chains in the Genus database with same CATH topology
1H4CA 3SX7A 4FRQA 4GBPA 1FGXA 1ZJ1A 1VZUA 2AE7A 2ICXA 2PX7A 4BQHA 4HO3A 2I5EA 3V90A 4HO2A 4HOCA 4NANA 2VS4A 5AJNA 3T7OA 4FIYA 4KC4A 4K6RA 2P72A 1VPAA 2X65A 2VXMA 1GWVA 1VGZA 4MIXA 3SXGA 3V0PA 4EVWA 2BO7A 3F1YA 1FO8A 3U2UA 3RMWA 1YP2A 1ZI1A 1MP3A 2JCJA 2MZBA 1G2VA 5FTVA 1WT0A 4B4BA 1ZJ0A 2JCOA 1R7XA 1JYLA 2VK9A 3CKQA 5CQLX 4DE7A 5AJOA 1YP3A 3JUJA 2Y4LA 3PNNA 1NKHB 1VZXA 1O23B 1S4NA 4CJ8A 1H7EA 4B42A 5C36A 1XZ6A 2RJ4A 1FGGA 4MNDA 4Y6NA 2RITA 1ZHJA 3OAMA 1WT2A 4NALA 3ST8A 1H5SB 3OH0A 1G3LA 1LZIA 2WAWA 4ZDQA 1HJJA 1H5RB 5FUHA 3V0QA 5L6VA 1QWJA 1WT3A 2FYAA 2QKXA 1O7OA 4O6MA 1V84A 1G93A 2O1GA 1ZIZA 4AAWA 3IOJA 4ARWA 3OH1A 2VSIA 2W0WA 2Z87A 4Y6UA 2YQHA 3SXBA 3SXEA 5AJPA 4KRVA 4C2SA 2YQSA 2P73A 4L41C 3R2WA 4DECA 4XWIA 1JV3A 4B4GA 2RJ9A 1FG5N 2AECA 1ON6A 1R7UA 1ZJ3A 1H7TA 2FY7A 4B5BA 1H5TB 1O0RA 2RIXA 3I0IX 2YCMA 2O1HA 1R81A 2WVKA 1VGUA 1Z90A 5CMIA 2AM4A 3ZLLA 4E1KA 4KXOA 5FV9A 3ZGFA 2AM5A 4EE3A 2XWNA 4D48A 1FOAA 2D7RA 4FCEA 1R7YA 1HM9A 4FROA 3U0YA 4Y7UA 1FR8A 1NWGB 1WSZA 5CMJA 4D11A 5CMHA 3QVBA 2PGVA 2YQJA 4D0TA 1ZJPA 4HO6A 4Y63A 2BO6A 3NGWA 5FTSA 2A8WA 1JV1A 2V0IA 4EEOA 3SXCA 2D0JA 5CMGX 4AYLA 1VICA 3DJ4A 1INJA 5JQQA 3EE5A 4HCQA 3U0XA 5C38A 4CJCA 3V0OA 1FZWA 3SXDA 1R7VA 2DPWA 3SX5A 5DDTA 1KWSA 2YC5A 2Y4KA 4JD0A 2O1FA 1OQMB 5FYEA 2FYBA 4IRQA 4FRDA 4YS8A 5FU0A 1JVGA 5BXCA 2C0NA 2Q4JA 1IIMA 2JCLA 1VH3A 2J0AA 3TZTA 4M4KA 3I0HA 3PKPA 3ZF8A 1W57A 4FCUA 2WEEA 4Y7FA 4IRPA 4B2WA 4B3UA 1S4PA 5IDSA 4HO8A 3SX8A 3OH4A 1XHBA 3OC9A 3Q80A 2V0KA 1I52A 1MP4A 4BMAA 4KC2A 5EJ1A 1LL2A 4Q7CA 1TW5A 4CVHA 2BO4A 3U2WA 2RJ5A 3CKJA 3HL3A 4ASJA 4B2XA 1K4VA 3SX3A 1YP4A 1FXJA 5CMFX 3OH3A 4EE5A 4KNXA 4HO4A 3SPTA 1NMMB 1GWWA 2AM3A 5C1GA 1OMZA 4JISA 2Y4MA 2Y4JA 3V8ZA 4Y64A 2XMHA 1VGTA 2D7IA 1ZI4A 5L6SA 1LZ0A 1H7QA 2RJ1A 4P00A 1O7QA 1FXOA 2E8BA 4EE4A 1YROB 4HO9A 1VGWA 4FRMA 1QG8A 2V0LA 4NAKA 5J49A 2X5ZA 3BCVA 2XWLA 2WE9A 5EJZA 3I0CA 3I0LA 1IINA 2Y6PA 4HG6A 1ZCVA 5D92A 1LZJA 1G0RA 4CJBA 2V0HA 1WT1A 4Y62A 5CQPA 2J0BA 1HJLA 2UX8A 3I0DA 2P6WA 4EEGA 2ZU8A 4EEAA 5CQNX 2FFVA 1H7HA 2VD4A 1EZIA 3O3PA 3D98A 3I0EA 4D11C 2Z86A 4FQWA 5C3BA 1G1LA 3CGXA 1PZTA 2FYDB 3E26A 4FIXA 3FOQA 2PGYA 3V91A 4KQLA 5C48A 2W0VA 5C1LA 3I0FA 1E5KA 1G95A 1S4OA 1ZJ2A 2VS3A 1WVCA 4KT7A 2YQCA 2NXVA 3D8VA 3K8EA 4D0ZA 3RMVA 4J18A 1LL0A 1NF5B 5C4CA 2GGOA 4ECMA 1R80A 3T7MA 1ZCTA 1PZYB 3DUVA 2QH5A 3SXAA 4FRAA 1GA8A 4KNRA 1FRWA 3U2TA 5C4FA 2OEGA 2RJ8A 3PKQA 2XWMA 3V0MA 2I5KA 3K8DA 2AGDA 1ZI5A 1MC3A 1V82A 2WVLA 4M2AA 1TVYA 