3V8ZA

Structure of apo-glycogenin truncated at residue 270 complexed with udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
256
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRTHPQFLNVWWDIFTTSVVPLLQQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Structural and biochemical insight into glycogenin inactivation by the glycogenosis-causing T82M mutation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 87
structure length 256
sequence length 264
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v8zA00
3Q80A 1H7TA 2CU2A 4B3UA 5CMFX 4EEGA 2X60A 2BO7A 3ZLLA 2RJ8A 4CVHA 4JD0A 3USQA 1W55A 1H5TA 4FRHA 2FYAA 2ZU9A 4Y7TA 4C2SA 2PX7A 3V0OA 1FGXA 3CKVA 2FFUA 2WVMA 3POLA 4IRQA 4MYBA 4ZDQA 5CMGX 2Q4JA 1W57A 2VFZA 2YQSA 2Z87A 1S4PA 1PZTA 3CKJA 3V0LA 4G3PA 1OQMB 4IRPA 1H7QA 1ZCTA 1LL3A 2GGOA 2Y4LA 3D98A 2APCA 3E25A 4HG6A 5FYEA 1HJLA 1XHBA 2WE9A 3I0GA 2I5EA 2PA4A 1FO9A 1LZ0A 2RIYA 3U2VA 1OMXA 3I0JA 3ZLKA 3U0YA 1I52A 2AE7A 1O7QA 1FOAA 2O1FA 3SX8A 3LW6A 2NXVA 5C36A 1O23B 2YQHA 1QWJA 5AJOA 1VH1A 1VZUA 1H7HA 3CKQA 4L41C 1NF5B 1R7TA 3RMWA 4FRQA 4B2XA 2JCKA 2FYBA 2FYDB 2OEGA 1XZ6A 2ZU8A 5FUHA 1H5SA 1EZIA 4YS8A 3OAMA 1MC3A 4EE3A 2FYCB 5EJ1A 3I0HA 4Y6UA 3SXAA 4ASYA 2ICXA 4KXOA 1JYKA 1VGZA 1H4EA 4XWIA 2Y7AA 1H5TB 2Z86A 3U2TA 3V8ZA 4Y64A 3Q4SA 2WVLA 2UX8A 2I7BA 3IOHA 2V0JA 5CQPA 2YCMA 2YQCA 4R7PA 1FR9A 3PNNA 4KNRA 2D0JA 5C48A 1WVCA 4FROA 4HO5A 2V0LA 1G2VA 1ZI3A 3V0QA 4P00A 1FZWA 4B4GA 1YP4A 4B4BA 4J18A 1HV9A 4KQLA 1IIMA 2WVKA 3K8EA 1NHEB 1H7LA 4KPXA 2AM3A 3SPTA 3DK5A 5CQOA 5CQMX 5C1GA 4AAWA 5C4EA 3N9WA 2VS5A 1ZJ0A 4EE4A 1ZI4A 1ZJOA 2AECA 3USRA 2O1HA 5IDTA 2AGDA 3CGXA 3EE5A 2XWLA 4ECMA 2RJ7A 4FRBA 2YC3A 2W0WA 3V8YA 3OH4A 1ZI1A 1FRWA 5CMJA 1S4OA 1INIA 1Z90A 4G3QA 5C4DA 4NALA 4CJBA 3RMVA 4FRAA 4M28A 1G95A 4NANA 5C8RA 2AESA 4KC2A 1ZJ2A 2V0IA 2D7RA 3D5NA 4EEAA 1H7FA 1H3MA 4NAKA 3T7MA 1NWGB 2D7IA 5IFYA 3I0LA 5C47A 1FR8A 3Q7UA 2AH9A 3R2WA 5IDSA 3KIAA 3F1YA 4HO8A 5FTVA 2QH5A 4CJ8A 5C38A 2YQJA 3CKNA 4D11C 1WSZA 1HM0A 1QGSA 3OH3A 2OI6A 1TW5A 2WAWA 1O7OA 4Y7GA 3K8DA 3SX3A 1G97A 1FG5N 1HM9A 5C4FA 1VGWA 2P72A 4E1KA 2RJ0A 1ZDGA 5L6SA 1INJA 3FWWA 5AJNA 4KRVA 1FWYA 1VM8A 1VPAA 2FY7A 1R81A 3OH1A 5CQNX 3BRKX 4HOCA 3GUEA 4BMAA 1SS9A 3T7OA 3ZGGA 1G8OA 2VSIA 3TQDA 3I0EA 2XMHA 2VS3A 4Y9XA 1WT3A 1YROB 2A8UA 1GQ9A 2X5SA 3V0NA 1JVGA 1R80A 1R7XA 3U2WA 3OKRA 1NKHB 3ST8A 1JV1A 3U2UA 2JCOA 1VZTA 3SX7A 1FGGA 1G23A 2PGVA 1WT0A 2E3DA 4DECA 2AM4A 3SXCA 1O0RA 1H5SD 4FREA 2XMEA 2YESA 2RJ5A 4GBPA 2YC5A 4K6RA 4EVWA 3OC9A 5C3BA 2V0KA 4UEGA 3V0MA 4HCQA 2VD4A 5C3AA 4FRMA 4B5BA 3SXBA 1H7EA 1G0RA 4HO9A 1ZCUA 3JTJA 3CU0A 4Y7UA 1ZCYA 1GX0A 2RIZA 1JYLA 3T7NA 3E26A 2OI5A 1ZHJA 5DDVA 5CMHA 5EIYA 5L6VA 3V91A 1WT1A 5FU8A 4Y7VA 2BO8A 5DDTA 1GX4A 3HL3A 1K4VA 2ICYA 3BCVA 1VGUA 3DUVA 2RJ4A 4B42A 4M4KA 2BO6A 2W0VA 3JUKA 5EJZA 2XWNA 3I0FA 1H4CA 1LL0A 1GWVA 3I0KA 5J49A 4KT7A 1VZXA 2Y6PA 1MP5A 2V0HA 3DJ4A 1G93A 2QKXA 2RJ1A 3SX5A 4FQWA 1H5SB 1HM8A 4KPZA 2RIXA 3D8VA 1G9RA 3V90A 3PKPA 1TZFA 1HJJA 4B2WA 2Y4MA 4FRPA 1S4NA 3V0PA 1H5RA 2MZBA 2WGZA 2X65A 1ZJ3A 4D0TA 1LVWA 4BQHA 2OI7A 1MP3A 2JCLA 4EEOA 1FO8A 3SXDA 2JCJA 1OMZA 2P73A 4Y6NA 4HO2A 5HS2A 1QGQA 2E8BA 4D48A 2A8WA 1GWWA 1R7VA 1NMMB 1V84A 4G87A 1ZCVA 3JUJA 2VXLA 1ZJ1A 2RJ6A 4HO3A 4AYJA 4EEMA 2FFVA 4LW6A 2OEFA 3SXGA 3IOIA 4FRDA 5C4CA 4ASJA 5C4BA 1R7YA 4KNXA 3CKOA 4LW3A 4G3SA 2Y4JA 2XWMA 1G3LA 1E5KA 5CMIA 1W77A 3RSBA 1TVYA 1NQIB 1V82A 1WT2A 2Y4KA 3ZF8A 1V83A 4KC1A 5BXCA 5CQLX 5FV9A 4P02A 1H7GA 4DDZA 1ON8A 3SXEA 1GQCA 1JVDA 