3V8ZA

Structure of apo-glycogenin truncated at residue 270 complexed with udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
256
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRTHPQFLNVWWDIFTTSVVPLLQQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Structural and biochemical insight into glycogenin inactivation by the glycogenosis-causing T82M mutation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 87
structure length 256
sequence length 264
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v8zA00
1NHEB 1VGTA 2RJ7A 3SX8A 3D98A 1LZJA 1JV1A 2Y4KA 4Y7TA 5J49A 2BO8A 4R7PA 2RJ9A 3TZTA 1FGGA 4B4GA 1R81A 1QGQA 2X65A 3Q7UA 2P73A 4EE5A 5FTSA 1S4NA 4G87A 2O1HA 2VS4A 3OH2A 4J18A 4FRBA 5EJZA 2OI6A 3O3PA 4KPXA 1G23A 3U0XA 4FRAA 4DE7A 2A8WA 1R80A 1O23B 2OI7A 2FFVA 1ZI4A 5C4CA 4D48A 5FV9A 4LW3A 1LZ7A 5C47A 5L6VA 1NF5B 3USRA 4C2SA 2JCKA 2JCOA 3DK5A 5CMIA 1QWJA 1O7OA 1V84A 2ZU9A 2MZBA 2QGIA 2RJ5A 3V0PA 1NKHB 3V0MA 2W0WA 5CMFX 1FWYA 3ZF8A 2VS5A 5I1FA 3OKRA 4KQLA 4ASJA 2DPWA 3R2WA 2P6WA 1O7QA 2UX8A 1S4PA 1LVWA 2GGQA 5CQMX 2I5EA 3PNNA 5FUHA 4XWIA 4HOCA 4ASYA 4P00A 4FRDA 5C38A 1VZXA 1ZJ0A 3EE5A 2V0HA 2XWNA 2YESA 1FO8A 2X5SA 5C1HA 1FOAA 1ZJOA 2BO4A 2BO6A 2AM5A 3U2VA 1XHBA 2YQJA 1GWWA 3SXGA 2P72A 5C4DA 2D7IA 1FRWA 2Z86A 4M2BA 1QG8A 1H7TA 4JISA 1OMZA 1ZCUA 3V0NA 2BO7A 4HO4A 2I5KA 1MP3A 2Y7AA 2Y6PA 2PA4A 4NAIA 2RJ4A 1G8OA 1H7EA 2XMEA 2AECA 2WGZA 1G93A 5C4FA 3GUEA 1ZIZA 1VICA 5HS2A 1JV3A 1ZI1A 1TVYA 1JVGA 1MP4A 4DECA 3V0QA 4Y64A 3JUKA 4FCUA 2RJ1A 1GX0A 2PGYA 3RSBA 2Z87A 1FXJA 3V91A 5C3AA 3D8VA 5DDVA 3SXAA 3FOQA 2V0JA 3PKQA 1ZDGA 1GQ9A 1FR8A 1YP4A 3ZGFA 1JVDA 4ZDQA 5C8RA 5CMJA 1VGZA 5C3DA 5CQNX 2RIYA 3DUVA 1KWSA 2WE9A 2AE7A 4Y9XA 3I0DA 3ST8A 3OC9A 3CGXA 2Q4JA 3I0IX 3F1CA 3IOJA 4FCEA 1VZTA 5DDTA 4L41C 4KRVA 4HO9A 1S4OA 1ZHJA 1YROB 3CKQA 4UEGA 1EYRA 2FYAA 1NMMB 3SXEA 4CJCA 2I7BA 1ZJ1A 4CVHA 5IDSA 4CJBA 1HV9A 1GX4A 4FREA 5C4EA 4Y6NA 3ZLLA 4D11C 3SXCA 3N9WA 4FQWA 4HO6A 2ICYA 3I0JA 4HG6A 4EEOA 1ZJPA 3V8ZA 4MYBA 2YC3A 4NANA 1H5TB 4Y6UA 4BQHA 1G97A 1H4CA 3CU0A 2RJ0A 3LW6A 4FRLA 4AYJA 1MC3A 4HO2A 1WVCA 5FU8A 5IFYA 1ON8A 1VH3A 3KIAA 1FG5N 3SX3A 3PKPA 1ZJ2A 1WT2A 3OGZA 1G2VA 1H3MA 2Y4JA 1VPAA 3TQDA 2E8BA 2AM3A 2YQHA 3SX5A 1O0RA 2FY7A 1MP5A 1H7HA 3U2UA 5C4BA 1ZI3A 4M28A 1INIA 4NALA 2WVLA 3D5NA 4D11A 2WVMA 2Y4MA 2XWMA 1VZUA 1LZ0A 1OQMB 3U2XA 1PZYB 2JCJA 4LW6A 2V0KA 2CU2A 4KPZA 4NAKA 4FRHA 1K4VA 4FRQA 2FYDB 1IINA 1R7VA 3DJ4A 1ZCVA 2Y4LA 5CQOA 5IDTA 3I0EA 2V0IA 3I0LA 4D0TA 3OH4A 2V0LA 1INJA 2NXVA 3I0HA 1XZ6A 3IOIA 1V82A 2E3DA 4EE4A 2RJ6A 1TZFA 2O1GA 4FROA 4D0ZA 2AH9A 3U0YA 4FRMA 2YQSA 1ZCTA 1H4EA 3I0KA 2PGVA 1G3LA 1WT1A 1H5SD 1WSZA 5EJ1A 3I0CA 4M2AA 1ZCYA 1W77A 3SPTA 4GBPA 2RITA 3ZLKA 2QH5A 1G9RA 2PX7A 3V90A 3K8EA 3T7MA 4YS8A 2QKXA 1YP3A 3BRKX 2YC5A 2WAWA 2VXLA 1PZTA 4IRPA 5EIYA 5BXCA 1FGXA 2ICXA 1H5RB 2XWLA 1HM8A 1NWGB 1H5SC 1LL2A 3CKJA 1W57A 4KC4A 5AJOA 1GWVA 2AESA 2RIZA 3FWWA 3I0FA 