3HL3A

2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
AMKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITGKEHMGDVVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVEEFTNQKEGAKVLLQSVDDPERFGVANIQNRKIIEIEEKPKEPKSSYAVTGIYLYDSKVFSYIKELKPSARGELEITDINNWYLKRGVLTYNEMSGWWTDAGTHVSLQRANALARDINFGKQFNGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate thymidylyltransferase
publication title 2.76 Angstrom Crystal Structure of a Putative Glucose-1-Phosphate Thymidylyltransferase from Bacillus anthracis in Complex with a Sucrose.
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 79
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3hl3A00
5FU8A 2APCA 4HO8A 3T7OA 1VGUA 5C1HA 1VGWA 4GBPA 1ZCUA 4NANA 4AC3A 4EEOA 3R2WA 3EE5A 2RIZA 1H4DA 2AM4A 1NWGB 1VZTA 3I0JA 5J49A 2FY7A 2UX8A 1QWJA 1ZJ3A 1GA8A 2O1FA 2Y4LA 2WEEA 1OMZA 4ECMA 1H5RA 4UEGA 1MP5A 3K8DA 3V91A 4NALA 1LL3A 2Q4JA 3USRA 4FRAA 4M2BA 3CKOA 3U2TA 1GX4A 1JV1A 1VGZA 2V0HA 2VFZA 4KPZA 3Q7UA 5DDVA 4AAWA 5C3BA 2E3DA 1QGQA 2RJ4A 1R7XA 3RSBA 2FFUA 4HO0A 3E25A 3SXGA 3V0PA 4XWIA 4JD0A 3SX7A 1JYLA 3D5NA 3DUVA 2VXLA 2OI5A 2XWLA 4JISA 2V0LA 2P73A 4B3UA 1LZ7A 5C3DA 1R7YA 4KNXA 2AE7A 2VSIA 2BO6A 1VM8A 4FROA 2Z87A 4FRLA 1ZI5A 4KXOA 2GGQA 4G87A 4CJCA 1LZIA 5C38A 2XWMA 4C2SA 2QGIA 1S4NA 1H7QA 2V0JA 3NGWA 1FGGA 2X5SA 2RJ6A 4ARWA 3OH3A 1ZHJA 2V0IA 4DDZA 4EEAA 1FXJA 4Y62A 3HL3A 3U0YA 2X60A 3LW6A 3Q4SA 3JUKA 3ZGGA 5C1LA 4EEGA 2FYBA 3U2UA 2AECA 1H5SA 2PX7A 3PKPA 3USQA 2CU2A 5IFYA 5CMGX 3CU0A 4BMAA 3I0LA 5FTSA 1VGTA 1ZIZA 1SS9A 3SX5A 1H5RB 2AM3A 1HM8A 1H7HA 3OAMA 1H5SD 4FRBA 1TZFA 2XMHA 2AESA 5C36A 3SX8A 4D11A 4MNDA 2RJ0A 3K8EA 5CQLX 1NQIB 5C47A 4EE4A 1YP3A 5CMFX 5FU0A 4Y7UA 2PA4A 4HO5A 1R7TA 3OGZA 1GWWA 3OKRA 3I0KA 4CJ8A 3RMVA 1ZI1A 1MP4A 2A8WA 2PGVA 1TW1A 3D8VA 1FO9A 2DPWA 1H5TA 2Y4MA 4FRDA 2D7IA 4G3SA 4Y9XA 2X65A 4AYLA 1W57A 1O7QA 4FCUA 1VZXA 2RITA 4EVWA 1O7OA 2QKXA 2I5EA 3CGXA 1H7LA 3PNNA 1KWSA 4M2AA 3F1YA 2A8UA 4B42A 4LW6A 4HOCA 2O1HA 3KIAA 4CJBA 2P72A 3OH0A 1INIA 1VH1A 2VSHA 3R3IA 5CMHA 4NAKA 2VS4A 1ZJPA 2YQJA 4FRMA 2W0VA 3U0XA 4ASJA 2RJ7A 3ZF8A 3I0EA 1H5SB 1ZDGA 4FRHA 1HJLA 1V84A 4IRQA 1NF5B 2YQCA 2X5ZA 2E8BA 2JCLA 2Y4KA 5AJOA 4Y63A 3T7NA 3CKJA 1ZDFA 2XMEA 4IRPA 4Y6NA 5AJNA 3T7MA 2YC5A 4B4MA 3V0LA 3GUEA 1ZCTA 1PZYB 4ASYA 4KT7A 2FFVA 1YROB 5C48A 5C4DA 4AYJA 5EJ1A 5C4CA 5BXCA 1H4CA 3TZTA 1HV9A 4B2XA 1PZTA 1H5TB 1FO8A 3RMWA 2RIXA 1FZWA 5L6SA 2WVLA 1GWVA 5C4EA 1YP2A 3V90A 1JYKA 2WVKA 4FQWA 4HO3A 4DE7A 5CMJA 1H5SC 3I0CA 3OH4A 2VD4A 2XWNA 4B5BA 1HM0A 3I0IX 5CQPA 4KC2A 4L41C 5CQMX 1H7GA 1JV3A 1INJA 1QG8A 1LZJA 1EYRA 1VH3A 4FRPA 3V0MA 3D98A 2WVMA 4ZDQA 3V0NA 4D11C 4HO9A 1K4VA 3Q80A 4FCEA 1ZJ0A 2AGDA 1NKHB 2I5KA 1S4OA 1G8OA 1IIMA 1QGSA 1WT2A 1H4EA 4D0ZA 2JCOA 1FR9A 5FTVA 1OMXA 3DK5A 4Y7FA 1H7EA 3I0DA 1TVYA 3I0GA 1EZIA 1V83A 2RJ5A 2Y7AA 3QVBA 4KQLA 4KRVA 1GQCA 2OI6A 5C8RA 1VPAA 2MZBA 4B4BA 4HO4A 3JUJA 4M4KA 3E26A 1LL0A 1ON6A 5AJPA 1W77A 1LL2A 2ZU8A 1R82A 1S4PA 3V0QA 2W0WA 2OEGA 1NHEB 5CMIA 2BO7A 1TW5A 1V82A 5CQNX 2RJ8A 4Y64A 3CKVA 4KC1A 4EE5A 2ICXA 5C3AA 1W55A 4P02A 1LZ0A 4Y7TA 2YESA 2WE9A 4P00A 3U2XA 1NMMB 1G9RA 1IINA 2D0JA 2PGYA 4FRQA 4KPXA 4HG6A 2OI7A 1OQMB 4Y7GA 2P6WA 2RIYA 4MYBA 2FYCB 1ZCVA 2Y4JA 1R81A 2YCMA 4J18A 1H7FA 4D0TA 1HM9A 2BO4A 1ZJ2A 4EE3A 1G0RA 1R7VA 2AM5A 3SX3A 3FWWA 1WT3A 4KNRA 2JCKA 1G93A 3ST8A 2V0KA 3PKQA 2NXVA 4CVHA 3ZGFA 1ZI3A 3OC9A 3I0FA 4E1KA 4FREA 3SPTA 1E5KA 1FG5N 5CQOA 1I52A 5FUHA 1Z90A 2YQHA 1YP4A 1HJJA 5C4FA 1XZ6A 1ZJOA 1MC3A 1ZCYA 3V8ZA 2RJ1A 5HS2A 4D48A 3ZLKA 