4DE7A 1FXOA 1IINA 4Y7FA 2O1GA 2RITA 1FXJA 1PZYB 2VSHA 4HO6A 1ON6A 3FOQA 3OH2A 3I0CA 4FCUA 2PGYA 4CJCA 2RJ9A 2BO4A 5C1LA 3NGWA 3QVBA 3OH0A 1VICA 1LL2A 1YP2A 1LZIA 1R82A 1JV3A 3U0XA 2AM5A 4NAIA 1H5RB 1LZJA 1VGTA 4M2AA 4D11A 1LZ7A 2VXMA 4Y63A 1ZJPA 1QG8A 4D0ZA 1MP4A 5FTSA 5FU0A 4B4MA 1G1LA 4M2BA 1ZI5A 4KC4A 1ZIZA 4AYLA 2P6WA 3ZGFA 3I0DA 4HO4A 3O3PA 4EE5A 1H4DA 4Y62A 4FRLA 1R7UA 4AC3A 2DPWA 4JISA 1KWSA 1EYRA 3R3IA 3F1CA 4HO0A 4MNDA 5JQQA 2GGQA 5C1HA 2VS4A 5C3DA 3PKQA 3I0IX 3TZTA 5C49A 4ARWA 2ZU7A 1YP3A 1TW1A 3OGZA 1ZDFA 5I1FA 2QGIA 1VH3A 3IOJA 1GA8A 2WEEA 2I5KA 5AJPA 3U2XA 1H5SC 2X5ZA 4FCEA
chains in the Genus database with same CATH superfamily
3Q80A 1H7TA 2CU2A 4B3UA 5CMFX 4EEGA 2X60A 2BO7A 3ZLLA 2RJ8A 4CVHA 4JD0A 3USQA 1W55A 1H5TA 4FRHA 2FYAA 2ZU9A 4Y7TA 4C2SA 2PX7A 3V0OA 1FGXA 3CKVA 2FFUA 2WVMA 3POLA 4IRQA 4MYBA 4ZDQA 5CMGX 2Q4JA 1W57A 2VFZA 2YQSA 2Z87A 1S4PA 1PZTA 3CKJA 3V0LA 4G3PA 1OQMB 4IRPA 4FIXA 1H7QA 1ZCTA 1LL3A 2GGOA 2Y4LA 3D98A 2APCA 3E25A 4HG6A 5FYEA 1HJLA 1XHBA 2WE9A 3I0GA 2I5EA 2PA4A 1FO9A 1LZ0A 2RIYA 3U2VA 1OMXA 3I0JA 3ZLKA 3U0YA 1I52A 2AE7A 1O7QA 1FOAA 2O1FA 3SX8A 3LW6A 2NXVA 5C36A 1O23B 2YQHA 4O6NA 1QWJA 5AJOA 1VH1A 1VZUA 1H7HA 3CKQA 4L41C 1NF5B 1R7TA 3RMWA 4FRQA 4B2XA 2JCKA 2FYBA 2FYDB 2OEGA 1XZ6A 2ZU8A 5FUHA 1H5SA 1EZIA 4YS8A 3OAMA 1MC3A 4EE3A 2FYCB 5EJ1A 3I0HA 4Y6UA 3SXAA 4ASYA 2ICXA 4KXOA 1JYKA 1VGZA 4FIYA 1H4EA 4XWIA 2Y7AA 1H5TB 2Z86A 3U2TA 3V8ZA 4Y64A 3Q4SA 2WVLA 2UX8A 4Q7CA 2I7BA 3IOHA 2V0JA 5CQPA 2YCMA 2YQCA 4R7PA 1FR9A 3PNNA 4KNRA 2D0JA 5C48A 1WVCA 4FROA 4HO5A 2V0LA 1G2VA 1ZI3A 3V0QA 4P00A 1FZWA 4B4GA 1YP4A 4B4BA 4J18A 1HV9A 4KQLA 1IIMA 2WVKA 3K8EA 1NHEB 1H7LA 4KPXA 2AM3A 3SPTA 3DK5A 5CQOA 5CQMX 5C1GA 4AAWA 5C4EA 3N9WA 2VS5A 1ZJ0A 4EE4A 1ZI4A 1ZJOA 2AECA 3USRA 2O1HA 5IDTA 2AGDA 3CGXA 3EE5A 2XWLA 4ECMA 2RJ7A 4FRBA 2YC3A 2W0WA 3V8YA 3OH4A 1ZI1A 1FRWA 5CMJA 1S4OA 1INIA 1Z90A 4G3QA 5C4DA 4NALA 4CJBA 3RMVA 4FRAA 4M28A 1G95A 4NANA 5C8RA 2AESA 4KC2A 1ZJ2A 5D91A 2V0IA 2D7RA 3D5NA 4EEAA 1H7FA 1H3MA 4NAKA 3T7MA 1NWGB 2D7IA 5IFYA 3I0LA 5C47A 1FR8A 3Q7UA 2AH9A 3R2WA 5IDSA 3KIAA 3F1YA 4HO8A 5FTVA 2QH5A 4CJ8A 5C38A 2YQJA 3CKNA 4D11C 1WSZA 1HM0A 1QGSA 3OH3A 2OI6A 1TW5A 2WAWA 1O7OA 4Y7GA 3K8DA 3SX3A 1G97A 1FG5N 1HM9A 5C4FA 1VGWA 2P72A 2VK9A 4E1KA 2RJ0A 1ZDGA 5L6SA 1INJA 3FWWA 5AJNA 4KRVA 1FWYA 1VM8A 1VPAA 2FY7A 1R81A 3OH1A 5CQNX 3BRKX 4HOCA 3GUEA 4BMAA 1SS9A 3T7OA 3ZGGA 1G8OA 2VSIA 3TQDA 3I0EA 2XMHA 2VS3A 4Y9XA 1WT3A 1YROB 2A8UA 1GQ9A 2X5SA 3V0NA 1JVGA 1R80A 1R7XA 3U2WA 3OKRA 1NKHB 3ST8A 1JV1A 3U2UA 2JCOA 1VZTA 3SX7A 1FGGA 1G23A 2PGVA 1WT0A 2E3DA 4DECA 2AM4A 3SXCA 1O0RA 1H5SD 4FREA 2XMEA 2YESA 2RJ5A 4GBPA 2YC5A 4K6RA 4EVWA 3OC9A 5C3BA 2V0KA 4UEGA 3V0MA 4HCQA 2VD4A 5C3AA 4FRMA 4B5BA 4MIXA 3SXBA 1H7EA 1G0RA 4HO9A 1ZCUA 3JTJA 3CU0A 4Y7UA 1ZCYA 1GX0A 2RIZA 1JYLA 3T7NA 3E26A 2OI5A 1ZHJA 5DDVA 5CMHA 5D92A 5EIYA 5L6VA 3V91A 1WT1A 5FU8A 4Y7VA 2BO8A 5DDTA 1GX4A 3HL3A 1K4VA 2ICYA 3BCVA 1VGUA 3DUVA 2RJ4A 4B42A 4M4KA 2BO6A 2W0VA 3JUKA 5EJZA 2XWNA 3I0FA 1H4CA 1LL0A 1GWVA 3I0KA 5J49A 4KT7A 1VZXA 2Y6PA 1MP5A 2V0HA 3DJ4A 1G93A 2QKXA 2RJ1A 3SX5A 4FQWA 1H5SB 1HM8A 4KPZA 2RIXA 3D8VA 1G9RA 3V90A 3PKPA 1TZFA 1HJJA 4B2WA 2Y4MA 4FRPA 1S4NA 3V0PA 1H5RA 2MZBA 2J0AA 2WGZA 2X65A 1ZJ3A 4D0TA 1LVWA 4BQHA 2OI7A 1MP3A 2JCLA 4EEOA 1FO8A 3SXDA 2JCJA 1OMZA 2P73A 4Y6NA 4HO2A 5HS2A 1QGQA 2E8BA 4D48A 2A8WA 1GWWA 1R7VA 1NMMB 1V84A 4G87A 1ZCVA 3JUJA 2VXLA 1ZJ1A 2RJ6A 4HO3A 4AYJA 4EEMA 2FFVA 4LW6A 2OEFA 3SXGA 3IOIA 4FRDA 5C4CA 4ASJA 5C4BA 1R7YA 