5C3BA 3BCVA 1H5RA 1NQIB 3POLA 5CMGX 3OH0A 1TW1A 4EEGA 3SX7A 1JYKA 1I52A 2WEEA 1TW5A 1HJJA 2FFUA 4M4KA 4KT7A 1OMXA 1H7GA 4Y7FA 4KNXA 4DDZA 1LZIA 4ECMA 3ZGGA 4EE3A 1H7LA 1HM9A 4Y7GA 1H5SB 3JTJA 4EEMA 1QGSA 1JYLA 1ZDFA 4G3QA 3T7OA 4B2WA 5C48A 5FYEA 2VFZA 4EVWA 1GQCA 2APCA 2A8UA 2OEFA 5CQLX 5C1LA 4Y7VA 1H5SA 4KC1A 5CMHA 4Y63A 3Q80A 4IRQA 4AAWA 1VGUA 4E1KA 4K6RA 1H5TA 5AJNA 4B3UA 1FR9A 1FO9A 1ZI5A 3HL3A 2AM4A 5C1GA 3SXDA 4FRPA 1FZWA 4G3PA 5FU0A 1ZJ3A 4B4BA 1GA8A 2O1FA 4KXOA 4B2XA 2ZU8A 2D0JA 4Y62A 2VSIA 1VH1A 2AGDA 2FYCB 5FTVA 1H7FA 3I0GA 1WT3A 5CQPA 4Y7UA 3OH1A 1EZIA 2D7RA 4AC3A 2XMHA 2X60A 3QVBA 3USQA 2VXMA 1R7UA 4G3SA 4MNDA 4AYLA 2OEGA 4CJ8A 1HM0A 5C36A 4B5BA 3SXBA 1VGWA 4HO0A 1LL3A 3IOHA 3JUJA 4HO5A 4JD0A 3RMVA 1H7QA 2RIXA 1ON6A 3CKNA 1G95A 1FXOA 1R7XA 2OI5A 3T7NA 3R3IA 2ZU7A 2GGOA 4ARWA 3F1YA 5JQQA 3V0OA 3OH3A 1HJLA 1WT0A 2YCMA 3Q4SA 1R7YA 3RMWA 3NGWA 2W0VA 1VM8A 1H4DA 4KNRA 3U2WA 5AJPA 1R82A 3V8YA 4HO3A 2VSHA 4HCQA 4KC2A 2JCLA 1G0RA 4B42A 4EEAA 2WVKA 3CKOA 3U2TA 4HO8A 1R7TA 3E25A 1LL0A 1Z90A 4BMAA 2RJ8A 3OAMA 2FYBA 3K8DA 1YP2A 2VS3A 1SS9A 3E26A 4P02A 2YQCA 1W55A 1E5KA 5C49A 4B4MA 3CKVA 1G1LA 2X5ZA 3V0LA 5L6SA 1IIMA 1V83A 2VD4A
chains in the Genus database with same CATH superfamily
1NHEB 1VGTA 2RJ7A 3SX8A 4MIXA 3D98A 1LZJA 1JV1A 2Y4KA 4Y7TA 5J49A 2BO8A 4R7PA 2RJ9A 3TZTA 1FGGA 4B4GA 1R81A 1QGQA 2X65A 3Q7UA 2P73A 4EE5A 5FTSA 1S4NA 4G87A 2O1HA 2VS4A 3OH2A 4J18A 4FRBA 5EJZA 2OI6A 3O3PA 4KPXA 1G23A 3U0XA 4FRAA 4DE7A 2A8WA 1R80A 1O23B 2OI7A 2FFVA 1ZI4A 5C4CA 4D48A 5FV9A 4LW3A 1LZ7A 5C47A 5L6VA 1NF5B 3USRA 4C2SA 2JCKA 2JCOA 3DK5A 5CMIA 1QWJA 1O7OA 1V84A 2ZU9A 2MZBA 2QGIA 2RJ5A 3V0PA 1NKHB 3V0MA 2W0WA 5CMFX 1FWYA 3ZF8A 2VS5A 5I1FA 3OKRA 4KQLA 4ASJA 2DPWA 3R2WA 2P6WA 1O7QA 2UX8A 1S4PA 1LVWA 2GGQA 5CQMX 2I5EA 3PNNA 5FUHA 4XWIA 4HOCA 2J0BA 4ASYA 4P00A 4FRDA 5C38A 1VZXA 1ZJ0A 3EE5A 2V0HA 2XWNA 2YESA 1FO8A 2X5SA 5C1HA 1FOAA 1ZJOA 2BO4A 2BO6A 2AM5A 3U2VA 1XHBA 2YQJA 1GWWA 3SXGA 2P72A 5C4DA 2D7IA 1FRWA 2Z86A 4M2BA 1QG8A 1H7TA 4JISA 1OMZA 1ZCUA 3V0NA 2BO7A 4HO4A 2I5KA 1MP3A 2Y7AA 2Y6PA 2PA4A 4NAIA 2RJ4A 1G8OA 1H7EA 2XMEA 2AECA 2WGZA 1G93A 5C4FA 3GUEA 1ZIZA 1VICA 5HS2A 1JV3A 1ZI1A 1TVYA 4O6MA 1JVGA 1MP4A 4DECA 3V0QA 4Y64A 3JUKA 4FCUA 2RJ1A 1GX0A 2PGYA 3RSBA 2Z87A 1FXJA 3V91A 5C3AA 3D8VA 5DDVA 3SXAA 3FOQA 2V0JA 3PKQA 1ZDGA 1GQ9A 1FR8A 1YP4A 3ZGFA 1JVDA 4ZDQA 5C8RA 5CMJA 1VGZA 5C3DA 5CQNX 2RIYA 3DUVA 1KWSA 2WE9A 2AE7A 4Y9XA 3I0DA 3ST8A 3OC9A 3CGXA 2Q4JA 3I0IX 3F1CA 3IOJA 4FCEA 1VZTA 5DDTA 4L41C 4KRVA 4HO9A 1S4OA 1ZHJA 1YROB 3CKQA 4UEGA 1EYRA 2FYAA 1NMMB 3SXEA 4CJCA 2I7BA 1ZJ1A 4CVHA 5IDSA 4CJBA 1HV9A 1GX4A 4FREA 5C4EA 4Y6NA 3ZLLA 4FIYA 4D11C 3SXCA 3N9WA 4FQWA 4HO6A 2ICYA 3I0JA 4HG6A 4EEOA 1ZJPA 3V8ZA 4MYBA 2YC3A 4NANA 1H5TB 4Y6UA 4BQHA 1G97A 1H4CA 3CU0A 2RJ0A 3LW6A 4FRLA 4AYJA 1MC3A 4HO2A 1WVCA 5FU8A 5IFYA 1ON8A 1VH3A 3KIAA 1FG5N 3SX3A 3PKPA 1ZJ2A 2VK9A 1WT2A 3OGZA 1G2VA 1H3MA 2Y4JA 1VPAA 