3POLA 1H3MA 1FWYA 1FR8A 1FGXA 1VZUA 4B2WA 4Y6UA 5C49A 2WAWA 1XHBA 5FYEA 5IDTA 4BQHA 3SXAA 3SXDA 2VXMA 4YS8A 1O23B 1O0RA 3BRKX 3SXEA 3N9WA 3I0HA 1G97A 2VS5A 5C1GA 4M28A 4R7PA 4DECA 2ICYA 4HCQA 5L6VA 1ZI4A 3ZLLA 2WGZA 3V8YA 3F1CA 4EEMA 3OH2A 1JVGA 4K6RA 3OH1A 4Y7VA 1MP3A 4G3QA 2Y6PA 1GX0A 2Z86A 3JTJA 5C4BA 4KC4A 1FRWA 1R7UA 5EIYA 5IDSA 4LW3A 5I1FA 1WSZA 3IOHA 1H7TA 4NAIA 2FYAA 3DJ4A 3TQDA 1ON8A 3BCVA 4HO2A 2D7RA 1ZJ1A 2AH9A 3SXBA 2QH5A 3O3PA 5FV9A 5JQQA 3U2WA 2VS3A 3SXCA 2RJ9A 1G23A 1FXOA 2BO8A 2YQSA 4HO6A 1GQ9A 2YC3A 4G3PA 3U2VA 1JVDA 1G3LA 1FOAA 3FOQA 3IOIA 3V0OA 3CKNA 1VICA 2O1GA 1WVCA 1LVWA 1WT1A 2JCJA 1G95A 1R80A 2GGOA 1WT0A 2ZU9A 5EJZA 2ZU7A 2FYDB 4B4GA 1G1LA 1G2VA 2I7BA 2OEFA 5DDTA 3CKQA 3IOJA
chains in the Genus database with same CATH superfamily
5FU8A 2APCA 4HO8A 3T7OA 1VGUA 5C1HA 1VGWA 4GBPA 1ZCUA 4NANA 4AC3A 4EEOA 3R2WA 3EE5A 2RIZA 1H4DA 2AM4A 1NWGB 1VZTA 3I0JA 5J49A 2FY7A 2UX8A 1QWJA 1ZJ3A 1GA8A 2O1FA 2Y4LA 2VK9A 2WEEA 1OMZA 4ECMA 1H5RA 4UEGA 1MP5A 3K8DA 3V91A 4NALA 1LL3A 2Q4JA 3USRA 4FRAA 4M2BA 3CKOA 3U2TA 1GX4A 1JV1A 1VGZA 2V0HA 2VFZA 4KPZA 3Q7UA 5DDVA 4AAWA 5C3BA 2E3DA 1QGQA 2RJ4A 1R7XA 3RSBA 2FFUA 4HO0A 3E25A 3SXGA 3V0PA 4XWIA 4JD0A 3SX7A 1JYLA 3D5NA 3DUVA 2VXLA 2OI5A 2XWLA 4JISA 2V0LA 2P73A 4B3UA 1LZ7A 5C3DA 1R7YA 4KNXA 2AE7A 2VSIA 2BO6A 2C0NA 1VM8A 2J0AA 4FROA 2Z87A 4FRLA 1ZI5A 4KXOA 2GGQA 4G87A 4CJCA 1LZIA 5C38A 2XWMA 4C2SA 2QGIA 1S4NA 1H7QA 2V0JA 3NGWA 1FGGA 2X5SA 2RJ6A 4ARWA 3OH3A 1ZHJA 2V0IA 4DDZA 4EEAA 1FXJA 4Y62A 3HL3A 3U0YA 2X60A 3LW6A 3Q4SA 3JUKA 3ZGGA 5C1LA 4EEGA 2FYBA 3U2UA 2AECA 1H5SA 2PX7A 3PKPA 3USQA 2CU2A 5IFYA 5CMGX 3CU0A 4BMAA 3I0LA 5FTSA 1VGTA 1ZIZA 1SS9A 3SX5A 1H5RB 2AM3A 1HM8A 1H7HA 3OAMA 1H5SD 4FRBA 1TZFA 2XMHA 2AESA 5C36A 3SX8A 4D11A 4MNDA 2RJ0A 3K8EA 5CQLX 1NQIB 5C47A 4EE4A 1YP3A 5CMFX 5FU0A 4Y7UA 2PA4A 4HO5A 1R7TA 3OGZA 1GWWA 3OKRA 3I0KA 4CJ8A 3RMVA 1ZI1A 1MP4A 2A8WA 2PGVA 1TW1A 3D8VA 1FO9A 2DPWA 1H5TA 2Y4MA 4FRDA 2D7IA 4G3SA 4Y9XA 2X65A 4AYLA 1W57A 1O7QA 4FCUA 1VZXA 2RITA 4EVWA 1O7OA 4MIXA 2QKXA 2I5EA 3CGXA 1H7LA 3PNNA 1KWSA 4M2AA 3F1YA 2A8UA 4B42A 4LW6A 4HOCA 2O1HA 3KIAA 4CJBA 2P72A 3OH0A 1INIA 1VH1A 2VSHA 4FIYA 3R3IA 5CMHA 4NAKA 5D91A 2VS4A 1ZJPA 2YQJA 4FRMA 2W0VA 3U0XA 4ASJA 2RJ7A 3ZF8A 3I0EA 1H5SB 1ZDGA 4FRHA 1HJLA 1V84A 2J0BA 5D92A 4IRQA 1NF5B 2YQCA 2X5ZA 2E8BA 2JCLA 2Y4KA 5AJOA 4Y63A 3T7NA 3CKJA 1ZDFA 2XMEA 4IRPA 4Y6NA 5AJNA 3T7MA 2YC5A 4B4MA 3V0LA 3GUEA 1ZCTA 1PZYB 4ASYA 4KT7A 2FFVA 1YROB 5C48A 5C4DA 4AYJA 5EJ1A 5C4CA 4O6NA 5BXCA 1H4CA 3TZTA 1HV9A 4B2XA 1PZTA 1H5TB 1FO8A 3RMWA 2RIXA 1FZWA 5L6SA 2WVLA 1GWVA 5C4EA 1YP2A 3V90A 1JYKA 2WVKA 4FQWA 4HO3A 4DE7A 5CMJA 1H5SC 3I0CA 3OH4A 2VD4A 2XWNA 4B5BA 1HM0A 3I0IX 5CQPA 4KC2A 4L41C 5CQMX 1H7GA 1JV3A 1INJA 1QG8A 1LZJA 1EYRA 1VH3A 4FRPA 3V0MA 3D98A 2WVMA 4ZDQA 3V0NA 4D11C 4HO9A 1K4VA 3Q80A 4FCEA 1ZJ0A 2AGDA 1NKHB 2I5KA 1S4OA 1G8OA 1IIMA 1QGSA 1WT2A 1H4EA 4D0ZA 2JCOA 1FR9A 5FTVA 1OMXA 3DK5A 4Y7FA 1H7EA 3I0DA 1TVYA 3I0GA 1EZIA 1V83A 2RJ5A 2Y7AA 3QVBA 4KQLA 4KRVA 1GQCA 2OI6A 5C8RA 1VPAA 2MZBA 4B4BA 4HO4A 3JUJA 4M4KA 3E26A 1LL0A 1ON6A 5AJPA 1W77A 1LL2A 2ZU8A 1R82A 1S4PA 3V0QA 2W0WA 2OEGA 1NHEB 5CMIA 2BO7A 1TW5A 1V82A 5CQNX 2RJ8A 4Y64A 3CKVA 4KC1A 4EE5A 2ICXA 5C3AA 1W55A 4P02A 1LZ0A 4Y7TA 2YESA 2WE9A 4P00A 3U2XA 1NMMB 1G9RA 1IINA 2D0JA 2PGYA 4FRQA 4KPXA 4HG6A 2OI7A 1OQMB 4Y7GA 2P6WA 2RIYA 4MYBA 2FYCB 1ZCVA 2Y4JA 1R81A 2YCMA 4J18A 1H7FA 4D0TA 1HM9A 2BO4A 1ZJ2A 4EE3A 1G0RA 1R7VA 2AM5A 3SX3A 3FWWA 1WT3A 4KNRA 4O6MA 2JCKA 1G93A 3ST8A 2V0KA 3PKQA 