4KNXA 3CKOA 4LW3A 4G3SA 2Y4JA 2XWMA 1G3LA 1E5KA 5CMIA 1W77A 3RSBA 1TVYA 2J0BA 1NQIB 1V82A 1WT2A 2Y4KA 3ZF8A 1V83A 4KC1A 5BXCA 5CQLX 5FV9A 4P02A 1H7GA 4DDZA 1ON8A 3SXEA 1GQCA 1JVDA 4DE7A 1FXOA 1IINA 4Y7FA 2O1GA 2RITA 1FXJA 1PZYB 2VSHA 4HO6A 1ON6A 3FOQA 3OH2A 3I0CA 4FCUA 2C0NA 2PGYA 4CJCA 2RJ9A 2BO4A 5C1LA 3NGWA 3QVBA 3OH0A 1VICA 1LL2A 1YP2A 1LZIA 1R82A 1JV3A 3U0XA 2AM5A 4NAIA 1H5RB 1LZJA 1VGTA 4M2AA 4D11A 1LZ7A 2VXMA 4Y63A 1ZJPA 1QG8A 4D0ZA 1MP4A 5FTSA 5FU0A 4B4MA 1G1LA 4M2BA 1ZI5A 4KC4A 1ZIZA 4AYLA 2P6WA 4O6MA 3ZGFA 3I0DA 4HO4A 3O3PA 4EE5A 1H4DA 4Y62A 4FRLA 1R7UA 4AC3A 2DPWA 4JISA 1KWSA 1EYRA 3R3IA 3F1CA 4HO0A 4MNDA 5JQQA 2GGQA 5C1HA 2VS4A 5C3DA 3PKQA 3I0IX 3TZTA 5C49A 4ARWA 2ZU7A 1YP3A 1TW1A 3OGZA 1ZDFA 5I1FA 2QGIA 1VH3A 3IOJA 1GA8A 2WEEA 2I5KA 5AJPA 3U2XA 1H5SC 2X5ZA 4FCEA
chains in the Genus database with same CATH topology
3Q80A 1H7TA 2CU2A 4B3UA 5CMFX 4EEGA 2X60A 2BO7A 3ZLLA 2RJ8A 4CVHA 4JD0A 3USQA 1W55A 1H5TA 4FRHA 2FYAA 2ZU9A 4Y7TA 4C2SA 2PX7A 3V0OA 1FGXA 3CKVA 2FFUA 2WVMA 3POLA 4IRQA 4MYBA 4ZDQA 5CMGX 2Q4JA 1W57A 2VFZA 2YQSA 2Z87A 1S4PA 1PZTA 3CKJA 3V0LA 4G3PA 1OQMB 4IRPA 4FIXA 1H7QA 1ZCTA 1LL3A 2GGOA 2Y4LA 3D98A 2APCA 3E25A 4HG6A 5FYEA 1HJLA 1XHBA 2WE9A 3I0GA 2I5EA 2PA4A 1FO9A 1LZ0A 2RIYA 3U2VA 1OMXA 3I0JA 3ZLKA 3U0YA 1I52A 2AE7A 1O7QA 1FOAA 2O1FA 3SX8A 3LW6A 2NXVA 5C36A 1O23B 2YQHA 4O6NA 1QWJA 5AJOA 1VH1A 1VZUA 1H7HA 3CKQA 4L41C 1NF5B 1R7TA 3RMWA 4FRQA 4B2XA 2JCKA 2FYBA 2FYDB 2OEGA 1XZ6A 2ZU8A 5FUHA 1H5SA 1EZIA 4YS8A 3OAMA 1MC3A 4EE3A 2FYCB 5EJ1A 3I0HA 4Y6UA 3SXAA 4ASYA 2ICXA 4KXOA 1JYKA 1VGZA 4FIYA 1H4EA 4XWIA 2Y7AA 1H5TB 2Z86A 3U2TA 3V8ZA 4Y64A 3Q4SA 2WVLA 2UX8A 4Q7CA 2I7BA 3IOHA 2V0JA 5CQPA 2YCMA 2YQCA 4R7PA 1FR9A 3PNNA 4KNRA 2D0JA 5C48A 1WVCA 4FROA 4HO5A 2V0LA 1G2VA 1ZI3A 3V0QA 4P00A 1FZWA 4B4GA 1YP4A 4B4BA 4J18A 1HV9A 4KQLA 1IIMA 2WVKA 3K8EA 1NHEB 1H7LA 4KPXA 2AM3A 3SPTA 3DK5A 5CQOA 5CQMX 5C1GA 4AAWA 5C4EA 3N9WA 2VS5A 1ZJ0A 4EE4A 1ZI4A 1ZJOA 2AECA 3USRA 2O1HA 5IDTA 2AGDA 3CGXA 3EE5A 2XWLA 4ECMA 2RJ7A 4FRBA 2YC3A 2W0WA 3V8YA 3OH4A 1ZI1A 1FRWA 5CMJA 1S4OA 1INIA 1Z90A 4G3QA 5C4DA 4NALA 4CJBA 3RMVA 4FRAA 4M28A 1G95A 4NANA 5C8RA 2AESA 4KC2A 1ZJ2A 5D91A 2V0IA 2D7RA 3D5NA 4EEAA 1H7FA 1H3MA 4NAKA 3T7MA 1NWGB 2D7IA 5IFYA 3I0LA 5C47A 1FR8A 3Q7UA 2AH9A 3R2WA 5IDSA 3KIAA 3F1YA 4HO8A 5FTVA 2QH5A 4CJ8A 5C38A 2YQJA 3CKNA 4D11C 1WSZA 1HM0A 1QGSA 3OH3A 2OI6A 1TW5A 2WAWA 1O7OA 4Y7GA 3K8DA 3SX3A 1G97A 1FG5N 1HM9A 5C4FA 1VGWA 2P72A 2VK9A 4E1KA 2RJ0A 1ZDGA 5L6SA 1INJA 3FWWA 5AJNA 4KRVA 1FWYA 1VM8A 1VPAA 2FY7A 1R81A 3OH1A 5CQNX 3BRKX 4HOCA 3GUEA 4BMAA 1SS9A 3T7OA 3ZGGA 1G8OA 2VSIA 3TQDA 3I0EA 2XMHA 2VS3A 4Y9XA 1WT3A 1YROB 2A8UA 1GQ9A 2X5SA 3V0NA 1JVGA 1R80A 1R7XA 3U2WA 3OKRA 1NKHB 3ST8A 1JV1A 3U2UA 2JCOA 1VZTA 3SX7A 1FGGA 1G23A 2PGVA 1WT0A 2E3DA 4DECA 2AM4A 3SXCA 1O0RA 1H5SD 4FREA 2XMEA 2YESA 2RJ5A 4GBPA 2YC5A 4K6RA 4EVWA 3OC9A 5C3BA 2V0KA 4UEGA 3V0MA 4HCQA 2VD4A 5C3AA 4FRMA 4B5BA 4MIXA 3SXBA 1H7EA 1G0RA 4HO9A 1ZCUA 3JTJA 3CU0A 4Y7UA 1ZCYA 1GX0A 2RIZA 1JYLA 3T7NA 3E26A 2OI5A 1ZHJA 5DDVA 5CMHA 5D92A 5EIYA 5L6VA 3V91A 1WT1A 5FU8A 4Y7VA 2BO8A 5DDTA 1GX4A 3HL3A 1K4VA 2ICYA 3BCVA 1VGUA 3DUVA 2RJ4A 4B42A 4M4KA 2BO6A 2W0VA 3JUKA 5EJZA 2XWNA 3I0FA 1H4CA 1LL0A 1GWVA 3I0KA 5J49A 4KT7A 1VZXA 2Y6PA 1MP5A 2V0HA 3DJ4A 1G93A 2QKXA 2RJ1A 3SX5A 4FQWA 1H5SB 1HM8A 4KPZA 2RIXA 3D8VA 1G9RA 3V90A 3PKPA 1TZFA 1HJJA 4B2WA 2Y4MA 4FRPA 1S4NA 3V0PA 1H5RA 2MZBA 2J0AA 2WGZA 2X65A 1ZJ3A 4D0TA 1LVWA 4BQHA 2OI7A 1MP3A 2JCLA 4EEOA 1FO8A 3SXDA 2JCJA 1OMZA 