1GQCA 4KPZA 1G9RA 3KIAA 5FU8A 4DDZA 3Q7UA 1FWYA 3R3IA 3U2XA 3DK5A 4AC3A 5C3DA 3IOHA 2RJ6A 5CQOA 5C8RA 1QGQA 3FWWA 1H4DA 1V83A 3I0GA 2FFUA 5C1HA 3ZGGA 1NHEB 2AH9A 2VSHA 2A8UA 4LW6A 5DDVA 1G23A 1H7LA 3V0NA 2WGZA 3CKVA 4EEMA 1GX4A 1MP5A 3T7NA 4R7PA 2VXLA 4Y7VA 2GGQA 2RJ0A 2QGIA 1HV9A 1R82A 1H4EA 5EIYA 1INIA 3OH2A 1GQ9A 3E25A 2BO8A 2CU2A 5IFYA 2YC3A 4G3SA 1LL3A 1ON8A 1W77A 3N9WA 4G87A 1TZFA 2OI6A 3USQA 4B4MA 1ZDFA 4NAIA 1W55A 3F1CA 4M2BA 4HO0A 3U2VA 1SS9A 4FRBA 1G8OA 1VZTA 2E3DA 4Y7GA 5C4EA 1H7FA 2X60A 2RIYA 4FRLA 3ZLKA 3OKRA 2ICYA 3JUKA 4Y9XA 4M28A 1LVWA 3OGZA 1H3MA 1H5SD 1TW1A 4MYBA 5C49A 2WVMA 2FYCB 1G97A 1H5SC 1ZCYA 4KPXA 2PA4A 1JYKA 4HO5A 2OI5A 3JTJA 1VM8A 1EYRA 4FRHA 2Y7AA 3V8YA 3RSBA 4LW3A 1NQIB 3I0KA 5HS2A 1R7TA 1H7GA 2ZU9A 1VH1A 4UEGA 4O6NA 1OMXA 1ZCUA 1H5SA 4FREA 2JCKA 5I1FA 2V0JA 5C4DA 4P02A 4G3PA 1H5RA 3CKNA 2VFZA 2X5SA 4FRPA 1LZ7A 4KC1A 3LW6A 4G3QA 1GX0A 2RIZA 3POLA 2OI7A 1ZI3A 3CKOA 1ZDGA 3V0LA 5C47A 2ZU7A 1QGSA 1HM0A 3D5NA 2YESA 3BRKX 2AESA 3Q4SA 4Y7TA 3IOIA 5CQMX 5IDTA 3USRA 4AYJA 1FO9A 3CU0A 3I0JA 2RJ7A 1JVDA 1HM8A 2OEFA 1H5TA 2APCA 5C4BA 2VS5A 5D91A 5C3AA 1FR9A 3TQDA 4ASYA 3GUEA 2XMEA 1ZJOA 2I7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4C A;  3SX7 A;  4FRQ A;  4GBP A;  1FGX A;  1ZJ1 A;  1VZU A;  2AE7 A;  2ICX A;  2PX7 A;  4BQH A;  4HO3 A;  2I5E A;  3V90 A;  4HO2 A;  4HOC A;  4NAN A;  2VS4 A;  5AJN A;  3T7O A;  4KC4 A;  4K6R A;  2P72 A;  1VPA A;  2X65 A;  2VXM A;  1GWV A;  1VGZ A;  3V0P A;  3SXG A;  4EVW A;  2BO7 A;  3F1Y A;  1FO8 A;  3U2U A;  3RMW A;  1YP2 A;  1ZI1 A;  1MP3 A;  2JCJ A;  2MZB A;  1G2V A;  5FTV A;  1WT0 A;  4B4B A;  1ZJ0 A;  2JCO A;  1R7X A;  1JYL A;  3CKQ A;  5CQL X;  4DE7 A;  5AJO A;  1YP3 A;  3JUJ A;  2Y4L A;  3PNN A;  1NKH B;  1VZX A;  1O23 B;  1S4N A;  4CJ8 A;  1H7E A;  4B42 A;  5C36 A;  1XZ6 A;  2RJ4 A;  1FGG A;  4MND A;  4Y6N A;  2RIT A;  1ZHJ A;  3OAM A;  1WT2 A;  4NAL A;  3ST8 A;  1H5S B;  3OH0 A;  1G3L A;  1LZI A;  2WAW A;  4ZDQ A;  1HJJ A;  1H5R B;  5FUH A;  3V0Q A;  5L6V A;  1QWJ A;  1WT3 A;  2FYA A;  2QKX A;  1O7O A;  1V84 A;  1G93 A;  2O1G A;  1ZIZ A;  4AAW A;  3IOJ A;  4ARW A;  3OH1 A;  2VSI A;  2W0W A;  2Z87 A;  4Y6U A;  2YQH A;  3SXB A;  3SXE A;  5AJP A;  4KRV A;  4C2S A;  2YQS A;  2P73 A;  4L41 C;  3R2W A;  4DEC A;  4XWI A;  1JV3 A;  4B4G A;  2RJ9 A;  1FG5 N;  2AEC A;  1ON6 A;  1R7U A;  1ZJ3 A;  1H7T A;  2FY7 A;  4B5B A;  1H5T B;  1O0R A;  2RIX A;  3I0I X;  2YCM A;  2O1H A;  1R81 A;  2WVK A;  1VGU A;  1Z90 A;  5CMI A;  2AM4 A;  