2NXVA 4CVHA 3ZGFA 1ZI3A 3OC9A 3I0FA 4E1KA 4FREA 3SPTA 1E5KA 1FG5N 5CQOA 1I52A 5FUHA 1Z90A 2YQHA 1YP4A 1HJJA 5C4FA 1XZ6A 1ZJOA 1MC3A 1ZCYA 3V8ZA 2RJ1A 5HS2A 4FIXA 4D48A 3ZLKA 3POLA 1H3MA 1FWYA 1FR8A 1FGXA 1VZUA 4B2WA 4Y6UA 5C49A 2WAWA 1XHBA 5FYEA 5IDTA 4BQHA 3SXAA 3SXDA 2VXMA 4YS8A 1O23B 1O0RA 3BRKX 3SXEA 3N9WA 3I0HA 1G97A 2VS5A 5C1GA 4M28A 4R7PA 4DECA 2ICYA 4HCQA 5L6VA 1ZI4A 3ZLLA 2WGZA 3V8YA 3F1CA 4EEMA 3OH2A 1JVGA 4K6RA 3OH1A 4Y7VA 1MP3A 4G3QA 2Y6PA 1GX0A 2Z86A 3JTJA 5C4BA 4KC4A 1FRWA 1R7UA 5EIYA 5IDSA 4LW3A 5I1FA 1WSZA 3IOHA 1H7TA 4NAIA 2FYAA 3DJ4A 3TQDA 1ON8A 3BCVA 4HO2A 2D7RA 1ZJ1A 2AH9A 3SXBA 2QH5A 3O3PA 5FV9A 5JQQA 3U2WA 2VS3A 3SXCA 2RJ9A 4Q7CA 1G23A 1FXOA 2BO8A 2YQSA 4HO6A 1GQ9A 2YC3A 4G3PA 3U2VA 1JVDA 1G3LA 1FOAA 3FOQA 3IOIA 3V0OA 3CKNA 1VICA 2O1GA 1WVCA 1LVWA 1WT1A 2JCJA 1G95A 1R80A 2GGOA 1WT0A 2ZU9A 5EJZA 2ZU7A 2FYDB 4B4GA 1G1LA 1G2VA 2I7BA 2OEFA 5DDTA 3CKQA 3IOJA
chains in the Genus database with same CATH topology
5FU8A 2APCA 4HO8A 3T7OA 1VGUA 5C1HA 1VGWA 4GBPA 1ZCUA 4NANA 4AC3A 4EEOA 3R2WA 3EE5A 2RIZA 1H4DA 2AM4A 1NWGB 1VZTA 3I0JA 5J49A 2FY7A 2UX8A 1QWJA 1ZJ3A 1GA8A 2O1FA 2Y4LA 2VK9A 2WEEA 1OMZA 4ECMA 1H5RA 4UEGA 1MP5A 3K8DA 3V91A 4NALA 1LL3A 2Q4JA 3USRA 4FRAA 4M2BA 3CKOA 3U2TA 1GX4A 1JV1A 1VGZA 2V0HA 2VFZA 4KPZA 3Q7UA 5DDVA 4AAWA 5C3BA 2E3DA 1QGQA 2RJ4A 1R7XA 3RSBA 2FFUA 4HO0A 3E25A 3SXGA 3V0PA 4XWIA 4JD0A 3SX7A 1JYLA 3D5NA 3DUVA 2VXLA 2OI5A 2XWLA 4JISA 2V0LA 2P73A 4B3UA 1LZ7A 5C3DA 1R7YA 4KNXA 2AE7A 2VSIA 2BO6A 2C0NA 1VM8A 2J0AA 4FROA 2Z87A 4FRLA 1ZI5A 4KXOA 2GGQA 4G87A 4CJCA 1LZIA 5C38A 2XWMA 4C2SA 2QGIA 1S4NA 1H7QA 2V0JA 3NGWA 1FGGA 2X5SA 2RJ6A 4ARWA 3OH3A 1ZHJA 2V0IA 4DDZA 4EEAA 1FXJA 4Y62A 3HL3A 3U0YA 2X60A 3LW6A 3Q4SA 3JUKA 3ZGGA 5C1LA 4EEGA 2FYBA 3U2UA 2AECA 1H5SA 2PX7A 3PKPA 3USQA 2CU2A 5IFYA 5CMGX 3CU0A 4BMAA 3I0LA 5FTSA 1VGTA 1ZIZA 1SS9A 3SX5A 1H5RB 2AM3A 1HM8A 1H7HA 3OAMA 1H5SD 4FRBA 1TZFA 2XMHA 2AESA 5C36A 3SX8A 4D11A 4MNDA 2RJ0A 3K8EA 5CQLX 1NQIB 5C47A 4EE4A 1YP3A 5CMFX 5FU0A 4Y7UA 2PA4A 4HO5A 1R7TA 3OGZA 1GWWA 3OKRA 3I0KA 4CJ8A 3RMVA 1ZI1A 1MP4A 2A8WA 2PGVA 1TW1A 3D8VA 1FO9A 2DPWA 1H5TA 2Y4MA 4FRDA 2D7IA 4G3SA 4Y9XA 2X65A 4AYLA 1W57A 1O7QA 4FCUA 1VZXA 2RITA 4EVWA 1O7OA 4MIXA 2QKXA 2I5EA 3CGXA 1H7LA 3PNNA 1KWSA 4M2AA 3F1YA 2A8UA 4B42A 4LW6A 4HOCA 2O1HA 3KIAA 4CJBA 2P72A 3OH0A 1INIA 1VH1A 2VSHA 4FIYA 3R3IA 5CMHA 4NAKA 5D91A 2VS4A 1ZJPA 2YQJA 4FRMA 2W0VA 3U0XA 4ASJA 2RJ7A 3ZF8A 3I0EA 1H5SB 1ZDGA 4FRHA 1HJLA 1V84A 2J0BA 5D92A 4IRQA 1NF5B 2YQCA 2X5ZA 2E8BA 2JCLA 2Y4KA 5AJOA 4Y63A 3T7NA 3CKJA 1ZDFA 2XMEA 4IRPA 4Y6NA 5AJNA 3T7MA 2YC5A 4B4MA 3V0LA 3GUEA 1ZCTA 1PZYB 4ASYA 4KT7A 2FFVA 1YROB 5C48A 5C4DA 4AYJA 5EJ1A 5C4CA 4O6NA 5BXCA 1H4CA 3TZTA 1HV9A 4B2XA 1PZTA 1H5TB 1FO8A 3RMWA 2RIXA 1FZWA 5L6SA 2WVLA 1GWVA 5C4EA 1YP2A 3V90A 1JYKA 2WVKA 4FQWA 4HO3A 4DE7A 5CMJA 1H5SC 3I0CA 3OH4A 2VD4A 2XWNA 4B5BA 1HM0A 3I0IX 5CQPA 4KC2A 4L41C 5CQMX 1H7GA 1JV3A 1INJA 1QG8A 1LZJA 1EYRA 1VH3A 4FRPA 3V0MA 3D98A 2WVMA 4ZDQA 3V0NA 4D11C 4HO9A 1K4VA 3Q80A 4FCEA 1ZJ0A 2AGDA 1NKHB 2I5KA 1S4OA 1G8OA 1IIMA 1QGSA 1WT2A 1H4EA 4D0ZA 2JCOA 1FR9A 5FTVA 1OMXA 3DK5A 4Y7FA 1H7EA 3I0DA 1TVYA 3I0GA 1EZIA 1V83A 2RJ5A 2Y7AA 3QVBA 4KQLA 4KRVA 1GQCA 2OI6A 5C8RA 1VPAA 2MZBA 4B4BA 4HO4A 3JUJA 4M4KA 3E26A 1LL0A 1ON6A 5AJPA 1W77A 1LL2A 2ZU8A 1R82A 1S4PA 3V0QA 2W0WA 2OEGA 1NHEB 5CMIA 2BO7A 1TW5A 1V82A 5CQNX 2RJ8A 4Y64A 3CKVA 4KC1A 4EE5A 2ICXA 5C3AA 1W55A 4P02A 1LZ0A 4Y7TA 2YESA 2WE9A 4P00A 3U2XA 1NMMB 1G9RA 1IINA 2D0JA 2PGYA 4FRQA 4KPXA 4HG6A 2OI7A 1OQMB 4Y7GA 