2P73A 4Y6NA 4HO2A 5HS2A 1QGQA 2E8BA 4D48A 2A8WA 1GWWA 1R7VA 1NMMB 1V84A 4G87A 1ZCVA 3JUJA 2VXLA 1ZJ1A 2RJ6A 4HO3A 4AYJA 4EEMA 2FFVA 4LW6A 2OEFA 3SXGA 3IOIA 4FRDA 5C4CA 4ASJA 5C4BA 1R7YA 4KNXA 3CKOA 4LW3A 4G3SA 2Y4JA 2XWMA 1G3LA 1E5KA 5CMIA 1W77A 3RSBA 1TVYA 2J0BA 1NQIB 1V82A 1WT2A 2Y4KA 3ZF8A 1V83A 4KC1A 5BXCA 5CQLX 5FV9A 4P02A 1H7GA 4DDZA 1ON8A 3SXEA 1GQCA 1JVDA 4DE7A 1FXOA 1IINA 4Y7FA 2O1GA 2RITA 1FXJA 1PZYB 2VSHA 4HO6A 1ON6A 3FOQA 3OH2A 3I0CA 4FCUA 2C0NA 2PGYA 4CJCA 2RJ9A 2BO4A 5C1LA 3NGWA 3QVBA 3OH0A 1VICA 1LL2A 1YP2A 1LZIA 1R82A 1JV3A 3U0XA 2AM5A 4NAIA 1H5RB 1LZJA 1VGTA 4M2AA 4D11A 1LZ7A 2VXMA 4Y63A 1ZJPA 1QG8A 4D0ZA 1MP4A 5FTSA 5FU0A 4B4MA 1G1LA 4M2BA 1ZI5A 4KC4A 1ZIZA 4AYLA 2P6WA 4O6MA 3ZGFA 3I0DA 4HO4A 3O3PA 4EE5A 1H4DA 4Y62A 4FRLA 1R7UA 4AC3A 2DPWA 4JISA 1KWSA 1EYRA 3R3IA 3F1CA 4HO0A 4MNDA 5JQQA 2GGQA 5C1HA 2VS4A 5C3DA 3PKQA 3I0IX 3TZTA 5C49A 4ARWA 2ZU7A 1YP3A 1TW1A 3OGZA 1ZDFA 5I1FA 2QGIA 1VH3A 3IOJA 1GA8A 2WEEA 2I5KA 5AJPA 3U2XA 1H5SC 2X5ZA 4FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q80 A;  1H7T A;  2CU2 A;  4B3U A;  5CMF X;  4EEG A;  2X60 A;  2BO7 A;  3ZLL A;  2RJ8 A;  4CVH A;  4JD0 A;  3USQ A;  1W55 A;  1H5T A;  4FRH A;  2FYA A;  2ZU9 A;  4Y7T A;  4C2S A;  2PX7 A;  3V0O A;  1FGX A;  3CKV A;  2FFU A;  2WVM A;  3POL A;  4IRQ A;  4MYB A;  4ZDQ A;  5CMG X;  2Q4J A;  1W57 A;  2VFZ A;  2YQS A;  2Z87 A;  1S4P A;  1PZT A;  3CKJ A;  3V0L A;  4G3P A;  1OQM B;  4IRP A;  1H7Q A;  1ZCT A;  1LL3 A;  2GGO A;  2Y4L A;  3D98 A;  2APC A;  3E25 A;  4HG6 A;  5FYE A;  1HJL A;  1XHB A;  2WE9 A;  3I0G A;  2I5E A;  2PA4 A;  1FO9 A;  1LZ0 A;  2RIY A;  3U2V A;  1OMX A;  3I0J A;  3ZLK A;  3U0Y A;  1I52 A;  2AE7 A;  1O7Q A;  1FOA A;  2O1F A;  3SX8 A;  3LW6 A;  2NXV A;  5C36 A;  1O23 B;  2YQH A;  1QWJ A;  5AJO A;  1VH1 A;  1VZU A;  1H7H A;  3CKQ A;  4L41 C;  1NF5 B;  1R7T A;  3RMW A;  4FRQ A;  4B2X A;  2JCK A;  2FYB A;  2FYD B;  2OEG A;  1XZ6 A;  2ZU8 A;  5FUH A;  1H5S A;  1EZI A;  4YS8 A;  3OAM A;  1MC3 A;  4EE3 A;  2FYC B;  5EJ1 A;  3I0H A;  4Y6U A;  3SXA A;  4ASY A;  2ICX A;  4KXO A;  1JYK A;  1VGZ A;  1H4E A;  4XWI A;  2Y7A A;  1H5T B;  2Z86 A;  3U2T A;  3V8Z A;  4Y64 A;  3Q4S A;  2WVL A;  2UX8 A;  2I7B A;  3IOH A;  2V0J A;  5CQP A;  2YCM A;  2YQC A;  4R7P A;  1FR9 A;  3PNN A;  4KNR A;  2D0J A;  5C48 A;  1WVC A;  4FRO A;  4HO5 A;  2V0L A;  1G2V A;  1ZI3 A;  3V0Q A;  4P00 A;  1FZW A;  4B4G A;  1YP4 A;  4B4B A;  4J18 A;  1HV9 A;  4KQL A;  1IIM A;  2WVK A;  3K8E A;  1NHE B;  1H7L A;  4KPX A;  2AM3 A;  3SPT A;  3DK5 A;  5CQO A;  5CQM X;  5C1G A;  4AAW A;  5C4E A;  3N9W A;  2VS5 A;  1ZJ0 A;  4EE4 A;  1ZI4 A;  1ZJO A;  2AEC A;  3USR A;  2O1H A;  5IDT A;  2AGD A;  3CGX A;  3EE5 A;  2XWL A;  4ECM A;  2RJ7 A;  4FRB A;  2YC3 A;  2W0W A;  3V8Y A;  3OH4 A;  1ZI1 A;  1FRW A;  5CMJ A;  1S4O A;  1INI A;  1Z90 A;  4G3Q A;  5C4D A;  4NAL A;  4CJB A;  3RMV A;  4FRA A;  4M28 A;  1G95 A;  4NAN A;  5C8R A;  2AES A;  4KC2 A;  1ZJ2 A;  2V0I A;  2D7R A;  3D5N A;  4EEA A;  1H7F A;  1H3M A;  4NAK A;  3T7M A;  1NWG B;  2D7I A;  5IFY A;  3I0L A;  5C47 A;  1FR8 A;  3Q7U A;  2AH9 A;  3R2W A;  5IDS A;  3KIA A;  3F1Y A;  4HO8 A;  5FTV A;  2QH5 A;  4CJ8 A;  5C38 A;  2YQJ A;  3CKN A;  4D11 C;  1WSZ A;  1HM0 A;  1QGS A;  3OH3 A;  2OI6 A;  1TW5 A;  2WAW A;  1O7O A;  4Y7G A;  3K8D A;  3SX3 A;  1G97 A;  1FG5 N;  1HM9 A;  5C4F A;  1VGW A;  2P72 A;  4E1K A;  2RJ0 A;  1ZDG A;  5L6S A;  1INJ A;  3FWW A;  5AJN A;  4KRV A;  1FWY A;  1VM8 A;  1VPA A;  