3ZLL A;  4E1K A;  4KXO A;  5FV9 A;  3ZGF A;  2AM5 A;  4EE3 A;  2XWN A;  4D48 A;  1FOA A;  2D7R A;  4FCE A;  1R7Y A;  1HM9 A;  4FRO A;  3U0Y A;  4Y7U A;  1FR8 A;  1NWG B;  1WSZ A;  5CMJ A;  4D11 A;  5CMH A;  3QVB A;  2PGV A;  2YQJ A;  4D0T A;  1ZJP A;  4HO6 A;  4Y63 A;  2BO6 A;  3NGW A;  5FTS A;  2A8W A;  1JV1 A;  2V0I A;  4EEO A;  3SXC A;  2D0J A;  5CMG X;  4AYL A;  1VIC A;  3DJ4 A;  1INJ A;  5JQQ A;  3EE5 A;  4HCQ A;  3U0X A;  5C38 A;  4CJC A;  3V0O A;  1FZW A;  3SXD A;  1R7V A;  2DPW A;  3SX5 A;  5DDT A;  1KWS A;  2YC5 A;  2Y4K A;  4JD0 A;  2O1F A;  1OQM B;  5FYE A;  2FYB A;  4IRQ A;  4FRD A;  4YS8 A;  5FU0 A;  1JVG A;  5BXC A;  2Q4J A;  1IIM A;  2JCL A;  1VH3 A;  3TZT A;  4M4K A;  3I0H A;  3PKP A;  3ZF8 A;  1W57 A;  4FCU A;  2WEE A;  4Y7F A;  4IRP A;  4B2W A;  4B3U A;  1S4P A;  5IDS A;  4HO8 A;  3SX8 A;  3OH4 A;  1XHB A;  3OC9 A;  3Q80 A;  2V0K A;  1I52 A;  1MP4 A;  4BMA A;  4KC2 A;  5EJ1 A;  1LL2 A;  1TW5 A;  4CVH A;  2BO4 A;  3U2W A;  2RJ5 A;  3CKJ A;  3HL3 A;  4ASJ A;  4B2X A;  1K4V A;  3SX3 A;  1YP4 A;  1FXJ A;  5CMF X;  3OH3 A;  4EE5 A;  4KNX A;  4HO4 A;  3SPT A;  1NMM B;  1GWW A;  2AM3 A;  5C1G A;  1OMZ A;  4JIS A;  2Y4M A;  2Y4J A;  3V8Z A;  4Y64 A;  2XMH A;  1VGT A;  2D7I A;  1ZI4 A;  5L6S A;  1LZ0 A;  1H7Q A;  2RJ1 A;  4P00 A;  1O7Q A;  1FXO A;  2E8B A;  4EE4 A;  1YRO B;  4HO9 A;  1VGW A;  4FRM A;  1QG8 A;  2V0L A;  4NAK A;  5J49 A;  2X5Z A;  3BCV A;  2XWL A;  2WE9 A;  5EJZ A;  3I0C A;  3I0L A;  1IIN A;  2Y6P A;  4HG6 A;  1ZCV A;  1LZJ A;  1G0R A;  4CJB A;  2V0H A;  1WT1 A;  4Y62 A;  5CQP A;  1HJL A;  2UX8 A;  3I0D A;  2P6W A;  4EEG A;  2ZU8 A;  4EEA A;  5CQN X;  2FFV A;  1H7H A;  2VD4 A;  1EZI A;  3O3P A;  3D98 A;  3I0E A;  4D11 C;  2Z86 A;  4FQW A;  5C3B A;  1G1L A;  3CGX A;  1PZT A;  2FYD B;  3E26 A;  3FOQ A;  2PGY A;  3V91 A;  4KQL A;  5C48 A;  2W0V A;  5C1L A;  3I0F A;  1E5K A;  1G95 A;  1S4O A;  1ZJ2 A;  2VS3 A;  1WVC A;  4KT7 A;  2YQC A;  2NXV A;  3D8V A;  3K8E A;  4D0Z A;  3RMV A;  4J18 A;  1LL0 A;  1NF5 B;  5C4C A;  2GGO A;  4ECM A;  1R80 A;  3T7M A;  1ZCT A;  1PZY B;  3DUV A;  2QH5 A;  3SXA A;  4FRA A;  1GA8 A;  4KNR A;  1FRW A;  3U2T A;  5C4F A;  2OEG A;  2RJ8 A;  3PKQ A;  2XWM A;  3V0M A;  2I5K A;  3K8D A;  2AGD A;  1ZI5 A;  1MC3 A;  1V82 A;  2WVL A;  4M2A A;  1TVY A;  1GQC A;  4KPZ A;  1G9R A;  3KIA A;  5FU8 A;  4DDZ A;  3Q7U A;  1FWY A;  3R3I A;  3U2X A;  3DK5 A;  4AC3 A;  5C3D A;  3IOH A;  2RJ6 A;  5CQO A;  5C8R A;  1QGQ A;  3FWW A;  1H4D A;  1V83 A;  3I0G A;  2FFU