3TQDA 2E8BA 2AM3A 2YQHA 3SX5A 1O0RA 2FY7A 1MP5A 1H7HA 3U2UA 5C4BA 1ZI3A 4M28A 1INIA 4NALA 2WVLA 3D5NA 4D11A 2WVMA 2Y4MA 2XWMA 1VZUA 1LZ0A 1OQMB 3U2XA 1PZYB 2JCJA 4LW6A 2V0KA 2CU2A 4KPZA 4NAKA 4FRHA 1K4VA 4FRQA 2FYDB 1IINA 1R7VA 3DJ4A 1ZCVA 2Y4LA 5CQOA 5D92A 5IDTA 3I0EA 2V0IA 3I0LA 4D0TA 3OH4A 2V0LA 1INJA 2NXVA 3I0HA 1XZ6A 3IOIA 1V82A 2E3DA 4EE4A 2RJ6A 1TZFA 2O1GA 4FROA 4D0ZA 2AH9A 3U0YA 4FRMA 2YQSA 1ZCTA 1H4EA 3I0KA 2PGVA 1G3LA 1WT1A 5D91A 1H5SD 1WSZA 5EJ1A 3I0CA 2C0NA 4M2AA 1ZCYA 1W77A 3SPTA 4GBPA 2RITA 3ZLKA 2QH5A 1G9RA 2PX7A 3V90A 3K8EA 3T7MA 4YS8A 2QKXA 1YP3A 3BRKX 2YC5A 2WAWA 2VXLA 1PZTA 4IRPA 5EIYA 5BXCA 1FGXA 2ICXA 1H5RB 2XWLA 1HM8A 1NWGB 1H5SC 1LL2A 3CKJA 1W57A 4KC4A 5AJOA 1GWVA 2AESA 2RIZA 3FWWA 3I0FA 5C3BA 2J0AA 3BCVA 1H5RA 1NQIB 3POLA 5CMGX 3OH0A 1TW1A 4EEGA 3SX7A 1JYKA 1I52A 2WEEA 1TW5A 1HJJA 2FFUA 4M4KA 4KT7A 1OMXA 1H7GA 4Y7FA 4KNXA 4DDZA 1LZIA 4ECMA 3ZGGA 4EE3A 1H7LA 1HM9A 4Y7GA 1H5SB 3JTJA 4EEMA 1QGSA 1JYLA 1ZDFA 4G3QA 3T7OA 4B2WA 5C48A 5FYEA 2VFZA 4EVWA 1GQCA 2APCA 2A8UA 2OEFA 5CQLX 5C1LA 4Y7VA 1H5SA 4KC1A 5CMHA 4Y63A 3Q80A 4IRQA 4AAWA 1VGUA 4E1KA 4K6RA 1H5TA 5AJNA 4Q7CA 4B3UA 1FR9A 1FO9A 1ZI5A 3HL3A 2AM4A 5C1GA 3SXDA 4FRPA 1FZWA 4G3PA 5FU0A 1ZJ3A 4B4BA 1GA8A 2O1FA 4KXOA 4B2XA 2ZU8A 2D0JA 4Y62A 2VSIA 1VH1A 2AGDA 2FYCB 5FTVA 1H7FA 3I0GA 1WT3A 5CQPA 4Y7UA 3OH1A 1EZIA 2D7RA 4AC3A 2XMHA 2X60A 3QVBA 3USQA 2VXMA 1R7UA 4G3SA 4MNDA 4AYLA 2OEGA 4CJ8A 1HM0A 4O6NA 5C36A 4B5BA 3SXBA 1VGWA 4HO0A 1LL3A 3IOHA 3JUJA 4HO5A 4JD0A 3RMVA 1H7QA 2RIXA 1ON6A 3CKNA 1G95A 1FXOA 1R7XA 2OI5A 3T7NA 3R3IA 2ZU7A 2GGOA 4ARWA 3F1YA 5JQQA 3V0OA 3OH3A 1HJLA 1WT0A 2YCMA 3Q4SA 1R7YA 3RMWA 3NGWA 2W0VA 1VM8A 1H4DA 4KNRA 3U2WA 5AJPA 1R82A 3V8YA 4HO3A 2VSHA 4HCQA 4KC2A 2JCLA 1G0RA 4B42A 4EEAA 2WVKA 3CKOA 3U2TA 4HO8A 1R7TA 3E25A 1LL0A 1Z90A 4BMAA 2RJ8A 3OAMA 2FYBA 3K8DA 1YP2A 2VS3A 1SS9A 3E26A 4P02A 2YQCA 1W55A 1E5KA 5C49A 4B4MA 3CKVA 1G1LA 2X5ZA 4FIXA 3V0LA 5L6SA 1IIMA 1V83A 2VD4A
chains in the Genus database with same CATH topology
1NHEB 1VGTA 2RJ7A 3SX8A 4MIXA 3D98A 1LZJA 1JV1A 2Y4KA 4Y7TA 5J49A 2BO8A 4R7PA 2RJ9A 3TZTA 1FGGA 4B4GA 1R81A 1QGQA 2X65A 3Q7UA 2P73A 4EE5A 5FTSA 1S4NA 4G87A 2O1HA 2VS4A 3OH2A 4J18A 4FRBA 5EJZA 2OI6A 3O3PA 4KPXA 1G23A 3U0XA 4FRAA 4DE7A 2A8WA 1R80A 1O23B 2OI7A 2FFVA 1ZI4A 5C4CA 4D48A 5FV9A 4LW3A 1LZ7A 5C47A 5L6VA 1NF5B 3USRA 4C2SA 2JCKA 2JCOA 3DK5A 5CMIA 1QWJA 1O7OA 1V84A 2ZU9A 2MZBA 2QGIA 2RJ5A 3V0PA 1NKHB 3V0MA 2W0WA 5CMFX 1FWYA 3ZF8A 2VS5A 5I1FA 3OKRA 4KQLA 4ASJA 2DPWA 3R2WA 2P6WA 1O7QA 2UX8A 1S4PA 1LVWA 2GGQA 5CQMX 2I5EA 3PNNA 5FUHA 4XWIA 4HOCA 2J0BA 4ASYA 4P00A 4FRDA 5C38A 1VZXA 1ZJ0A 3EE5A 2V0HA 2XWNA 2YESA 1FO8A 2X5SA 5C1HA 1FOAA 1ZJOA 2BO4A 2BO6A 2AM5A 3U2VA 1XHBA 2YQJA 1GWWA 3SXGA 2P72A 5C4DA 2D7IA 1FRWA 2Z86A 4M2BA 1QG8A 1H7TA 4JISA 1OMZA 1ZCUA 3V0NA 2BO7A 4HO4A 2I5KA 1MP3A 2Y7AA 2Y6PA 2PA4A 4NAIA 2RJ4A 1G8OA 1H7EA 2XMEA 2AECA 2WGZA 1G93A 5C4FA 3GUEA 1ZIZA 1VICA 