2FY7 A;  1R81 A;  3OH1 A;  5CQN X;  3BRK X;  4HOC A;  3GUE A;  4BMA A;  1SS9 A;  3T7O A;  3ZGG A;  1G8O A;  2VSI A;  3TQD A;  3I0E A;  2XMH A;  2VS3 A;  4Y9X A;  1WT3 A;  1YRO B;  2A8U A;  1GQ9 A;  2X5S A;  3V0N A;  1JVG A;  1R80 A;  1R7X A;  3U2W A;  3OKR A;  1NKH B;  3ST8 A;  1JV1 A;  3U2U A;  2JCO A;  1VZT A;  3SX7 A;  1FGG A;  1G23 A;  2PGV A;  1WT0 A;  2E3D A;  4DEC A;  2AM4 A;  3SXC A;  1O0R A;  1H5S D;  4FRE A;  2XME A;  2YES A;  2RJ5 A;  4GBP A;  2YC5 A;  4K6R A;  4EVW A;  3OC9 A;  5C3B A;  2V0K A;  4UEG A;  3V0M A;  4HCQ A;  2VD4 A;  5C3A A;  4FRM A;  4B5B A;  3SXB A;  1H7E A;  1G0R A;  4HO9 A;  1ZCU A;  3JTJ A;  3CU0 A;  4Y7U A;  1ZCY A;  1GX0 A;  2RIZ A;  1JYL A;  3T7N A;  3E26 A;  2OI5 A;  1ZHJ A;  5DDV A;  5CMH A;  5EIY A;  5L6V A;  3V91 A;  1WT1 A;  5FU8 A;  4Y7V A;  2BO8 A;  5DDT A;  1GX4 A;  3HL3 A;  1K4V A;  2ICY A;  3BCV A;  1VGU A;  3DUV A;  2RJ4 A;  4B42 A;  4M4K A;  2BO6 A;  2W0V A;  3JUK A;  5EJZ A;  2XWN A;  3I0F A;  1H4C A;  1LL0 A;  1GWV A;  3I0K A;  5J49 A;  4KT7 A;  1VZX A;  2Y6P A;  1MP5 A;  2V0H A;  3DJ4 A;  1G93 A;  2QKX A;  2RJ1 A;  3SX5 A;  4FQW A;  1H5S B;  1HM8 A;  4KPZ A;  2RIX A;  3D8V A;  1G9R A;  3V90 A;  3PKP A;  1TZF A;  1HJJ A;  4B2W A;  2Y4M A;  4FRP A;  1S4N A;  3V0P A;  1H5R A;  2MZB A;  2WGZ A;  2X65 A;  1ZJ3 A;  4D0T A;  1LVW A;  4BQH A;  2OI7 A;  1MP3 A;  2JCL A;  4EEO A;  1FO8 A;  3SXD A;  2JCJ A;  1OMZ A;  2P73 A;  4Y6N A;  4HO2 A;  5HS2 A;  1QGQ A;  2E8B A;  4D48 A;  2A8W A;  1GWW A;  1R7V A;  1NMM B;  1V84 A;  4G87 A;  1ZCV A;  3JUJ A;  2VXL A;  1ZJ1 A;  2RJ6 A;  4HO3 A;  4AYJ A;  4EEM A;  2FFV A;  4LW6 A;  2OEF A;  3SXG A;  3IOI A;  4FRD A;  5C4C A;  4ASJ A;  5C4B A;  1R7Y A;  4KNX A;  3CKO A;  4LW3 A;  4G3S A;  2Y4J A;  2XWM A;  1G3L A;  1E5K A;  5CMI A;  1W77 A;  3RSB A;  1TVY A;  1NQI B;  1V82 A;  1WT2 A;  2Y4K A;  3ZF8 A;  1V83 A;  4KC1 A;  5BXC A;  5CQL X;  5FV9 A;  4P02 A;  1H7G A;  4DDZ A;  1ON8 A;  3SXE A;  1GQC A;  1JVD A;  4DE7 A;  1FXO A;  1IIN A;  4Y7F A;  2O1G A;  2RIT A;  1FXJ A;  1PZY B;  2VSH A;  4HO6 A;  1ON6 A;  3FOQ A;  3OH2 A;  3I0C A;  4FCU A;  2PGY A;  4CJC A;  2RJ9 A;  2BO4 A;  5C1L A;  3NGW A;  3QVB A;  3OH0 A;  1VIC A;  1LL2 A;  1YP2 A;  1LZI A;  1R82 A;  1JV3 A;  3U0X A;  2AM5 A;  4NAI A;  1H5R B;  1LZJ A;  1VGT A;  4M2A A;  4D11 A;  1LZ7 A;  2VXM A;  4Y63 A;  1ZJP A;  1QG8 A;  4D0Z A;  1MP4 A;  5FTS A;  5FU0 A;  4B4M A;  1G1L A;  4M2B A;  1ZI5 A;  4KC4 A;  1ZIZ A;  4AYL A;  2P6W A;  3ZGF A;  3I0D A;  4HO4 A;  3O3P A;  4EE5 A;  1H4D A;  4Y62 A;  4FRL A;  1R7U A;  4AC3 A;  2DPW A;  4JIS A;  1KWS A;  1EYR A;  3R3I A;  3F1C A;  4HO0 A;  4MND A;  5JQQ A;  2GGQ A;  5C1H A;  2VS4 A;  5C3D A;  3PKQ A;  3I0I X;  3TZT A;  5C49 A;  4ARW A;  2ZU7 A;  1YP3 A;  1TW1 A;  3OGZ A;  1ZDF A;  5I1F A;  2QGI A;  1VH3 A;  3IOJ A;  1GA8 A;  2WEE A;  2I5K A;  5AJP A;  3U2X A;  1H5S C;  2X5Z A;  4FCE A; 
#chains in the Genus database with same CATH topology
 3Q80 A;  1H7T A;  2CU2 A;  4B3U A;  5CMF X;  4EEG A;  2X60 A;  2BO7 A;  3ZLL A;  2RJ8 A;  4CVH A;  4JD0 A;  3USQ A;  1W55 A;  1H5T A;  4FRH A;  2FYA A;  2ZU9 A;  4Y7T A;  4C2S A;  2PX7 A;  3V0O A;  1FGX A;  3CKV A;  2FFU A;  2WVM A;  3POL A;  4IRQ A;  4MYB A;  4ZDQ A;  5CMG X;  2Q4J A;  1W57 A;  2VFZ A;  2YQS A;  2Z87 A;  1S4P A;  1PZT A;  3CKJ A;  3V0L A;  4G3P A;  1OQM B;  4IRP A;  4FIX A;  1H7Q A;  1ZCT A;  1LL3 A;  2GGO A;  2Y4L A;  3D98 A;  2APC A;  3E25 A;  4HG6 A;  5FYE A;  1HJL A;  1XHB A;  2WE9 A;  