A;  5C1H A;  3ZGG A;  1NHE B;  2AH9 A;  2VSH A;  2A8U A;  4LW6 A;  5DDV A;  1G23 A;  1H7L A;  3V0N A;  2WGZ A;  3CKV A;  4EEM A;  1GX4 A;  1MP5 A;  3T7N A;  4R7P A;  2VXL A;  4Y7V A;  2GGQ A;  2RJ0 A;  2QGI A;  1HV9 A;  1R82 A;  1H4E A;  5EIY A;  1INI A;  3OH2 A;  1GQ9 A;  3E25 A;  2BO8 A;  2CU2 A;  5IFY A;  2YC3 A;  4G3S A;  1LL3 A;  1ON8 A;  1W77 A;  3N9W A;  4G87 A;  1TZF A;  2OI6 A;  3USQ A;  4B4M A;  1ZDF A;  4NAI A;  1W55 A;  3F1C A;  4M2B A;  4HO0 A;  3U2V A;  1SS9 A;  4FRB A;  1G8O A;  1VZT A;  2E3D A;  4Y7G A;  5C4E A;  1H7F A;  2X60 A;  2RIY A;  4FRL A;  3ZLK A;  3OKR A;  2ICY A;  3JUK A;  4Y9X A;  4M28 A;  1LVW A;  3OGZ A;  1H3M A;  1H5S D;  1TW1 A;  4MYB A;  5C49 A;  2WVM A;  2FYC B;  1G97 A;  1H5S C;  1ZCY A;  4KPX A;  2PA4 A;  1JYK A;  4HO5 A;  2OI5 A;  3JTJ A;  1VM8 A;  1EYR A;  4FRH A;  2Y7A A;  3V8Y A;  3RSB A;  4LW3 A;  1NQI B;  3I0K A;  5HS2 A;  1R7T A;  1H7G A;  2ZU9 A;  1VH1 A;  4UEG A;  1OMX A;  1ZCU A;  1H5S A;  4FRE A;  2JCK A;  5I1F A;  2V0J A;  5C4D A;  4P02 A;  4G3P A;  1H5R A;  3CKN A;  2VFZ A;  2X5S A;  4FRP A;  1LZ7 A;  4KC1 A;  3LW6 A;  4G3Q A;  1GX0 A;  2RIZ A;  3POL A;  2OI7 A;  1ZI3 A;  3CKO A;  1ZDG A;  3V0L A;  5C47 A;  2ZU7 A;  1QGS A;  1HM0 A;  3D5N A;  2YES A;  3BRK X;  2AES A;  3Q4S A;  4Y7T A;  3IOI A;  5CQM X;  5IDT A;  3USR A;  4AYJ A;  1FO9 A;  3CU0 A;  3I0J A;  2RJ7 A;  1JVD A;  1HM8 A;  2OEF A;  1H5T A;  2APC A;  5C4B A;  2VS5 A;  5C3A A;  1FR9 A;  3TQD A;  4ASY A;  3GUE A;  2XME A;  1ZJO A;  2I7B A; 
#chains in the Genus database with same CATH topology
 1H4C A;  3SX7 A;  4FRQ A;  4GBP A;  1FGX A;  1ZJ1 A;  1VZU A;  2AE7 A;  2ICX A;  2PX7 A;  4BQH A;  4HO3 A;  2I5E A;  3V90 A;  4HO2 A;  4HOC A;  4NAN A;  2VS4 A;  5AJN A;  3T7O A;  4FIY A;  4KC4 A;  4K6R A;  2P72 A;  1VPA A;  2X65 A;  2VXM A;  1GWV A;  1VGZ A;  4MIX A;  3SXG A;  3V0P A;  4EVW A;  2BO7 A;  3F1Y A;  1FO8 A;  3U2U A;  3RMW A;  1YP2 A;  1ZI1 A;  1MP3 A;  2JCJ A;  2MZB A;  1G2V A;  5FTV A;  1WT0 A;  4B4B A;  1ZJ0 A;  2JCO A;  1R7X A;  1JYL A;  2VK9 A;  3CKQ A;  5CQL X;  4DE7 A;  5AJO A;  1YP3 A;  3JUJ A;  2Y4L A;  3PNN A;  1NKH B;  1VZX A;  1O23 B;  1S4N A;  4CJ8 A;  1H7E A;  4B42 A;  5C36 A;  1XZ6 A;  2RJ4 A;  1FGG A;  4MND A;  4Y6N A;  2RIT A;  1ZHJ A;  3OAM A;  1WT2 A;  4NAL A;  3ST8 A;  1H5S B;  3OH0 A;  1G3L A;  1LZI A;  2WAW A;  4ZDQ A;  1HJJ A;  1H5R B;  5FUH A;  3V0Q A;  5L6V A;  1QWJ A;  1WT3 A;  2FYA A;  2QKX A;  1O7O A;  4O6M A;  1V84 A;  1G93 A;  2O1G A;  1ZIZ A;  4AAW