5HS2A 1JV3A 1ZI1A 1TVYA 4O6MA 1JVGA 1MP4A 4DECA 3V0QA 4Y64A 3JUKA 4FCUA 2RJ1A 1GX0A 2PGYA 3RSBA 2Z87A 1FXJA 3V91A 5C3AA 3D8VA 5DDVA 3SXAA 3FOQA 2V0JA 3PKQA 1ZDGA 1GQ9A 1FR8A 1YP4A 3ZGFA 1JVDA 4ZDQA 5C8RA 5CMJA 1VGZA 5C3DA 5CQNX 2RIYA 3DUVA 1KWSA 2WE9A 2AE7A 4Y9XA 3I0DA 3ST8A 3OC9A 3CGXA 2Q4JA 3I0IX 3F1CA 3IOJA 4FCEA 1VZTA 5DDTA 4L41C 4KRVA 4HO9A 1S4OA 1ZHJA 1YROB 3CKQA 4UEGA 1EYRA 2FYAA 1NMMB 3SXEA 4CJCA 2I7BA 1ZJ1A 4CVHA 5IDSA 4CJBA 1HV9A 1GX4A 4FREA 5C4EA 4Y6NA 3ZLLA 4FIYA 4D11C 3SXCA 3N9WA 4FQWA 4HO6A 2ICYA 3I0JA 4HG6A 4EEOA 1ZJPA 3V8ZA 4MYBA 2YC3A 4NANA 1H5TB 4Y6UA 4BQHA 1G97A 1H4CA 3CU0A 2RJ0A 3LW6A 4FRLA 4AYJA 1MC3A 4HO2A 1WVCA 5FU8A 5IFYA 1ON8A 1VH3A 3KIAA 1FG5N 3SX3A 3PKPA 1ZJ2A 2VK9A 1WT2A 3OGZA 1G2VA 1H3MA 2Y4JA 1VPAA 3TQDA 2E8BA 2AM3A 2YQHA 3SX5A 1O0RA 2FY7A 1MP5A 1H7HA 3U2UA 5C4BA 1ZI3A 4M28A 1INIA 4NALA 2WVLA 3D5NA 4D11A 2WVMA 2Y4MA 2XWMA 1VZUA 1LZ0A 1OQMB 3U2XA 1PZYB 2JCJA 4LW6A 2V0KA 2CU2A 4KPZA 4NAKA 4FRHA 1K4VA 4FRQA 2FYDB 1IINA 1R7VA 3DJ4A 1ZCVA 2Y4LA 5CQOA 5D92A 5IDTA 3I0EA 2V0IA 3I0LA 4D0TA 3OH4A 2V0LA 1INJA 2NXVA 3I0HA 1XZ6A 3IOIA 1V82A 2E3DA 4EE4A 2RJ6A 1TZFA 2O1GA 4FROA 4D0ZA 2AH9A 3U0YA 4FRMA 2YQSA 1ZCTA 1H4EA 3I0KA 2PGVA 1G3LA 1WT1A 5D91A 1H5SD 1WSZA 5EJ1A 3I0CA 2C0NA 4M2AA 1ZCYA 1W77A 3SPTA 4GBPA 2RITA 3ZLKA 2QH5A 1G9RA 2PX7A 3V90A 3K8EA 3T7MA 4YS8A 2QKXA 1YP3A 3BRKX 2YC5A 2WAWA 2VXLA 1PZTA 4IRPA 5EIYA 5BXCA 1FGXA 2ICXA 1H5RB 2XWLA 1HM8A 1NWGB 1H5SC 1LL2A 3CKJA 1W57A 4KC4A 5AJOA 1GWVA 2AESA 2RIZA 3FWWA 3I0FA 5C3BA 2J0AA 3BCVA 1H5RA 1NQIB 3POLA 5CMGX 3OH0A 1TW1A 4EEGA 3SX7A 1JYKA 1I52A 2WEEA 1TW5A 1HJJA 2FFUA 4M4KA 4KT7A 1OMXA 1H7GA 4Y7FA 4KNXA 4DDZA 1LZIA 4ECMA 3ZGGA 4EE3A 1H7LA 1HM9A 4Y7GA 1H5SB 3JTJA 4EEMA 1QGSA 1JYLA 1ZDFA 4G3QA 3T7OA 4B2WA 5C48A 5FYEA 2VFZA 4EVWA 1GQCA 2APCA 2A8UA 2OEFA 5CQLX 5C1LA 4Y7VA 1H5SA 4KC1A 5CMHA 4Y63A 3Q80A 4IRQA 4AAWA 1VGUA 4E1KA 4K6RA 1H5TA 5AJNA 4Q7CA 4B3UA 1FR9A 1FO9A 1ZI5A 3HL3A 2AM4A 5C1GA 3SXDA 4FRPA 1FZWA 4G3PA 5FU0A 1ZJ3A 4B4BA 1GA8A 2O1FA 4KXOA 4B2XA 2ZU8A 2D0JA 4Y62A 2VSIA 1VH1A 2AGDA 2FYCB 5FTVA 1H7FA 3I0GA 1WT3A 5CQPA 4Y7UA 3OH1A 1EZIA 2D7RA 4AC3A 2XMHA 2X60A 3QVBA 3USQA 2VXMA 1R7UA 4G3SA 4MNDA 4AYLA 2OEGA 4CJ8A 1HM0A 4O6NA 5C36A 4B5BA 3SXBA 1VGWA 4HO0A 1LL3A 3IOHA 3JUJA 4HO5A 4JD0A 3RMVA 1H7QA 2RIXA 1ON6A 3CKNA 1G95A 1FXOA 1R7XA 2OI5A 3T7NA 3R3IA 2ZU7A 2GGOA 4ARWA 3F1YA 5JQQA 3V0OA 3OH3A 1HJLA 1WT0A 2YCMA 3Q4SA 1R7YA 3RMWA 3NGWA 2W0VA 1VM8A 1H4DA 4KNRA 3U2WA 5AJPA 1R82A 3V8YA 4HO3A 2VSHA 4HCQA 4KC2A 2JCLA 1G0RA 4B42A 4EEAA 2WVKA 3CKOA 3U2TA 4HO8A 1R7TA 3E25A 1LL0A 1Z90A 4BMAA 2RJ8A 3OAMA 2FYBA 3K8DA 1YP2A 2VS3A 1SS9A 3E26A 4P02A 2YQCA 1W55A 1E5KA 5C49A 4B4MA 3CKVA 1G1LA 2X5ZA 4FIXA 3V0LA 5L6SA 1IIMA 1V83A 2VD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHE B;  1VGT A;  2RJ7 A;  3SX8 A;  3D98 A;  1LZJ A;  1JV1 A;  2Y4K A;  4Y7T A;  5J49 A;  2BO8 A;  4R7P A;  2RJ9 A;  3TZT A;  1FGG A;  4B4G A;  