2P6WA 2RIYA 4MYBA 2FYCB 1ZCVA 2Y4JA 1R81A 2YCMA 4J18A 1H7FA 4D0TA 1HM9A 2BO4A 1ZJ2A 4EE3A 1G0RA 1R7VA 2AM5A 3SX3A 3FWWA 1WT3A 4KNRA 4O6MA 2JCKA 1G93A 3ST8A 2V0KA 3PKQA 2NXVA 4CVHA 3ZGFA 1ZI3A 3OC9A 3I0FA 4E1KA 4FREA 3SPTA 1E5KA 1FG5N 5CQOA 1I52A 5FUHA 1Z90A 2YQHA 1YP4A 1HJJA 5C4FA 1XZ6A 1ZJOA 1MC3A 1ZCYA 3V8ZA 2RJ1A 5HS2A 4FIXA 4D48A 3ZLKA 3POLA 1H3MA 1FWYA 1FR8A 1FGXA 1VZUA 4B2WA 4Y6UA 5C49A 2WAWA 1XHBA 5FYEA 5IDTA 4BQHA 3SXAA 3SXDA 2VXMA 4YS8A 1O23B 1O0RA 3BRKX 3SXEA 3N9WA 3I0HA 1G97A 2VS5A 5C1GA 4M28A 4R7PA 4DECA 2ICYA 4HCQA 5L6VA 1ZI4A 3ZLLA 2WGZA 3V8YA 3F1CA 4EEMA 3OH2A 1JVGA 4K6RA 3OH1A 4Y7VA 1MP3A 4G3QA 2Y6PA 1GX0A 2Z86A 3JTJA 5C4BA 4KC4A 1FRWA 1R7UA 5EIYA 5IDSA 4LW3A 5I1FA 1WSZA 3IOHA 1H7TA 4NAIA 2FYAA 3DJ4A 3TQDA 1ON8A 3BCVA 4HO2A 2D7RA 1ZJ1A 2AH9A 3SXBA 2QH5A 3O3PA 5FV9A 5JQQA 3U2WA 2VS3A 3SXCA 2RJ9A 4Q7CA 1G23A 1FXOA 2BO8A 2YQSA 4HO6A 1GQ9A 2YC3A 4G3PA 3U2VA 1JVDA 1G3LA 1FOAA 3FOQA 3IOIA 3V0OA 3CKNA 1VICA 2O1GA 1WVCA 1LVWA 1WT1A 2JCJA 1G95A 1R80A 2GGOA 1WT0A 2ZU9A 5EJZA 2ZU7A 2FYDB 4B4GA 1G1LA 1G2VA 2I7BA 2OEFA 5DDTA 3CKQA 3IOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU8 A;  2APC A;  4HO8 A;  3T7O A;  1VGU A;  5C1H A;  1VGW A;  4GBP A;  1ZCU A;  4NAN A;  4AC3 A;  4EEO A;  3R2W A;  3EE5 A;  2RIZ A;  1H4D A;  2AM4 A;  1NWG B;  1VZT A;  3I0J A;  5J49 A;  2FY7 A;  2UX8 A;  1QWJ A;  1ZJ3 A;  1GA8 A;  2O1F A;  2Y4L A;  2WEE A;  1OMZ A;  4ECM A;  1H5R A;  4UEG A;  1MP5 A;  3K8D A;  3V91 A;  4NAL A;  1LL3 A;  2Q4J A;  3USR A;  4FRA A;  4M2B A;  3CKO A;  3U2T A;  1GX4 A;  1JV1 A;  1VGZ A;  2V0H A;  2VFZ A;  4KPZ A;  3Q7U A;  5DDV A;  4AAW A;  5C3B A;  2E3D A;  1QGQ A;  2RJ4 A;  1R7X A;  3RSB A;  2FFU A;  4HO0 A;  3E25 A;  3SXG A;  3V0P A;  4XWI A;  4JD0 A;  3SX7 A;  1JYL A;  3D5N A;  3DUV A;  2VXL A;  2OI5 A;  2XWL A;  4JIS A;  2V0L A;  2P73 A;  4B3U A;  1LZ7 A;  5C3D A;  1R7Y A;  4KNX A;  2AE7 A;  2VSI A;  2BO6 A;  1VM8 A;  4FRO A;  2Z87 A;  4FRL A;  1ZI5 A;  4KXO A;  2GGQ A;  4G87 A;  4CJC A;  1LZI A;  5C38 A;  2XWM A;  4C2S A;  2QGI A;  1S4N A;  1H7Q A;  2V0J A;  3NGW A;  1FGG A;  2X5S A;  2RJ6 A;  4ARW A;  3OH3 A;  1ZHJ A;  2V0I A;  4DDZ A;  4EEA A;  1FXJ A;  4Y62 A;  3HL3 A;  3U0Y A;  2X60 A;  3LW6 A;  3Q4S A;  3JUK A;  3ZGG A;  5C1L A;  4EEG A;  2FYB A;  3U2U A;  2AEC A;  1H5S A;  2PX7 A;  3PKP A;  3USQ A;  2CU2 A;  5IFY A;  5CMG X;  3CU0 A;  4BMA A;  3I0L A;  5FTS A;  1VGT A;  1ZIZ A;  1SS9 A;  3SX5 A;  1H5R B;  2AM3 A;  1HM8 A;  1H7H A;  3OAM A;  1H5S D;  4FRB A;  1TZF A;  2XMH A;  2AES A;  5C36 A;  3SX8 A;  4D11 A;  4MND A;  2RJ0 A;  3K8E A;  5CQL X;  1NQI B;  5C47 A;  4EE4 A;  1YP3 A;  5CMF X;  5FU0 A;  4Y7U A;  2PA4 A;  4HO5 A;  1R7T A;  3OGZ A;  1GWW A;  3OKR A;  3I0K A;  4CJ8 A;  3RMV A;  1ZI1 A;  1MP4 A;  2A8W A;  2PGV A;  1TW1 A;  3D8V A;  1FO9 A;  2DPW A;  1H5T A;  2Y4M A;  4FRD A;  2D7I A;  4G3S A;  4Y9X A;  2X65 A;  4AYL A;  1W57 A;  1O7Q A;  4FCU A;  1VZX A;  2RIT A;  4EVW A;  1O7O A;  2QKX A;  2I5E A;  3CGX A;  1H7L A;  3PNN A;  1KWS A;  4M2A A;  3F1Y A;  2A8U A;  4B42 A;  4LW6 A;  4HOC A;  2O1H A;  3KIA A;  4CJB A;  2P72 A;  3OH0 A;  1INI A;  1VH1 A;  2VSH A;  3R3I A;  5CMH A;  4NAK A;  2VS4 A;  1ZJP A;  2YQJ A;  4FRM A;  2W0V A;  3U0X A;  4ASJ A;  2RJ7 A;  3ZF8 A;  3I0E A;  1H5S B;  1ZDG A;  4FRH A;  1HJL A;  1V84 A;  4IRQ A;  1NF5 B;  2YQC A;  2X5Z A;  2E8B A;  2JCL A;  2Y4K A;  5AJO A;  4Y63 A;  3T7N A;  3CKJ A;  1ZDF A;  2XME A;  4IRP A;  4Y6N A;  5AJN A;  3T7M A;  2YC5 A;  4B4M A;  3V0L A;  