3I0G A;  2I5E A;  2PA4 A;  1FO9 A;  1LZ0 A;  2RIY A;  3U2V A;  1OMX A;  3I0J A;  3ZLK A;  3U0Y A;  1I52 A;  2AE7 A;  1O7Q A;  1FOA A;  2O1F A;  3SX8 A;  3LW6 A;  2NXV A;  5C36 A;  1O23 B;  2YQH A;  4O6N A;  1QWJ A;  5AJO A;  1VH1 A;  1VZU A;  1H7H A;  3CKQ A;  4L41 C;  1NF5 B;  1R7T A;  3RMW A;  4FRQ A;  4B2X A;  2JCK A;  2FYB A;  2FYD B;  2OEG A;  1XZ6 A;  2ZU8 A;  5FUH A;  1H5S A;  1EZI A;  4YS8 A;  3OAM A;  1MC3 A;  4EE3 A;  2FYC B;  5EJ1 A;  3I0H A;  4Y6U A;  3SXA A;  4ASY A;  2ICX A;  4KXO A;  1JYK A;  1VGZ A;  4FIY A;  1H4E A;  4XWI A;  2Y7A A;  1H5T B;  2Z86 A;  3U2T A;  3V8Z A;  4Y64 A;  3Q4S A;  2WVL A;  2UX8 A;  4Q7C A;  2I7B A;  3IOH A;  2V0J A;  5CQP A;  2YCM A;  2YQC A;  4R7P A;  1FR9 A;  3PNN A;  4KNR A;  2D0J A;  5C48 A;  1WVC A;  4FRO A;  4HO5 A;  2V0L A;  1G2V A;  1ZI3 A;  3V0Q A;  4P00 A;  1FZW A;  4B4G A;  1YP4 A;  4B4B A;  4J18 A;  1HV9 A;  4KQL A;  1IIM A;  2WVK A;  3K8E A;  1NHE B;  1H7L A;  4KPX A;  2AM3 A;  3SPT A;  3DK5 A;  5CQO A;  5CQM X;  5C1G A;  4AAW A;  5C4E A;  3N9W A;  2VS5 A;  1ZJ0 A;  4EE4 A;  1ZI4 A;  1ZJO A;  2AEC A;  3USR A;  2O1H A;  5IDT A;  2AGD A;  3CGX A;  3EE5 A;  2XWL A;  4ECM A;  2RJ7 A;  4FRB A;  2YC3 A;  2W0W A;  3V8Y A;  3OH4 A;  1ZI1 A;  1FRW A;  5CMJ A;  1S4O A;  1INI A;  1Z90 A;  4G3Q A;  5C4D A;  4NAL A;  4CJB A;  3RMV A;  4FRA A;  4M28 A;  1G95 A;  4NAN A;  5C8R A;  2AES A;  4KC2 A;  1ZJ2 A;  5D91 A;  2V0I A;  2D7R A;  3D5N A;  4EEA A;  1H7F A;  1H3M A;  4NAK A;  3T7M A;  1NWG B;  2D7I A;  5IFY A;  3I0L A;  5C47 A;  1FR8 A;  3Q7U A;  2AH9 A;  3R2W A;  5IDS A;  3KIA A;  3F1Y A;  4HO8 A;  5FTV A;  2QH5 A;  4CJ8 A;  5C38 A;  2YQJ A;  3CKN A;  4D11 C;  1WSZ A;  1HM0 A;  1QGS A;  3OH3 A;  2OI6 A;  1TW5 A;  2WAW A;  1O7O A;  4Y7G A;  3K8D A;  3SX3 A;  1G97 A;  1FG5 N;  1HM9 A;  5C4F A;  1VGW A;  2P72 A;  2VK9 A;  4E1K A;  2RJ0 A;  1ZDG A;  5L6S A;  1INJ A;  3FWW A;  5AJN A;  4KRV A;  1FWY A;  1VM8 A;  1VPA A;  2FY7 A;  1R81 A;  3OH1 A;  5CQN X;  3BRK X;  4HOC A;  3GUE A;  4BMA A;  1SS9 A;  3T7O A;  3ZGG A;  1G8O A;  2VSI A;  3TQD A;  3I0E A;  2XMH A;  2VS3 A;  4Y9X A;  1WT3 A;  1YRO B;  2A8U A;  1GQ9 A;  2X5S A;  3V0N A;  1JVG A;  1R80 A;  1R7X A;  3U2W A;  3OKR A;  1NKH B;  3ST8 A;  1JV1 A;  3U2U A;  2JCO A;  1VZT A;  3SX7 A;  1FGG A;  1G23 A;  2PGV A;  1WT0 A;  2E3D A;  4DEC A;  2AM4 A;  3SXC A;  1O0R A;  1H5S D;  4FRE A;  2XME A;  2YES A;  2RJ5 A;  4GBP A;  2YC5 A;  4K6R A;  4EVW A;  3OC9 A;  5C3B A;  2V0K A;  4UEG A;  3V0M A;  4HCQ A;  2VD4 A;  5C3A A;  4FRM A;  4B5B A;  4MIX A;  3SXB A;  1H7E A;  1G0R A;  4HO9 A;  1ZCU A;  3JTJ A;  3CU0 A;  4Y7U A;  1ZCY A;  1GX0 A;  2RIZ A;  1JYL A;  3T7N A;  3E26 A;  2OI5 A;  1ZHJ A;  5DDV A;  5CMH A;  5D92 A;  5EIY A;  5L6V A;  3V91 A;  1WT1 A;  5FU8 A;  4Y7V A;  2BO8 A;  5DDT A;  1GX4 A;  3HL3 A;  1K4V A;  2ICY A;  3BCV A;  1VGU A;  3DUV A;  2RJ4 A;  4B42 A;  4M4K A;  2BO6 A;  2W0V A;  3JUK A;  5EJZ A;  2XWN A;  3I0F A;  1H4C A;  1LL0 A;  1GWV A;  3I0K A;  5J49 A;  4KT7 A;  1VZX A;  2Y6P A;  1MP5 A;  2V0H A;  3DJ4 A;  1G93 A;  2QKX A;  2RJ1 A;  3SX5 A;  4FQW A;  1H5S B;  1HM8 A;  4KPZ A;  2RIX A;  3D8V A;  1G9R A;  3V90 A;  3PKP A;  1TZF A;  1HJJ A;  4B2W A;  2Y4M A;  4FRP A;  1S4N A;  3V0P A;  1H5R A;  2MZB A;  2J0A A;  2WGZ A;  2X65 A;  1ZJ3 A;  4D0T A;  1LVW A;  4BQH A;  2OI7 A;  1MP3 A;  2JCL A;  4EEO A;  1FO8 A;  3SXD A;  2JCJ A;  1OMZ A;  2P73 A;  4Y6N A;  4HO2 A;  5HS2 A;  1QGQ A;  2E8B A;  4D48 A;  2A8W A;  1GWW A;  