1R81 A;  1QGQ A;  2X65 A;  3Q7U A;  2P73 A;  4EE5 A;  5FTS A;  1S4N A;  4G87 A;  2O1H A;  2VS4 A;  3OH2 A;  4J18 A;  4FRB A;  5EJZ A;  2OI6 A;  3O3P A;  4KPX A;  1G23 A;  3U0X A;  4FRA A;  4DE7 A;  2A8W A;  1R80 A;  1O23 B;  2OI7 A;  2FFV A;  1ZI4 A;  5C4C A;  4D48 A;  5FV9 A;  4LW3 A;  1LZ7 A;  5C47 A;  5L6V A;  1NF5 B;  3USR A;  4C2S A;  2JCK A;  2JCO A;  3DK5 A;  5CMI A;  1QWJ A;  1O7O A;  1V84 A;  2ZU9 A;  2MZB A;  2QGI A;  2RJ5 A;  3V0P A;  1NKH B;  3V0M A;  2W0W A;  5CMF X;  1FWY A;  3ZF8 A;  2VS5 A;  5I1F A;  3OKR A;  4KQL A;  4ASJ A;  2DPW A;  3R2W A;  2P6W A;  1O7Q A;  2UX8 A;  1S4P A;  1LVW A;  2GGQ A;  5CQM X;  2I5E A;  3PNN A;  5FUH A;  4XWI A;  4HOC A;  4ASY A;  4P00 A;  4FRD A;  5C38 A;  1VZX A;  1ZJ0 A;  3EE5 A;  2V0H A;  2XWN A;  2YES A;  1FO8 A;  2X5S A;  5C1H A;  1FOA A;  1ZJO A;  2BO4 A;  2BO6 A;  2AM5 A;  3U2V A;  1XHB A;  2YQJ A;  1GWW A;  3SXG A;  2P72 A;  5C4D A;  2D7I A;  1FRW A;  2Z86 A;  4M2B A;  1QG8 A;  1H7T A;  4JIS A;  1OMZ A;  1ZCU A;  3V0N A;  2BO7 A;  4HO4 A;  2I5K A;  1MP3 A;  2Y7A A;  2Y6P A;  2PA4 A;  4NAI A;  2RJ4 A;  1G8O A;  1H7E A;  2XME A;  2AEC A;  2WGZ A;  1G93 A;  5C4F A;  3GUE A;  1ZIZ A;  1VIC A;  5HS2 A;  1JV3 A;  1ZI1 A;  1TVY A;  1JVG A;  1MP4 A;  4DEC A;  3V0Q A;  4Y64 A;  3JUK A;  4FCU A;  2RJ1 A;  1GX0 A;  2PGY A;  3RSB A;  2Z87 A;  1FXJ A;  3V91 A;  5C3A A;  3D8V A;  5DDV A;  3SXA A;  3FOQ A;  2V0J A;  3PKQ A;  1ZDG A;  1GQ9 A;  1FR8 A;  1YP4 A;  3ZGF A;  1JVD A;  4ZDQ A;  5C8R A;  5CMJ A;  1VGZ A;  5C3D A;  5CQN X;  2RIY A;  3DUV A;  1KWS A;  2WE9 A;  2AE7 A;  4Y9X A;  3I0D A;  3ST8 A;  3OC9 A;  3CGX A;  2Q4J A;  3I0I X;  3F1C A;  3IOJ A;  4FCE A;  1VZT A;  5DDT A;  4L41 C;  4KRV A;  4HO9 A;  1S4O A;  1ZHJ A;  1YRO B;  3CKQ A;  4UEG A;  1EYR A;  2FYA A;  1NMM B;  3SXE A;  4CJC A;  2I7B A;  1ZJ1 A;  4CVH A;  5IDS A;  4CJB A;  1HV9 A;  1GX4 A;  4FRE A;  5C4E A;  4Y6N A;  3ZLL A;  4D11 C;  3SXC A;  3N9W A;  4FQW A;  4HO6 A;  2ICY A;  3I0J A;  4HG6 A;  4EEO A;  1ZJP A;  3V8Z A;  4MYB A;  2YC3 A;  4NAN A;  1H5T B;  4Y6U A;  4BQH A;  1G97 A;  1H4C A;  3CU0 A;  2RJ0 A;  3LW6 A;  4FRL A;  4AYJ A;  1MC3 A;  4HO2 A;  1WVC A;  5FU8 A;  5IFY A;  1ON8 A;  1VH3 A;  3KIA A;  1FG5 N;  3SX3 A;  3PKP A;  1ZJ2 A;  1WT2 A;  3OGZ A;  1G2V A;  1H3M A;  2Y4J A;  1VPA A;  3TQD A;  2E8B A;  2AM3 A;  2YQH A;  3SX5 A;  1O0R A;  2FY7 A;  1MP5 A;  1H7H A;  3U2U A;  5C4B A;  1ZI3 A;  4M28 A;  1INI A;  4NAL A;  2WVL A;  3D5N A;  4D11 A;  2WVM A;  2Y4M A;  2XWM A;  1VZU A;  1LZ0 A;  1OQM B;  3U2X A;  1PZY B;  2JCJ A;  4LW6 A;  2V0K A;  2CU2 A;  4KPZ A;  4NAK A;  4FRH A;  1K4V A;  4FRQ A;  2FYD B;  1IIN A;  1R7V A;  3DJ4 A;  1ZCV A;  2Y4L A;  5CQO A;  5IDT A;  3I0E A;  2V0I A;  3I0L A;  4D0T A;  3OH4 A;  2V0L A;  1INJ A;  2NXV A;  3I0H A;  1XZ6 A;  3IOI A;  1V82 A;  2E3D A;  4EE4 A;  2RJ6 A;  1TZF A;  2O1G A;  4FRO A;  4D0Z A;  2AH9 A;  3U0Y A;  4FRM