A;  3IOJ A;  4ARW A;  3OH1 A;  2VSI A;  2W0W A;  2Z87 A;  4Y6U A;  2YQH A;  3SXB A;  3SXE A;  5AJP A;  4KRV A;  4C2S A;  2YQS A;  2P73 A;  4L41 C;  3R2W A;  4DEC A;  4XWI A;  1JV3 A;  4B4G A;  2RJ9 A;  1FG5 N;  2AEC A;  1ON6 A;  1R7U A;  1ZJ3 A;  1H7T A;  2FY7 A;  4B5B A;  1H5T B;  1O0R A;  2RIX A;  3I0I X;  2YCM A;  2O1H A;  1R81 A;  2WVK A;  1VGU A;  1Z90 A;  5CMI A;  2AM4 A;  3ZLL A;  4E1K A;  4KXO A;  5FV9 A;  3ZGF A;  2AM5 A;  4EE3 A;  2XWN A;  4D48 A;  1FOA A;  2D7R A;  4FCE A;  1R7Y A;  1HM9 A;  4FRO A;  3U0Y A;  4Y7U A;  1FR8 A;  1NWG B;  1WSZ A;  5CMJ A;  4D11 A;  5CMH A;  3QVB A;  2PGV A;  2YQJ A;  4D0T A;  1ZJP A;  4HO6 A;  4Y63 A;  2BO6 A;  3NGW A;  5FTS A;  2A8W A;  1JV1 A;  2V0I A;  4EEO A;  3SXC A;  2D0J A;  5CMG X;  4AYL A;  1VIC A;  3DJ4 A;  1INJ A;  5JQQ A;  3EE5 A;  4HCQ A;  3U0X A;  5C38 A;  4CJC A;  3V0O A;  1FZW A;  3SXD A;  1R7V A;  2DPW A;  3SX5 A;  5DDT A;  1KWS A;  2YC5 A;  2Y4K A;  4JD0 A;  2O1F A;  1OQM B;  5FYE A;  2FYB A;  4IRQ A;  4FRD A;  4YS8 A;  5FU0 A;  1JVG A;  5BXC A;  2C0N A;  2Q4J A;  1IIM A;  2JCL A;  1VH3 A;  2J0A A;  3TZT A;  4M4K A;  3I0H A;  3PKP A;  3ZF8 A;  1W57 A;  4FCU A;  2WEE A;  4Y7F A;  4IRP A;  4B2W A;  4B3U A;  1S4P A;  5IDS A;  4HO8 A;  3SX8 A;  3OH4 A;  1XHB A;  3OC9 A;  3Q80 A;  2V0K A;  1I52 A;  1MP4 A;  4BMA A;  4KC2 A;  5EJ1 A;  1LL2 A;  4Q7C A;  1TW5 A;  4CVH A;  2BO4 A;  3U2W A;  2RJ5 A;  3CKJ A;  3HL3 A;  4ASJ A;  4B2X A;  1K4V A;  3SX3 A;  1YP4 A;  1FXJ A;  5CMF X;  3OH3 A;  4EE5 A;  4KNX A;  4HO4 A;  3SPT A;  1NMM B;  1GWW A;  2AM3 A;  5C1G A;  1OMZ A;  4JIS A;  2Y4M A;  2Y4J A;  3V8Z A;  4Y64 A;  2XMH A;  1VGT A;  2D7I A;  1ZI4 A;  5L6S A;  1LZ0 A;  1H7Q A;  2RJ1 A;  4P00 A;  1O7Q A;  1FXO A;  2E8B A;  4EE4 A;  1YRO B;  4HO9 A;  1VGW A;  4FRM A;  1QG8 A;  2V0L A;  4NAK A;  5J49 A;  2X5Z A;  3BCV A;  2XWL A;  2WE9 A;  5EJZ A;  3I0C A;  3I0L A;  1IIN A;  2Y6P A;  4HG6 A;  1ZCV A;  5D92 A;  1LZJ A;  1G0R A;  4CJB A;  2V0H A;  1WT1 A;  4Y62 A;  5CQP A;  2J0B A;  1HJL A;  2UX8 A;  3I0D A;  2P6W A;  4EEG A;  2ZU8 A;  4EEA A;  5CQN X;  2FFV A;  1H7H A;  2VD4 A;  1EZI A;  3O3P A;  3D98 A;  3I0E A;  4D11 C;  2Z86 A;  4FQW A;  5C3B A;  1G1L A;  3CGX A;  1PZT A;  2FYD B;  3E26 A;  4FIX A;  3FOQ A;  2PGY A;  3V91 A;  4KQL A;  5C48 A;  2W0V A;  5C1L A;  3I0F A;  1E5K A;  1G95 A;  1S4O A;  1ZJ2 A;  2VS3 A;  1WVC A;  4KT7 A;  2YQC A;  2NXV A;  3D8V A;  3K8E A;  4D0Z A;  3RMV A;  4J18 A;  1LL0 A;  1NF5 B;  5C4C A;  2GGO A;  4ECM A;  1R80 A;  