1R7V A;  1NMM B;  1V84 A;  4G87 A;  1ZCV A;  3JUJ A;  2VXL A;  1ZJ1 A;  2RJ6 A;  4HO3 A;  4AYJ A;  4EEM A;  2FFV A;  4LW6 A;  2OEF A;  3SXG A;  3IOI A;  4FRD A;  5C4C A;  4ASJ A;  5C4B A;  1R7Y A;  4KNX A;  3CKO A;  4LW3 A;  4G3S A;  2Y4J A;  2XWM A;  1G3L A;  1E5K A;  5CMI A;  1W77 A;  3RSB A;  1TVY A;  2J0B A;  1NQI B;  1V82 A;  1WT2 A;  2Y4K A;  3ZF8 A;  1V83 A;  4KC1 A;  5BXC A;  5CQL X;  5FV9 A;  4P02 A;  1H7G A;  4DDZ A;  1ON8 A;  3SXE A;  1GQC A;  1JVD A;  4DE7 A;  1FXO A;  1IIN A;  4Y7F A;  2O1G A;  2RIT A;  1FXJ A;  1PZY B;  2VSH A;  4HO6 A;  1ON6 A;  3FOQ A;  3OH2 A;  3I0C A;  4FCU A;  2C0N A;  2PGY A;  4CJC A;  2RJ9 A;  2BO4 A;  5C1L A;  3NGW A;  3QVB A;  3OH0 A;  1VIC A;  1LL2 A;  1YP2 A;  1LZI A;  1R82 A;  1JV3 A;  3U0X A;  2AM5 A;  4NAI A;  1H5R B;  1LZJ A;  1VGT A;  4M2A A;  4D11 A;  1LZ7 A;  2VXM A;  4Y63 A;  1ZJP A;  1QG8 A;  4D0Z A;  1MP4 A;  5FTS A;  5FU0 A;  4B4M A;  1G1L A;  4M2B A;  1ZI5 A;  4KC4 A;  1ZIZ A;  4AYL A;  2P6W A;  4O6M A;  3ZGF A;  3I0D A;  4HO4 A;  3O3P A;  4EE5 A;  1H4D A;  4Y62 A;  4FRL A;  1R7U A;  4AC3 A;  2DPW A;  4JIS A;  1KWS A;  1EYR A;  3R3I A;  3F1C A;  4HO0 A;  4MND A;  5JQQ A;  2GGQ A;  5C1H A;  2VS4 A;  5C3D A;  3PKQ A;  3I0I X;  3TZT A;  5C49 A;  4ARW A;  2ZU7 A;  1YP3 A;  1TW1 A;  3OGZ A;  1ZDF A;  5I1F A;  2QGI A;  1VH3 A;  3IOJ A;  1GA8 A;  2WEE A;  2I5K A;  5AJP A;  3U2X A;  1H5S C;  2X5Z A;  4FCE A; 
#chains in the Genus database with same CATH homology
 3Q80 A;  1H7T A;  2CU2 A;  4B3U A;  5CMF X;  4EEG A;  2X60 A;  2BO7 A;  3ZLL A;  2RJ8 A;  4CVH A;  4JD0 A;  3USQ A;  1W55 A;  1H5T A;  4FRH A;  2FYA A;  2ZU9 A;  4Y7T A;  4C2S A;  2PX7 A;  3V0O A;  1FGX A;  3CKV A;  2FFU A;  2WVM A;  3POL A;  4IRQ A;  4MYB A;  4ZDQ A;  5CMG X;  2Q4J A;  1W57 A;  2VFZ A;  2YQS A;  2Z87 A;  1S4P A;  1PZT A;  3CKJ A;  3V0L A;  4G3P A;  1OQM B;  4IRP A;  4FIX A;  1H7Q A;  1ZCT A;  1LL3 A;  2GGO A;  2Y4L A;  3D98 A;  2APC A;  3E25 A;  4HG6 A;  5FYE A;  1HJL A;  1XHB A;  2WE9 A;  3I0G A;  2I5E A;  2PA4 A;  1FO9 A;  1LZ0 A;  2RIY A;  3U2V A;  1OMX A;  3I0J A;  3ZLK A;  3U0Y A;  1I52 A;  2AE7 A;  1O7Q A;  1FOA A;  2O1F A;  3SX8 A;  3LW6 A;  2NXV A;  5C36 A;  1O23 B;  2YQH A;  4O6N A;  1QWJ A;  5AJO A;  1VH1 A;  1VZU A;  1H7H A;  3CKQ A;  4L41 C;  1NF5 B;  1R7T A;  3RMW A;  4FRQ A;  4B2X A;  2JCK A;  2FYB A;  2FYD B;  2OEG A;  1XZ6 A;  2ZU8 A;  5FUH A;  1H5S A;  1EZI A;  4YS8 A;  3OAM A;  1MC3 A;  4EE3 A;  2FYC B;  5EJ1 A;  3I0H A;  4Y6U A;  3SXA A;  4ASY A;  2ICX A;  4KXO A;  1JYK A;  1VGZ A;  4FIY A;  1H4E A;  4XWI A;  2Y7A A;  1H5T B;  2Z86 A;  3U2T A;  3V8Z A;  4Y64 A;  3Q4S A;  2WVL A;  2UX8 A;  4Q7C A;  2I7B A;  3IOH A;  2V0J A;  5CQP A;  2YCM A;  2YQC A;  4R7P A;  1FR9 A;  3PNN A;  4KNR A;  2D0J A;  5C48 A;  1WVC A;  4FRO A;  4HO5 A;  2V0L A;  1G2V A;  1ZI3 A;  3V0Q A;  4P00 A;  1FZW A;  4B4G A;  1YP4 A;  4B4B A;  4J18 A;  1HV9 A;  4KQL A;  1IIM A;  2WVK A;  3K8E A;  1NHE B;  1H7L A;  4KPX A;  2AM3 A;  3SPT A;  3DK5 A;  5CQO A;  5CQM X;  5C1G A;  4AAW A;  5C4E A;  3N9W A;  2VS5 A;  1ZJ0 A;  4EE4 A;  1ZI4 A;  1ZJO A;  2AEC A;  3USR A;  2O1H A;  5IDT A;  2AGD A;  3CGX A;  3EE5 A;  2XWL A;  4ECM A;  2RJ7 A;  4FRB A;  2YC3 A;  2W0W A;  3V8Y A;  3OH4 A;  1ZI1 A;  1FRW A;  5CMJ A;  1S4O A;  1INI A;  1Z90 A;  4G3Q A;  5C4D A;  4NAL A;  4CJB A;  3RMV A;  4FRA A;  4M28 A;  1G95 A;  4NAN A;  5C8R A;  2AES A;  4KC2 A;  1ZJ2 A;  5D91 A;  2V0I A;  2D7R A;  3D5N A;  4EEA A;  1H7F A;  1H3M