A;  2YQS A;  1ZCT A;  1H4E A;  3I0K A;  2PGV A;  1G3L A;  1WT1 A;  1H5S D;  1WSZ A;  5EJ1 A;  3I0C A;  4M2A A;  1ZCY A;  1W77 A;  3SPT A;  4GBP A;  2RIT A;  3ZLK A;  2QH5 A;  1G9R A;  2PX7 A;  3V90 A;  3K8E A;  3T7M A;  4YS8 A;  2QKX A;  1YP3 A;  3BRK X;  2YC5 A;  2WAW A;  2VXL A;  1PZT A;  4IRP A;  5EIY A;  5BXC A;  1FGX A;  2ICX A;  1H5R B;  2XWL A;  1HM8 A;  1NWG B;  1H5S C;  1LL2 A;  3CKJ A;  1W57 A;  4KC4 A;  5AJO A;  1GWV A;  2AES A;  2RIZ A;  3FWW A;  3I0F A;  5C3B A;  3BCV A;  1H5R A;  1NQI B;  3POL A;  5CMG X;  3OH0 A;  1TW1 A;  4EEG A;  3SX7 A;  1JYK A;  1I52 A;  2WEE A;  1TW5 A;  1HJJ A;  2FFU A;  4M4K A;  4KT7 A;  1OMX A;  1H7G A;  4Y7F A;  4KNX A;  4DDZ A;  1LZI A;  4ECM A;  3ZGG A;  4EE3 A;  1H7L A;  1HM9 A;  4Y7G A;  1H5S B;  3JTJ A;  4EEM A;  1QGS A;  1JYL A;  1ZDF A;  4G3Q A;  3T7O A;  4B2W A;  5C48 A;  5FYE A;  2VFZ A;  4EVW A;  1GQC A;  2APC A;  2A8U A;  2OEF A;  5CQL X;  5C1L A;  4Y7V A;  1H5S A;  4KC1 A;  5CMH A;  4Y63 A;  3Q80 A;  4IRQ A;  4AAW A;  1VGU A;  4E1K A;  4K6R A;  1H5T A;  5AJN A;  4B3U A;  1FR9 A;  1FO9 A;  1ZI5 A;  3HL3 A;  2AM4 A;  5C1G A;  3SXD A;  4FRP A;  1FZW A;  4G3P A;  5FU0 A;  1ZJ3 A;  4B4B A;  1GA8 A;  2O1F A;  4KXO A;  4B2X A;  2ZU8 A;  2D0J A;  4Y62 A;  2VSI A;  1VH1 A;  2AGD A;  2FYC B;  5FTV A;  1H7F A;  3I0G A;  1WT3 A;  5CQP A;  4Y7U A;  3OH1 A;  1EZI A;  2D7R A;  4AC3 A;  2XMH A;  2X60 A;  3QVB A;  3USQ A;  2VXM A;  1R7U A;  4G3S A;  4MND A;  4AYL A;  2OEG A;  4CJ8 A;  1HM0 A;  5C36 A;  4B5B A;  3SXB A;  1VGW A;  4HO0 A;  1LL3 A;  3IOH A;  3JUJ A;  4HO5 A;  4JD0 A;  3RMV A;  1H7Q A;  2RIX A;  1ON6 A;  3CKN A;  1G95 A;  1FXO A;  1R7X A;  2OI5 A;  3T7N A;  3R3I A;  2ZU7 A;  2GGO A;  4ARW A;  3F1Y A;  5JQQ A;  3V0O A;  3OH3 A;  1HJL A;  1WT0 A;  2YCM A;  3Q4S A;  1R7Y A;  3RMW A;  3NGW A;  2W0V A;  1VM8 A;  1H4D A;  4KNR A;  3U2W A;  5AJP A;  1R82 A;  3V8Y A;  4HO3 A;  2VSH A;  4HCQ A;  4KC2 A;  2JCL A;  1G0R A;  4B42 A;  4EEA A;  2WVK A;  3CKO A;  3U2T A;  4HO8 A;  1R7T A;  3E25 A;  1LL0 A;  1Z90 A;  4BMA A;  2RJ8 A;  3OAM A;  2FYB A;  3K8D A;  1YP2 A;  2VS3 A;  1SS9 A;  3E26 A;  4P02 A;  2YQC A;  1W55 A;  1E5K A;  5C49 A;  4B4M A;  3CKV A;  1G1L A;  2X5Z A;  3V0L A;  5L6S A;  1IIM A;  1V83 A;  2VD4 A; 
#chains in the Genus database with same CATH topology
 1NHE B;  1VGT A;  2RJ7 A;  3SX8 A;  4MIX A;  3D98 A;  1LZJ A;  1JV1 A;  2Y4K A;  4Y7T A;  5J49 A;  2BO8 A;  4R7P A;  2RJ9 A;  3TZT A;  1FGG A;  4B4G A;  1R81 A;  1QGQ A;  2X65 A;  3Q7U A;  2P73 A;  4EE5 A;  5FTS A;  1S4N A;  4G87 A;  2O1H A;  2VS4 A;  3OH2 A;  4J18 A;  4FRB A;  5EJZ A;  2OI6 A;  3O3P A;  4KPX A;  1G23 A;  3U0X A;  4FRA A;  4DE7 A;  2A8W A;  1R80 A;  1O23 B;  2OI7 A;  2FFV A;  1ZI4 A;  5C4C A;  4D48 A;  5FV9 A;  4LW3 A;  1LZ7 A;  5C47 A;  5L6V A;  1NF5 B;  3USR A;  4C2S A;  2JCK A;  2JCO A;  3DK5 A;  5CMI A;  1QWJ A;  1O7O A;  1V84 A;  2ZU9 A;  2MZB