3GUE A;  1ZCT A;  1PZY B;  4ASY A;  4KT7 A;  2FFV A;  1YRO B;  5C48 A;  5C4D A;  4AYJ A;  5EJ1 A;  5C4C A;  5BXC A;  1H4C A;  3TZT A;  1HV9 A;  4B2X A;  1PZT A;  1H5T B;  1FO8 A;  3RMW A;  2RIX A;  1FZW A;  5L6S A;  2WVL A;  1GWV A;  5C4E A;  1YP2 A;  3V90 A;  1JYK A;  2WVK A;  4FQW A;  4HO3 A;  4DE7 A;  5CMJ A;  1H5S C;  3I0C A;  3OH4 A;  2VD4 A;  2XWN A;  4B5B A;  1HM0 A;  3I0I X;  5CQP A;  4KC2 A;  4L41 C;  5CQM X;  1H7G A;  1JV3 A;  1INJ A;  1QG8 A;  1LZJ A;  1EYR A;  1VH3 A;  4FRP A;  3V0M A;  3D98 A;  2WVM A;  4ZDQ A;  3V0N A;  4D11 C;  4HO9 A;  1K4V A;  3Q80 A;  4FCE A;  1ZJ0 A;  2AGD A;  1NKH B;  2I5K A;  1S4O A;  1G8O A;  1IIM A;  1QGS A;  1WT2 A;  1H4E A;  4D0Z A;  2JCO A;  1FR9 A;  5FTV A;  1OMX A;  3DK5 A;  4Y7F A;  1H7E A;  3I0D A;  1TVY A;  3I0G A;  1EZI A;  1V83 A;  2RJ5 A;  2Y7A A;  3QVB A;  4KQL A;  4KRV A;  1GQC A;  2OI6 A;  5C8R A;  1VPA A;  2MZB A;  4B4B A;  4HO4 A;  3JUJ A;  4M4K A;  3E26 A;  1LL0 A;  1ON6 A;  5AJP A;  1W77 A;  1LL2 A;  2ZU8 A;  1R82 A;  1S4P A;  3V0Q A;  2W0W A;  2OEG A;  1NHE B;  5CMI A;  2BO7 A;  1TW5 A;  1V82 A;  5CQN X;  2RJ8 A;  4Y64 A;  3CKV A;  4KC1 A;  4EE5 A;  2ICX A;  5C3A A;  1W55 A;  4P02 A;  1LZ0 A;  4Y7T A;  2YES A;  2WE9 A;  4P00 A;  3U2X A;  1NMM B;  1G9R A;  1IIN A;  2D0J A;  2PGY A;  4FRQ A;  4KPX A;  4HG6 A;  2OI7 A;  1OQM B;  4Y7G A;  2P6W A;  2RIY A;  4MYB A;  2FYC B;  1ZCV A;  2Y4J A;  1R81 A;  2YCM A;  4J18 A;  1H7F A;  4D0T A;  1HM9 A;  2BO4 A;  1ZJ2 A;  4EE3 A;  1G0R A;  1R7V A;  2AM5 A;  3SX3 A;  3FWW A;  1WT3 A;  4KNR A;  2JCK A;  1G93 A;  3ST8 A;  2V0K A;  3PKQ A;  2NXV A;  4CVH A;  3ZGF A;  1ZI3 A;  3OC9 A;  3I0F A;  4E1K A;  4FRE A;  3SPT A;  1E5K A;  1FG5 N;  5CQO A;  1I52 A;  5FUH A;  1Z90 A;  2YQH A;  1YP4 A;  1HJJ A;  5C4F A;  1XZ6 A;  1ZJO A;  1MC3 A;  1ZCY A;  3V8Z A;  2RJ1 A;  5HS2 A;  4D48 A;  3ZLK A;  3POL A;  1H3M A;  1FWY A;  1FR8 A;  1FGX A;  1VZU A;  4B2W A;  4Y6U A;  5C49 A;  2WAW A;  1XHB A;  5FYE A;  5IDT A;  4BQH A;  3SXA A;  3SXD A;  2VXM A;  4YS8 A;  1O23 B;  1O0R A;  3BRK X;  3SXE A;  3N9W A;  3I0H A;  1G97 A;  2VS5 A;  5C1G A;  4M28 A;  4R7P A;  4DEC A;  2ICY A;  4HCQ A;  5L6V A;  1ZI4 A;  3ZLL A;  2WGZ A;  3V8Y A;  3F1C A;  4EEM A;  3OH2 A;  1JVG A;  4K6R A;  3OH1 A;  4Y7V A;  1MP3 A;  4G3Q A;  2Y6P A;  1GX0 A;  2Z86 A;  3JTJ A;  5C4B A;  4KC4 A;  1FRW A;  1R7U A;  5EIY A;  5IDS A;  4LW3 A;  5I1F A;  1WSZ A;  3IOH A;  1H7T A;  4NAI A;  2FYA A;  3DJ4 A;  3TQD A;  1ON8 A;  3BCV A;  4HO2 A;  2D7R A;  1ZJ1 A;  2AH9 A;  3SXB A;  2QH5 A;  3O3P A;  5FV9 A;  5JQQ A;  3U2W A;  2VS3 A;  3SXC A;  2RJ9 A;  1G23 A;  1FXO A;  2BO8 A;  2YQS A;  4HO6 A;  1GQ9 A;  2YC3 A;  4G3P A;  3U2V A;  1JVD A;  1G3L A;  1FOA A;  3FOQ A;  3IOI A;  3V0O A;  3CKN A;  1VIC A;  2O1G A;  1WVC A;  1LVW A;  1WT1 A;  2JCJ A;  1G95 A;  1R80 A;  2GGO A;  1WT0 A;  2ZU9 A;  5EJZ A;  2ZU7 A;  2FYD B;  4B4G A;  1G1L A;  1G2V A;  2I7B A;  2OEF A;  5DDT A;  3CKQ A;  3IOJ A; 
#chains in the Genus database with same CATH topology