A;  4NAK A;  3T7M A;  1NWG B;  2D7I A;  5IFY A;  3I0L A;  5C47 A;  1FR8 A;  3Q7U A;  2AH9 A;  3R2W A;  5IDS A;  3KIA A;  3F1Y A;  4HO8 A;  5FTV A;  2QH5 A;  4CJ8 A;  5C38 A;  2YQJ A;  3CKN A;  4D11 C;  1WSZ A;  1HM0 A;  1QGS A;  3OH3 A;  2OI6 A;  1TW5 A;  2WAW A;  1O7O A;  4Y7G A;  3K8D A;  3SX3 A;  1G97 A;  1FG5 N;  1HM9 A;  5C4F A;  1VGW A;  2P72 A;  2VK9 A;  4E1K A;  2RJ0 A;  1ZDG A;  5L6S A;  1INJ A;  3FWW A;  5AJN A;  4KRV A;  1FWY A;  1VM8 A;  1VPA A;  2FY7 A;  1R81 A;  3OH1 A;  5CQN X;  3BRK X;  4HOC A;  3GUE A;  4BMA A;  1SS9 A;  3T7O A;  3ZGG A;  1G8O A;  2VSI A;  3TQD A;  3I0E A;  2XMH A;  2VS3 A;  4Y9X A;  1WT3 A;  1YRO B;  2A8U A;  1GQ9 A;  2X5S A;  3V0N A;  1JVG A;  1R80 A;  1R7X A;  3U2W A;  3OKR A;  1NKH B;  3ST8 A;  1JV1 A;  3U2U A;  2JCO A;  1VZT A;  3SX7 A;  1FGG A;  1G23 A;  2PGV A;  1WT0 A;  2E3D A;  4DEC A;  2AM4 A;  3SXC A;  1O0R A;  1H5S D;  4FRE A;  2XME A;  2YES A;  2RJ5 A;  4GBP A;  2YC5 A;  4K6R A;  4EVW A;  3OC9 A;  5C3B A;  2V0K A;  4UEG A;  3V0M A;  4HCQ A;  2VD4 A;  5C3A A;  4FRM A;  4B5B A;  4MIX A;  3SXB A;  1H7E A;  1G0R A;  4HO9 A;  1ZCU A;  3JTJ A;  3CU0 A;  4Y7U A;  1ZCY A;  1GX0 A;  2RIZ A;  1JYL A;  3T7N A;  3E26 A;  2OI5 A;  1ZHJ A;  5DDV A;  5CMH A;  5D92 A;  5EIY A;  5L6V A;  3V91 A;  1WT1 A;  5FU8 A;  4Y7V A;  2BO8 A;  5DDT A;  1GX4 A;  3HL3 A;  1K4V A;  2ICY A;  3BCV A;  1VGU A;  3DUV A;  2RJ4 A;  4B42 A;  4M4K A;  2BO6 A;  2W0V A;  3JUK A;  5EJZ A;  2XWN A;  3I0F A;  1H4C A;  1LL0 A;  1GWV A;  3I0K A;  5J49 A;  4KT7 A;  1VZX A;  2Y6P A;  1MP5 A;  2V0H A;  3DJ4 A;  1G93 A;  2QKX A;  2RJ1 A;  3SX5 A;  4FQW A;  1H5S B;  1HM8 A;  4KPZ A;  2RIX A;  3D8V A;  1G9R A;  3V90 A;  3PKP A;  1TZF A;  1HJJ A;  4B2W A;  2Y4M A;  4FRP A;  1S4N A;  3V0P A;  1H5R A;  2MZB A;  2J0A A;  2WGZ A;  2X65 A;  1ZJ3 A;  4D0T A;  1LVW A;  4BQH A;  2OI7 A;  1MP3 A;  2JCL A;  4EEO A;  1FO8 A;  3SXD A;  2JCJ A;  1OMZ A;  2P73 A;  4Y6N A;  4HO2 A;  5HS2 A;  1QGQ A;  2E8B A;  4D48 A;  2A8W A;  1GWW A;  1R7V A;  1NMM B;  1V84 A;  4G87 A;  1ZCV A;  3JUJ A;  2VXL A;  1ZJ1 A;  2RJ6 A;  4HO3 A;  4AYJ A;  4EEM A;  2FFV A;  4LW6 A;  2OEF A;  3SXG A;  3IOI A;  4FRD A;  5C4C A;  4ASJ A;  5C4B A;  1R7Y A;  4KNX A;  3CKO A;  4LW3 A;  4G3S A;  2Y4J A;  2XWM A;  1G3L A;  1E5K A;  5CMI A;  1W77 A;  3RSB A;  1TVY A;  2J0B A;  1NQI B;  1V82 A;  1WT2 A;  2Y4K A;  3ZF8 A;  1V83 A;  4KC1 A;  5BXC A;  5CQL X;  5FV9 A;  4P02 A;  1H7G A;  4DDZ A;  1ON8 A;  3SXE A;  1GQC A;  1JVD A;  4DE7 A;  1FXO A;  1IIN A;  4Y7F A;  2O1G A;  2RIT A;  1FXJ A;  1PZY B;  2VSH A;  4HO6 A;  1ON6 A;  3FOQ A;  3OH2 A;  3I0C A;  4FCU A;  2C0N A;  2PGY A;  4CJC A;  2RJ9 A;  2BO4 A;  5C1L A;  3NGW A;  3QVB A;  3OH0 A;  1VIC A;  1LL2 A;  1YP2 A;  1LZI A;  1R82 A;  1JV3 A;  3U0X A;  2AM5 A;  4NAI A;  1H5R B;  1LZJ A;  1VGT A;  4M2A A;  4D11 A;  1LZ7 A;  2VXM A;  4Y63 A;  1ZJP A;  1QG8 A;  4D0Z A;  1MP4 A;  5FTS A;  5FU0 A;  4B4M A;  1G1L A;  4M2B A;  1ZI5 A;  4KC4 A;  1ZIZ A;  4AYL A;  2P6W A;  4O6M A;  3ZGF A;  3I0D A;  4HO4 A;  3O3P A;  4EE5 A;  1H4D A;  4Y62 A;  4FRL A;  1R7U A;  4AC3 A;  2DPW A;  4JIS A;  1KWS A;  1EYR A;  3R3I A;  3F1C A;  4HO0 A;  4MND A;  5JQQ A;  2GGQ A;  5C1H A;  2VS4 A;  5C3D A;  3PKQ A;  3I0I X;  3TZT A;  5C49 A;  4ARW A;  2ZU7 A;  1YP3 A;  1TW1 A;  3OGZ A;  1ZDF A;  5I1F A;  2QGI A;  1VH3 A;  3IOJ A;  1GA8 A;  2WEE A;  2I5K A;  5AJP A;  3U2X A;  1H5S C;  2X5Z A;  4FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...