A;  2QGI A;  2RJ5 A;  3V0P A;  1NKH B;  3V0M A;  2W0W A;  5CMF X;  1FWY A;  3ZF8 A;  2VS5 A;  5I1F A;  3OKR A;  4KQL A;  4ASJ A;  2DPW A;  3R2W A;  2P6W A;  1O7Q A;  2UX8 A;  1S4P A;  1LVW A;  2GGQ A;  5CQM X;  2I5E A;  3PNN A;  5FUH A;  4XWI A;  4HOC A;  2J0B A;  4ASY A;  4P00 A;  4FRD A;  5C38 A;  1VZX A;  1ZJ0 A;  3EE5 A;  2V0H A;  2XWN A;  2YES A;  1FO8 A;  2X5S A;  5C1H A;  1FOA A;  1ZJO A;  2BO4 A;  2BO6 A;  2AM5 A;  3U2V A;  1XHB A;  2YQJ A;  1GWW A;  3SXG A;  2P72 A;  5C4D A;  2D7I A;  1FRW A;  2Z86 A;  4M2B A;  1QG8 A;  1H7T A;  4JIS A;  1OMZ A;  1ZCU A;  3V0N A;  2BO7 A;  4HO4 A;  2I5K A;  1MP3 A;  2Y7A A;  2Y6P A;  2PA4 A;  4NAI A;  2RJ4 A;  1G8O A;  1H7E A;  2XME A;  2AEC A;  2WGZ A;  1G93 A;  5C4F A;  3GUE A;  1ZIZ A;  1VIC A;  5HS2 A;  1JV3 A;  1ZI1 A;  1TVY A;  4O6M A;  1JVG A;  1MP4 A;  4DEC A;  3V0Q A;  4Y64 A;  3JUK A;  4FCU A;  2RJ1 A;  1GX0 A;  2PGY A;  3RSB A;  2Z87 A;  1FXJ A;  3V91 A;  5C3A A;  3D8V A;  5DDV A;  3SXA A;  3FOQ A;  2V0J A;  3PKQ A;  1ZDG A;  1GQ9 A;  1FR8 A;  1YP4 A;  3ZGF A;  1JVD A;  4ZDQ A;  5C8R A;  5CMJ A;  1VGZ A;  5C3D A;  5CQN X;  2RIY A;  3DUV A;  1KWS A;  2WE9 A;  2AE7 A;  4Y9X A;  3I0D A;  3ST8 A;  3OC9 A;  3CGX A;  2Q4J A;  3I0I X;  3F1C A;  3IOJ A;  4FCE A;  1VZT A;  5DDT A;  4L41 C;  4KRV A;  4HO9 A;  1S4O A;  1ZHJ A;  1YRO B;  3CKQ A;  4UEG A;  1EYR A;  2FYA A;  1NMM B;  3SXE A;  4CJC A;  2I7B A;  1ZJ1 A;  4CVH A;  5IDS A;  4CJB A;  1HV9 A;  1GX4 A;  4FRE A;  5C4E A;  4Y6N A;  3ZLL A;  4FIY A;  4D11 C;  3SXC A;  3N9W A;  4FQW A;  4HO6 A;  2ICY A;  3I0J A;  4HG6 A;  4EEO A;  1ZJP A;  3V8Z A;  4MYB A;  2YC3 A;  4NAN A;  1H5T B;  4Y6U A;  4BQH A;  1G97 A;  1H4C A;  3CU0 A;  2RJ0 A;  3LW6 A;  4FRL A;  4AYJ A;  1MC3 A;  4HO2 A;  1WVC A;  5FU8 A;  5IFY A;  1ON8 A;  1VH3 A;  3KIA A;  1FG5 N;  3SX3 A;  3PKP A;  1ZJ2 A;  2VK9 A;  1WT2 A;  3OGZ A;  1G2V A;  1H3M A;  2Y4J A;  1VPA A;  3TQD A;  2E8B A;  2AM3 A;  2YQH A;  3SX5 A;  1O0R A;  2FY7 A;  1MP5 A;  1H7H A;  3U2U A;  5C4B A;  1ZI3 A;  4M28 A;  1INI A;  4NAL A;  2WVL A;  3D5N A;  4D11 A;  2WVM A;  2Y4M A;  2XWM A;  1VZU A;  1LZ0 A;  1OQM B;  3U2X A;  1PZY B;  2JCJ A;  4LW6 A;  2V0K A;  2CU2 A;  4KPZ A;  4NAK A;  4FRH A;  1K4V A;  4FRQ A;  2FYD B;  1IIN A;  1R7V A;  3DJ4 A;  1ZCV A;  2Y4L A;  5CQO A;  5D92 A;  5IDT A;  3I0E A;  2V0I A;  3I0L A;  4D0T A;  3OH4 A;  2V0L A;  1INJ A;  2NXV A;  3I0H A;  1XZ6 A;  3IOI A;  1V82 A;  2E3D A;  4EE4 A;  2RJ6 A;  1TZF A;  2O1G A;  4FRO A;  4D0Z A;  2AH9 A;  3U0Y A;  4FRM A;  2YQS A;  1ZCT A;  1H4E A;  3I0K A;  2PGV A;  1G3L A;  1WT1 A;  5D91 A;  1H5S D;  1WSZ A;  5EJ1 A;  3I0C A;  2C0N A;  4M2A A;  1ZCY A;  1W77 A;  3SPT A;  4GBP A;  2RIT A;  3ZLK A;  2QH5 A;  1G9R A;  2PX7 A;  3V90 A;  3K8E A;  3T7M A;  4YS8 A;  2QKX A;  1YP3 A;  3BRK X;  2YC5 A;  2WAW A;  2VXL A;  1PZT A;  4IRP A;  5EIY A;  5BXC A;  1FGX A;  2ICX A;  1H5R B;  2XWL A;  