 5FU8 A;  2APC A;  4HO8 A;  3T7O A;  1VGU A;  5C1H A;  1VGW A;  4GBP A;  1ZCU A;  4NAN A;  4AC3 A;  4EEO A;  3R2W A;  3EE5 A;  2RIZ A;  1H4D A;  2AM4 A;  1NWG B;  1VZT A;  3I0J A;  5J49 A;  2FY7 A;  2UX8 A;  1QWJ A;  1ZJ3 A;  1GA8 A;  2O1F A;  2Y4L A;  2VK9 A;  2WEE A;  1OMZ A;  4ECM A;  1H5R A;  4UEG A;  1MP5 A;  3K8D A;  3V91 A;  4NAL A;  1LL3 A;  2Q4J A;  3USR A;  4FRA A;  4M2B A;  3CKO A;  3U2T A;  1GX4 A;  1JV1 A;  1VGZ A;  2V0H A;  2VFZ A;  4KPZ A;  3Q7U A;  5DDV A;  4AAW A;  5C3B A;  2E3D A;  1QGQ A;  2RJ4 A;  1R7X A;  3RSB A;  2FFU A;  4HO0 A;  3E25 A;  3SXG A;  3V0P A;  4XWI A;  4JD0 A;  3SX7 A;  1JYL A;  3D5N A;  3DUV A;  2VXL A;  2OI5 A;  2XWL A;  4JIS A;  2V0L A;  2P73 A;  4B3U A;  1LZ7 A;  5C3D A;  1R7Y A;  4KNX A;  2AE7 A;  2VSI A;  2BO6 A;  2C0N A;  1VM8 A;  2J0A A;  4FRO A;  2Z87 A;  4FRL A;  1ZI5 A;  4KXO A;  2GGQ A;  4G87 A;  4CJC A;  1LZI A;  5C38 A;  2XWM A;  4C2S A;  2QGI A;  1S4N A;  1H7Q A;  2V0J A;  3NGW A;  1FGG A;  2X5S A;  2RJ6 A;  4ARW A;  3OH3 A;  1ZHJ A;  2V0I A;  4DDZ A;  4EEA A;  1FXJ A;  4Y62 A;  3HL3 A;  3U0Y A;  2X60 A;  3LW6 A;  3Q4S A;  3JUK A;  3ZGG A;  5C1L A;  4EEG A;  2FYB A;  3U2U A;  2AEC A;  1H5S A;  2PX7 A;  3PKP A;  3USQ A;  2CU2 A;  5IFY A;  5CMG X;  3CU0 A;  4BMA A;  3I0L A;  5FTS A;  1VGT A;  1ZIZ A;  1SS9 A;  3SX5 A;  1H5R B;  2AM3 A;  1HM8 A;  1H7H A;  3OAM A;  1H5S D;  4FRB A;  1TZF A;  2XMH A;  2AES A;  5C36 A;  3SX8 A;  4D11 A;  4MND A;  2RJ0 A;  3K8E A;  5CQL X;  1NQI B;  5C47 A;  4EE4 A;  1YP3 A;  5CMF X;  5FU0 A;  4Y7U A;  2PA4 A;  4HO5 A;  1R7T A;  3OGZ A;  1GWW A;  3OKR A;  3I0K A;  4CJ8 A;  3RMV A;  1ZI1 A;  1MP4 A;  2A8W A;  2PGV A;  1TW1 A;  3D8V A;  1FO9 A;  2DPW A;  1H5T A;  2Y4M A;  4FRD A;  2D7I A;  4G3S A;  4Y9X A;  2X65 A;  4AYL A;  1W57 A;  1O7Q A;  4FCU A;  1VZX A;  2RIT A;  4EVW A;  1O7O A;  4MIX A;  2QKX A;  2I5E A;  3CGX A;  1H7L A;  3PNN A;  1KWS A;  4M2A A;  3F1Y A;  2A8U A;  4B42 A;  4LW6 A;  4HOC A;  2O1H A;  3KIA A;  4CJB A;  2P72 A;  3OH0 A;  1INI A;  1VH1 A;  2VSH A;  4FIY A;  3R3I A;  5CMH A;  4NAK A;  5D91 A;  2VS4 A;  1ZJP A;  2YQJ A;  4FRM A;  2W0V A;  3U0X A;  4ASJ A;  2RJ7 A;  3ZF8 A;  3I0E A;  1H5S B;  1ZDG A;  4FRH A;  1HJL A;  1V84 A;  2J0B A;  5D92 A;  4IRQ A;  1NF5 B;  2YQC A;  2X5Z A;  2E8B A;  2JCL A;  2Y4K A;  5AJO A;  4Y63 A;  3T7N A;  3CKJ A;  1ZDF A;  2XME A;  4IRP A;  4Y6N A;  5AJN A;  3T7M A;  2YC5 A;  4B4M A;  3V0L A;  3GUE A;  1ZCT A;  1PZY B;  4ASY A;  4KT7 A;  2FFV A;  1YRO B;  5C48 A;  5C4D A;  4AYJ A;  5EJ1 A;  5C4C A;  4O6N A;  5BXC A;  1H4C A;  3TZT A;  1HV9 A;  4B2X A;  1PZT A;  1H5T B;  1FO8 A;  3RMW A;  2RIX A;  1FZW A;  5L6S A;  2WVL A;  1GWV A;  5C4E A;  1YP2 A;  3V90 A;  1JYK A;  2WVK A;  4FQW A;  4HO3 A;  4DE7 A;  5CMJ A;  1H5S C;  3I0C A;  3OH4 A;  2VD4 A;  2XWN A;  4B5B A;  1HM0 A;  3I0I X;  5CQP A;  4KC2 A;  4L41 C;  5CQM X;  1H7G A;  1JV3 A;  1INJ A;  1QG8 A;  1LZJ A;  1EYR A;  1VH3 A;  4FRP A;  3V0M A;  3D98 A;  2WVM A;  4ZDQ A;  3V0N A;  4D11 C;  4HO9 A;  1K4V A;  3Q80 A;  4FCE A;  1ZJ0 A;  2AGD A;  1NKH B;  2I5K A;  1S4O A;  1G8O A;  1IIM A;  1QGS A;  1WT2 A;  1H4E A;  4D0Z A;  2JCO A;  1FR9 A;  5FTV A;  1OMX A;  3DK5 A;  4Y7F A;  1H7E A;  3I0D A;  1TVY A;  3I0G A;  1EZI A;  1V83 A;  2RJ5 A;  2Y7A A;  3QVB A;  4KQL A;  4KRV A;  1GQC A;  2OI6 A;  5C8R A;  1VPA A;  2MZB A;  4B4B A;  4HO4 A;  3JUJ A;  4M4K A;  3E26 A;  1LL0 A;  1ON6 A;  5AJP A;  1W77 A;  1LL2 A;  2ZU8 A;  1R82 A;  1S4P A;  3V0Q A;  2W0W A;  2OEG A;  1NHE B;  5CMI A;  2BO7 A;  1TW5 A;  1V82 A;  5CQN X;  2RJ8 A;  4Y64 A;  3CKV A;  4KC1 A;  4EE5 A;  2ICX A;  5C3A A;  1W55 A;  4P02 A;  1LZ0 A;  4Y7T A;  2YES A;  2WE9 A;  4P00 A;  3U2X A;  1NMM B;  1G9R A;  1IIN A;  2D0J A;  2PGY A;  4FRQ A;  4KPX A;  4HG6 A;  2OI7 A;  1OQM B;  4Y7G A;  2P6W A;  2RIY A;  4MYB A;  2FYC B;  1ZCV A;  2Y4J A;  1R81 A;  2YCM A;  4J18 A;  1H7F A;  4D0T A;  1HM9 A;  2BO4 A;  1ZJ2 A;  4EE3 A;  1G0R A;  1R7V A;  2AM5 A;  3SX3 A;  