3T7M A;  1ZCT A;  1PZY B;  3DUV A;  2QH5 A;  3SXA A;  4FRA A;  1GA8 A;  4KNR A;  1FRW A;  3U2T A;  5C4F A;  2OEG A;  2RJ8 A;  3PKQ A;  2XWM A;  3V0M A;  2I5K A;  3K8D A;  2AGD A;  1ZI5 A;  1MC3 A;  1V82 A;  2WVL A;  4M2A A;  1TVY A;  1GQC A;  4KPZ A;  1G9R A;  3KIA A;  5FU8 A;  4DDZ A;  3Q7U A;  1FWY A;  3R3I A;  3U2X A;  3DK5 A;  4AC3 A;  5C3D A;  3IOH A;  2RJ6 A;  5CQO A;  5C8R A;  1QGQ A;  3FWW A;  1H4D A;  1V83 A;  3I0G A;  2FFU A;  5C1H A;  3ZGG A;  1NHE B;  2AH9 A;  2VSH A;  2A8U A;  4LW6 A;  5DDV A;  1G23 A;  1H7L A;  3V0N A;  2WGZ A;  3CKV A;  4EEM A;  1GX4 A;  1MP5 A;  3T7N A;  4R7P A;  2VXL A;  4Y7V A;  2GGQ A;  2RJ0 A;  2QGI A;  1HV9 A;  1R82 A;  1H4E A;  5EIY A;  1INI A;  3OH2 A;  1GQ9 A;  3E25 A;  2BO8 A;  2CU2 A;  5IFY A;  2YC3 A;  4G3S A;  1LL3 A;  1ON8 A;  1W77 A;  3N9W A;  4G87 A;  1TZF A;  2OI6 A;  3USQ A;  4B4M A;  1ZDF A;  4NAI A;  1W55 A;  3F1C A;  4M2B A;  4HO0 A;  3U2V A;  1SS9 A;  4FRB A;  1G8O A;  1VZT A;  2E3D A;  4Y7G A;  5C4E A;  1H7F A;  2X60 A;  2RIY A;  4FRL A;  3ZLK A;  3OKR A;  2ICY A;  3JUK A;  4Y9X A;  4M28 A;  1LVW A;  3OGZ A;  1H3M A;  1H5S D;  1TW1 A;  4MYB A;  5C49 A;  2WVM A;  2FYC B;  1G97 A;  1H5S C;  1ZCY A;  4KPX A;  2PA4 A;  1JYK A;  4HO5 A;  2OI5 A;  3JTJ A;  1VM8 A;  1EYR A;  4FRH A;  2Y7A A;  3V8Y A;  3RSB A;  4LW3 A;  1NQI B;  3I0K A;  5HS2 A;  1R7T A;  1H7G A;  2ZU9 A;  1VH1 A;  4UEG A;  4O6N A;  1OMX A;  1ZCU A;  1H5S A;  4FRE A;  2JCK A;  5I1F A;  2V0J A;  5C4D A;  4P02 A;  4G3P A;  1H5R A;  3CKN A;  2VFZ A;  2X5S A;  4FRP A;  1LZ7 A;  4KC1 A;  3LW6 A;  4G3Q A;  1GX0 A;  2RIZ A;  3POL A;  2OI7 A;  1ZI3 A;  3CKO A;  1ZDG A;  3V0L A;  5C47 A;  2ZU7 A;  1QGS A;  1HM0 A;  3D5N A;  2YES A;  3BRK X;  2AES A;  3Q4S A;  4Y7T A;  3IOI A;  5CQM X;  5IDT A;  3USR A;  4AYJ A;  1FO9 A;  3CU0 A;  3I0J A;  2RJ7 A;  1JVD A;  1HM8 A;  2OEF A;  1H5T A;  2APC A;  5C4B A;  2VS5 A;  5D91 A;  5C3A A;  1FR9 A;  3TQD A;  4ASY A;  3GUE A;  2XME A;  1ZJO A;  2I7B A; 
#chains in the Genus database with same CATH homology
 1H4C A;  3SX7 A;  4FRQ A;  4GBP A;  1FGX A;  1ZJ1 A;  1VZU A;  2AE7 A;  2ICX A;  2PX7 A;  4BQH A;  4HO3 A;  2I5E A;  3V90 A;  4HO2 A;  4HOC A;  4NAN A;  2VS4 A;  5AJN A;  3T7O A;  4FIY A;  4KC4 A;  4K6R A;  2P72 A;  1VPA A;  2X65 A;  2VXM A;  1GWV A;  1VGZ A;  4MIX A;  3SXG A;  3V0P A;  4EVW A;  2BO7 A;  3F1Y A;  1FO8 A;  3U2U A;  3RMW A;  1YP2 A;  1ZI1 A;  1MP3 A;  2JCJ A;  2MZB A;  1G2V A;  5FTV A;  1WT0 A;  4B4B A;  1ZJ0 A;  2JCO A;  1R7X A;  