3FWW A;  1WT3 A;  4KNR A;  4O6M A;  2JCK A;  1G93 A;  3ST8 A;  2V0K A;  3PKQ A;  2NXV A;  4CVH A;  3ZGF A;  1ZI3 A;  3OC9 A;  3I0F A;  4E1K A;  4FRE A;  3SPT A;  1E5K A;  1FG5 N;  5CQO A;  1I52 A;  5FUH A;  1Z90 A;  2YQH A;  1YP4 A;  1HJJ A;  5C4F A;  1XZ6 A;  1ZJO A;  1MC3 A;  1ZCY A;  3V8Z A;  2RJ1 A;  5HS2 A;  4FIX A;  4D48 A;  3ZLK A;  3POL A;  1H3M A;  1FWY A;  1FR8 A;  1FGX A;  1VZU A;  4B2W A;  4Y6U A;  5C49 A;  2WAW A;  1XHB A;  5FYE A;  5IDT A;  4BQH A;  3SXA A;  3SXD A;  2VXM A;  4YS8 A;  1O23 B;  1O0R A;  3BRK X;  3SXE A;  3N9W A;  3I0H A;  1G97 A;  2VS5 A;  5C1G A;  4M28 A;  4R7P A;  4DEC A;  2ICY A;  4HCQ A;  5L6V A;  1ZI4 A;  3ZLL A;  2WGZ A;  3V8Y A;  3F1C A;  4EEM A;  3OH2 A;  1JVG A;  4K6R A;  3OH1 A;  4Y7V A;  1MP3 A;  4G3Q A;  2Y6P A;  1GX0 A;  2Z86 A;  3JTJ A;  5C4B A;  4KC4 A;  1FRW A;  1R7U A;  5EIY A;  5IDS A;  4LW3 A;  5I1F A;  1WSZ A;  3IOH A;  1H7T A;  4NAI A;  2FYA A;  3DJ4 A;  3TQD A;  1ON8 A;  3BCV A;  4HO2 A;  2D7R A;  1ZJ1 A;  2AH9 A;  3SXB A;  2QH5 A;  3O3P A;  5FV9 A;  5JQQ A;  3U2W A;  2VS3 A;  3SXC A;  2RJ9 A;  4Q7C A;  1G23 A;  1FXO A;  2BO8 A;  2YQS A;  4HO6 A;  1GQ9 A;  2YC3 A;  4G3P A;  3U2V A;  1JVD A;  1G3L A;  1FOA A;  3FOQ A;  3IOI A;  3V0O A;  3CKN A;  1VIC A;  2O1G A;  1WVC A;  1LVW A;  1WT1 A;  2JCJ A;  1G95 A;  1R80 A;  2GGO A;  1WT0 A;  2ZU9 A;  5EJZ A;  2ZU7 A;  2FYD B;  4B4G A;  1G1L A;  1G2V A;  2I7B A;  2OEF A;  5DDT A;  3CKQ A;  3IOJ A; 
#chains in the Genus database with same CATH homology
 5FU8 A;  2APC A;  4HO8 A;  3T7O A;  1VGU A;  5C1H A;  1VGW A;  4GBP A;  1ZCU A;  4NAN A;  4AC3 A;  4EEO A;  3R2W A;  3EE5 A;  2RIZ A;  1H4D A;  2AM4 A;  1NWG B;  1VZT A;  3I0J A;  5J49 A;  2FY7 A;  2UX8 A;  1QWJ A;  1ZJ3 A;  1GA8 A;  2O1F A;  2Y4L A;  2VK9 A;  2WEE A;  1OMZ A;  4ECM A;  1H5R A;  4UEG A;  1MP5 A;  3K8D A;  3V91 A;  4NAL A;  1LL3 A;  2Q4J A;  3USR A;  4FRA A;  4M2B A;  3CKO A;  3U2T A;  1GX4 A;  1JV1 A;  1VGZ A;  2V0H A;  2VFZ A;  4KPZ A;  3Q7U A;  5DDV A;  4AAW A;  5C3B A;  2E3D A;  1QGQ A;  2RJ4 A;  1R7X A;  3RSB A;  2FFU A;  4HO0 A;  3E25 A;  3SXG A;  3V0P A;  4XWI A;  4JD0 A;  3SX7 A;  1JYL A;  3D5N A;  3DUV A;  2VXL A;  2OI5 A;  2XWL A;  4JIS A;  2V0L A;  2P73 A;  4B3U A;  1LZ7 A;  5C3D A;  1R7Y A;  4KNX A;  2AE7 A;  2VSI A;  2BO6 A;  2C0N A;  1VM8 A;  2J0A A;  4FRO A;  2Z87 A;  4FRL A;  1ZI5 A;  4KXO A;  2GGQ A;  4G87 A;  4CJC A;  1LZI A;  5C38 A;  2XWM A;  4C2S A;  2QGI A;  1S4N A;  1H7Q A;  2V0J A;  3NGW A;  1FGG A;  2X5S A;  2RJ6 A;  4ARW A;  3OH3 A;  1ZHJ A;  2V0I A;  4DDZ A;  4EEA A;  1FXJ A;  4Y62 A;  3HL3 A;  3U0Y A;  2X60 A;  3LW6 A;  3Q4S A;  3JUK A;  3ZGG A;  5C1L A;  4EEG A;  2FYB A;  3U2U A;  2AEC A;  1H5S A;  2PX7 A;  3PKP A;  3USQ A;  2CU2 A;  5IFY A;  5CMG X;  3CU0 A;  4BMA A;  3I0L A;  5FTS A;  1VGT A;  1ZIZ A;  1SS9 A;  3SX5 A;  1H5R B;  2AM3 A;  1HM8 A;  1H7H A;  3OAM A;  1H5S D;  4FRB A;  1TZF A;  2XMH A;  2AES A;  5C36 A;  3SX8 A;  4D11 A;  4MND A;  2RJ0 A;  3K8E A;  5CQL X;  1NQI B;  5C47 A;  4EE4 A;  1YP3 A;  5CMF X;  5FU0 A;  4Y7U A;  2PA4 A;  4HO5 A;  1R7T A;  3OGZ A;  1GWW A;  3OKR A;  3I0K A;  4CJ8 A;  3RMV A;  1ZI1 A;  1MP4 A;  2A8W A;  2PGV A;  1TW1 A;  3D8V A;  1FO9 A;  2DPW A;  1H5T A;  2Y4M A;  4FRD A;  2D7I A;  4G3S A;  4Y9X A;  2X65 A;  4AYL A;  1W57 A;  1O7Q A;  4FCU A;  1VZX A;  2RIT A;  4EVW A;  1O7O A;  4MIX A;  2QKX A;  2I5E A;  3CGX A;  1H7L A;  3PNN A;  1KWS A;  4M2A A;  3F1Y A;  2A8U A;  4B42 A;  4LW6 A;  4HOC A;  2O1H A;  3KIA A;  4CJB A;  2P72 A;  3OH0 A;  1INI A;  1VH1 A;  2VSH A;  4FIY A;  3R3I A;  5CMH A;  4NAK A;  5D91 A;  2VS4 A;  1ZJP A;  2YQJ A;  4FRM A;  2W0V A;  3U0X A;  4ASJ A;  2RJ7 A;  3ZF8 A;  3I0E A;  1H5S B;  1ZDG A;  4FRH A;  1HJL A;  1V84 A;  2J0B A;  5D92 A;  4IRQ A;  1NF5 B;  2YQC A;  2X5Z A;  2E8B A;  2JCL A;  2Y4K A;  5AJO A;  4Y63 A;  3T7N A;  3CKJ A;  1ZDF A;  2XME A;  4IRP A;  4Y6N A;  5AJN A;  3T7M A;  2YC5 A;  4B4M A;  3V0L A;  3GUE A;  1ZCT A;  1PZY B;  4ASY A;  4KT7 A;  2FFV A;  1YRO B;  5C48 A;  5C4D A;  4AYJ A;  5EJ1 A;  5C4C A;  4O6N A;  5BXC A;  1H4C A;  3TZT A;  1HV9 A;  4B2X A;  1PZT A;  1H5T B;  1FO8 A;  3RMW A;  2RIX A;  1FZW A;  5L6S A;  2WVL A;  1GWV A;  5C4E A;  1YP2 A;  3V90 A;  1JYK A;  2WVK A;  4FQW A;  4HO3 A;  4DE7 A;  5CMJ A;  1H5S C;  3I0C A;  3OH4 A;  2VD4 A;  2XWN A;  4B5B A;  1HM0 A;  3I0I X;  5CQP A;  4KC2 A;  4L41 C;  5CQM X;  1H7G A;  1JV3 A;  1INJ A;  1QG8 A;  1LZJ A;  1EYR A;  1VH3 A;  4FRP A;  3V0M A;  3D98 A;  2WVM A;  4ZDQ A;  3V0N A;  4D11 C;  4HO9 A;  1K4V A;  3Q80 A;  4FCE A;  1ZJ0 A;  2AGD A;  1NKH B;  2I5K A;  1S4O A;  1G8O A;  1IIM A;  1QGS A;  1WT2 A;  1H4E A;  4D0Z A;  2JCO A;  1FR9 A;  5FTV A;  1OMX A;  3DK5 A;  4Y7F A;  1H7E A;  3I0D A;  1TVY A;  3I0G A;  1EZI A;  1V83 A;  2RJ5 A;  2Y7A A;  3QVB A;  4KQL A;  4KRV A;  1GQC A;  2OI6 A;  5C8R A;  1VPA A;  2MZB A;  4B4B A;  4HO4 A;  3JUJ A;  4M4K A;  3E26 A;  1LL0 A;  1ON6 A;  5AJP A;  1W77 A;  1LL2 A;  2ZU8 A;  1R82 A;  1S4P A;  3V0Q A;  2W0W A;  2OEG A;  1NHE B;  5CMI A;  2BO7 A;  1TW5 A;  1V82 A;  5CQN X;  2RJ8 A;  4Y64 A;  3CKV A;  4KC1 A;  4EE5 A;  2ICX A;  5C3A A;  1W55 A;  4P02 A;  1LZ0 A;  4Y7T A;  2YES A;  2WE9 A;  4P00 A;  3U2X A;  1NMM B;  1G9R A;  1IIN A;  2D0J A;  2PGY A;  4FRQ A;  4KPX A;  4HG6 A;  2OI7 A;  1OQM B;  4Y7G A;  2P6W A;  2RIY A;  4MYB A;  2FYC B;  1ZCV A;  2Y4J A;  1R81 A;  2YCM A;  4J18 A;  1H7F A;  4D0T A;  1HM9 A;  2BO4 A;  1ZJ2 A;  4EE3 A;  1G0R A;  1R7V A;  2AM5 A;  3SX3 A;  3FWW A;  1WT3 A;  4KNR A;  4O6M A;  2JCK A;  1G93 A;  3ST8 A;  2V0K A;  3PKQ A;  2NXV A;  4CVH A;  3ZGF A;  1ZI3 A;  3OC9 A;  3I0F A;  4E1K A;  4FRE A;  3SPT A;  1E5K A;  1FG5 N;  5CQO A;  1I52 A;  5FUH A;  1Z90 A;  2YQH A;  1YP4 A;  1HJJ A;  5C4F A;  1XZ6 A;  1ZJO A;  1MC3 A;  1ZCY A;  3V8Z A;  2RJ1 A;  5HS2 A;  4FIX A;  4D48 A;  3ZLK A;  3POL A;  1H3M A;  1FWY A;  1FR8 A;  1FGX A;  1VZU A;  4B2W A;  4Y6U A;  5C49 A;  2WAW A;  1XHB A;  5FYE A;  5IDT A;  4BQH A;  3SXA A;  3SXD A;  2VXM A;  4YS8 A;  1O23 B;  1O0R A;  3BRK X;  3SXE A;  3N9W A;  3I0H A;  1G97 A;  2VS5 A;  5C1G A;  4M28 A;  4R7P A;  4DEC A;  2ICY A;  4HCQ A;  5L6V A;  1ZI4 A;  3ZLL A;  2WGZ A;  3V8Y A;  3F1C A;  4EEM A;  3OH2 A;  1JVG A;  4K6R A;  3OH1 A;  4Y7V A;  1MP3 A;  4G3Q A;  2Y6P A;  1GX0 A;  2Z86 A;  3JTJ A;  5C4B A;  4KC4 A;  1FRW A;  1R7U A;  5EIY A;  5IDS A;  4LW3 A;  5I1F A;  1WSZ A;  3IOH A;  1H7T A;  4NAI A;  2FYA A;  3DJ4 A;  3TQD A;  1ON8 A;  3BCV A;  4HO2 A;  2D7R A;  1ZJ1 A;  2AH9 A;  3SXB A;  2QH5 A;  3O3P A;  5FV9 A;  5JQQ A;  3U2W A;  2VS3 A;  3SXC A;  2RJ9 A;  4Q7C A;  1G23 A;  1FXO A;  2BO8 A;  2YQS A;  4HO6 A;  1GQ9 A;  2YC3 A;  4G3P A;  3U2V A;  1JVD A;  1G3L A;  1FOA A;  3FOQ A;  3IOI A;  3V0O A;  3CKN A;  1VIC A;  2O1G A;  1WVC A;  1LVW A;  1WT1 A;  2JCJ A;  1G95 A;  1R80 A;  2GGO A;  1WT0 A;  2ZU9 A;  5EJZ A;  2ZU7 A;  2FYD B;  4B4G A;  1G1L A;  1G2V A;  2I7B A;  2OEF A;  5DDT A;  3CKQ A;  3IOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...