1JYL A;  2VK9 A;  3CKQ A;  5CQL X;  4DE7 A;  5AJO A;  1YP3 A;  3JUJ A;  2Y4L A;  3PNN A;  1NKH B;  1VZX A;  1O23 B;  1S4N A;  4CJ8 A;  1H7E A;  4B42 A;  5C36 A;  1XZ6 A;  2RJ4 A;  1FGG A;  4MND A;  4Y6N A;  2RIT A;  1ZHJ A;  3OAM A;  1WT2 A;  4NAL A;  3ST8 A;  1H5S B;  3OH0 A;  1G3L A;  1LZI A;  2WAW A;  4ZDQ A;  1HJJ A;  1H5R B;  5FUH A;  3V0Q A;  5L6V A;  1QWJ A;  1WT3 A;  2FYA A;  2QKX A;  1O7O A;  4O6M A;  1V84 A;  1G93 A;  2O1G A;  1ZIZ A;  4AAW A;  3IOJ A;  4ARW A;  3OH1 A;  2VSI A;  2W0W A;  2Z87 A;  4Y6U A;  2YQH A;  3SXB A;  3SXE A;  5AJP A;  4KRV A;  4C2S A;  2YQS A;  2P73 A;  4L41 C;  3R2W A;  4DEC A;  4XWI A;  1JV3 A;  4B4G A;  2RJ9 A;  1FG5 N;  2AEC A;  1ON6 A;  1R7U A;  1ZJ3 A;  1H7T A;  2FY7 A;  4B5B A;  1H5T B;  1O0R A;  2RIX A;  3I0I X;  2YCM A;  2O1H A;  1R81 A;  2WVK A;  1VGU A;  1Z90 A;  5CMI A;  2AM4 A;  3ZLL A;  4E1K A;  4KXO A;  5FV9 A;  3ZGF A;  2AM5 A;  4EE3 A;  2XWN A;  4D48 A;  1FOA A;  2D7R A;  4FCE A;  1R7Y A;  1HM9 A;  4FRO A;  3U0Y A;  4Y7U A;  1FR8 A;  1NWG B;  1WSZ A;  5CMJ A;  4D11 A;  5CMH A;  3QVB A;  2PGV A;  2YQJ A;  4D0T A;  1ZJP A;  4HO6 A;  4Y63 A;  2BO6 A;  3NGW A;  5FTS A;  2A8W A;  1JV1 A;  2V0I A;  4EEO A;  3SXC A;  2D0J A;  5CMG X;  4AYL A;  1VIC A;  3DJ4 A;  1INJ A;  5JQQ A;  3EE5 A;  4HCQ A;  3U0X A;  5C38 A;  4CJC A;  3V0O A;  1FZW A;  3SXD A;  1R7V A;  2DPW A;  3SX5 A;  5DDT A;  1KWS A;  2YC5 A;  2Y4K A;  4JD0 A;  2O1F A;  1OQM B;  5FYE A;  2FYB A;  4IRQ A;  4FRD A;  4YS8 A;  5FU0 A;  1JVG A;  5BXC A;  2C0N A;  2Q4J A;  1IIM A;  2JCL A;  1VH3 A;  2J0A A;  3TZT A;  4M4K A;  3I0H A;  3PKP A;  3ZF8 A;  1W57 A;  4FCU A;  2WEE A;  4Y7F A;  4IRP A;  4B2W A;  4B3U A;  1S4P A;  5IDS A;  4HO8 A;  3SX8 A;  3OH4 A;  1XHB A;  3OC9 A;  3Q80 A;  2V0K A;  1I52 A;  1MP4 A;  4BMA A;  4KC2 A;  5EJ1 A;  1LL2 A;  4Q7C A;  1TW5 A;  4CVH A;  2BO4 A;  3U2W A;  2RJ5 A;  3CKJ A;  3HL3 A;  4ASJ A;  4B2X A;  1K4V A;  3SX3 A;  1YP4 A;  1FXJ A;  5CMF X;  3OH3 A;  4EE5 A;  4KNX A;  4HO4 A;  3SPT A;  1NMM B;  1GWW A;  2AM3 A;  5C1G A;  1OMZ A;  4JIS A;  2Y4M A;  2Y4J A;  3V8Z A;  4Y64 A;  2XMH A;  1VGT A;  2D7I A;  1ZI4 A;  5L6S A;  1LZ0 A;  1H7Q A;  2RJ1 A;  4P00 A;  1O7Q A;  1FXO A;  2E8B A;  4EE4 A;  1YRO B;  4HO9 A;  1VGW A;  4FRM A;  1QG8 A;  2V0L A;  4NAK A;  5J49 A;  2X5Z A;  3BCV A;  2XWL A;  2WE9 A;  5EJZ A;  3I0C A;  3I0L A;  1IIN A;  2Y6P A;  4HG6 A;  1ZCV A;  5D92 A;  1LZJ A;  1G0R A;  4CJB A;  2V0H A;  1WT1 A;  4Y62 A;  5CQP A;  2J0B A;  1HJL A;  2UX8 A;  3I0D A;  2P6W A;  4EEG A;  2ZU8 A;  4EEA A;  5CQN X;  2FFV A;  1H7H A;  2VD4 A;  1EZI A;  3O3P A;  3D98 A;  3I0E A;  4D11 C;  2Z86 A;  4FQW A;  5C3B A;  1G1L A;  3CGX A;  1PZT A;  2FYD B;  3E26 A;  4FIX A;  3FOQ A;  2PGY A;  3V91 A;  4KQL A;  5C48 A;  2W0V A;  5C1L A;  3I0F A;  1E5K A;  1G95 A;  1S4O A;  1ZJ2 A;  2VS3 A;  1WVC A;  4KT7 A;  2YQC A;  2NXV A;  3D8V A;  3K8E A;  4D0Z A;  3RMV A;  4J18 A;  1LL0 A;  1NF5 B;  5C4C A;  2GGO A;  4ECM A;  1R80 A;  3T7M A;  1ZCT A;  1PZY B;  3DUV A;  2QH5 A;  3SXA A;  4FRA A;  1GA8 A;  4KNR A;  1FRW A;  3U2T A;  5C4F A;  2OEG A;  2RJ8 A;  3PKQ A;  2XWM A;  3V0M A;  2I5K A;  3K8D A;  2AGD A;  1ZI5 A;  1MC3 A;  1V82 A;  2WVL A;  4M2A A;  1TVY A;  1GQC A;  4KPZ A;  1G9R A;  3KIA A;  5FU8 A;  4DDZ A;  3Q7U A;  1FWY A;  3R3I A;  3U2X A;  3DK5 A;  4AC3 A;  5C3D A;  3IOH A;  2RJ6 A;  5CQO A;  5C8R A;  1QGQ A;  3FWW A;  1H4D A;  1V83 A;  3I0G A;  2FFU A;  5C1H A;  3ZGG A;  1NHE B;  2AH9 A;  2VSH A;  2A8U A;  4LW6 A;  5DDV A;  1G23 A;  1H7L A;  3V0N A;  2WGZ A;  3CKV A;  4EEM A;  1GX4 A;  1MP5 A;  3T7N A;  4R7P A;  2VXL A;  4Y7V A;  2GGQ A;  2RJ0 A;  2QGI A;  1HV9 A;  1R82 A;  1H4E A;  5EIY A;  1INI A;  3OH2 A;  1GQ9 A;  3E25 A;  2BO8 A;  2CU2 A;  5IFY A;  2YC3 A;  4G3S A;  1LL3 A;  1ON8 A;  1W77 A;  3N9W A;  4G87 A;  1TZF A;  2OI6 A;  3USQ A;  4B4M A;  1ZDF A;  4NAI A;  1W55 A;  3F1C A;  4M2B A;  4HO0 A;  3U2V A;  1SS9 A;  4FRB A;  1G8O A;  1VZT A;  2E3D A;  4Y7G A;  5C4E A;  1H7F A;  2X60 A;  2RIY A;  4FRL A;  3ZLK A;  3OKR A;  2ICY A;  3JUK A;  4Y9X A;  4M28 A;  1LVW A;  3OGZ A;  1H3M A;  1H5S D;  1TW1 A;  4MYB A;  5C49 A;  2WVM A;  2FYC B;  1G97 A;  1H5S C;  1ZCY A;  4KPX A;  2PA4 A;  1JYK A;  4HO5 A;  2OI5 A;  3JTJ A;  1VM8 A;  1EYR A;  4FRH A;  2Y7A A;  3V8Y A;  3RSB A;  4LW3 A;  1NQI B;  3I0K A;  5HS2 A;  1R7T A;  1H7G A;  2ZU9 A;  1VH1 A;  4UEG A;  4O6N A;  1OMX A;  1ZCU A;  1H5S A;  4FRE A;  2JCK A;  5I1F A;  2V0J A;  5C4D A;  4P02 A;  4G3P A;  1H5R A;  3CKN A;  2VFZ A;  2X5S A;  4FRP A;  1LZ7 A;  4KC1 A;  3LW6 A;  4G3Q A;  1GX0 A;  2RIZ A;  3POL A;  2OI7 A;  1ZI3 A;  3CKO A;  1ZDG A;  3V0L A;  5C47 A;  2ZU7 A;  1QGS A;  1HM0 A;  3D5N A;  2YES A;  3BRK X;  2AES A;  3Q4S A;  4Y7T A;  3IOI A;  5CQM X;  5IDT A;  3USR A;  4AYJ A;  1FO9 A;  3CU0 A;  3I0J A;  2RJ7 A;  1JVD A;  1HM8 A;  2OEF A;  1H5T A;  2APC A;  5C4B A;  2VS5 A;  5D91 A;  5C3A A;  1FR9 A;  3TQD A;  4ASY A;  3GUE A;  2XME A;  1ZJO A;  2I7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...