1HM8 A;  1NWG B;  1H5S C;  1LL2 A;  3CKJ A;  1W57 A;  4KC4 A;  5AJO A;  1GWV A;  2AES A;  2RIZ A;  3FWW A;  3I0F A;  5C3B A;  2J0A A;  3BCV A;  1H5R A;  1NQI B;  3POL A;  5CMG X;  3OH0 A;  1TW1 A;  4EEG A;  3SX7 A;  1JYK A;  1I52 A;  2WEE A;  1TW5 A;  1HJJ A;  2FFU A;  4M4K A;  4KT7 A;  1OMX A;  1H7G A;  4Y7F A;  4KNX A;  4DDZ A;  1LZI A;  4ECM A;  3ZGG A;  4EE3 A;  1H7L A;  1HM9 A;  4Y7G A;  1H5S B;  3JTJ A;  4EEM A;  1QGS A;  1JYL A;  1ZDF A;  4G3Q A;  3T7O A;  4B2W A;  5C48 A;  5FYE A;  2VFZ A;  4EVW A;  1GQC A;  2APC A;  2A8U A;  2OEF A;  5CQL X;  5C1L A;  4Y7V A;  1H5S A;  4KC1 A;  5CMH A;  4Y63 A;  3Q80 A;  4IRQ A;  4AAW A;  1VGU A;  4E1K A;  4K6R A;  1H5T A;  5AJN A;  4Q7C A;  4B3U A;  1FR9 A;  1FO9 A;  1ZI5 A;  3HL3 A;  2AM4 A;  5C1G A;  3SXD A;  4FRP A;  1FZW A;  4G3P A;  5FU0 A;  1ZJ3 A;  4B4B A;  1GA8 A;  2O1F A;  4KXO A;  4B2X A;  2ZU8 A;  2D0J A;  4Y62 A;  2VSI A;  1VH1 A;  2AGD A;  2FYC B;  5FTV A;  1H7F A;  3I0G A;  1WT3 A;  5CQP A;  4Y7U A;  3OH1 A;  1EZI A;  2D7R A;  4AC3 A;  2XMH A;  2X60 A;  3QVB A;  3USQ A;  2VXM A;  1R7U A;  4G3S A;  4MND A;  4AYL A;  2OEG A;  4CJ8 A;  1HM0 A;  4O6N A;  5C36 A;  4B5B A;  3SXB A;  1VGW A;  4HO0 A;  1LL3 A;  3IOH A;  3JUJ A;  4HO5 A;  4JD0 A;  3RMV A;  1H7Q A;  2RIX A;  1ON6 A;  3CKN A;  1G95 A;  1FXO A;  1R7X A;  2OI5 A;  3T7N A;  3R3I A;  2ZU7 A;  2GGO A;  4ARW A;  3F1Y A;  5JQQ A;  3V0O A;  3OH3 A;  1HJL A;  1WT0 A;  2YCM A;  3Q4S A;  1R7Y A;  3RMW A;  3NGW A;  2W0V A;  1VM8 A;  1H4D A;  4KNR A;  3U2W A;  5AJP A;  1R82 A;  3V8Y A;  4HO3 A;  2VSH A;  4HCQ A;  4KC2 A;  2JCL A;  1G0R A;  4B42 A;  4EEA A;  2WVK A;  3CKO A;  3U2T A;  4HO8 A;  1R7T A;  3E25 A;  1LL0 A;  1Z90 A;  4BMA A;  2RJ8 A;  3OAM A;  2FYB A;  3K8D A;  1YP2 A;  2VS3 A;  1SS9 A;  3E26 A;  4P02 A;  2YQC A;  1W55 A;  1E5K A;  5C49 A;  4B4M A;  3CKV A;  1G1L A;  2X5Z A;  4FIX A;  3V0L A;  5L6S A;  1IIM A;  1V83 A;  2VD4 A; 
#chains in the Genus database with same CATH homology
 1NHE B;  1VGT A;  2RJ7 A;  3SX8 A;  4MIX A;  3D98 A;  1LZJ A;  1JV1 A;  2Y4K A;  4Y7T A;  5J49 A;  2BO8 A;  4R7P A;  2RJ9 A;  3TZT A;  1FGG A;  4B4G A;  1R81 A;  1QGQ A;  2X65 A;  3Q7U A;  2P73 A;  4EE5 A;  5FTS A;  1S4N A;  4G87 A;  2O1H A;  2VS4 A;  3OH2 A;  4J18 A;  4FRB A;  5EJZ A;  2OI6 A;  3O3P A;  4KPX A;  1G23 A;  3U0X A;  4FRA A;  4DE7 A;  2A8W A;  1R80 A;  1O23 B;  2OI7 A;  2FFV A;  1ZI4 A;  5C4C A;  4D48 A;  5FV9 A;  4LW3 A;  1LZ7 A;  5C47 A;  5L6V A;  1NF5 B;  3USR A;  4C2S A;  2JCK A;  2JCO A;  3DK5 A;  5CMI A;  1QWJ A;  1O7O A;  1V84 A;  2ZU9 A;  2MZB A;  2QGI A;  2RJ5 A;  3V0P A;  1NKH B;  3V0M A;  2W0W A;  5CMF X;  1FWY A;  3ZF8 A;  2VS5 A;  5I1F A;  3OKR A;  4KQL A;  4ASJ A;  2DPW A;  3R2W A;  2P6W A;  1O7Q A;  2UX8 A;  1S4P A;  1LVW A;  2GGQ A;  5CQM X;  2I5E A;  3PNN A;  5FUH A;  4XWI A;  4HOC A;  2J0B A;  4ASY A;  4P00 A;  4FRD A;  5C38 A;  1VZX A;  1ZJ0 A;  3EE5 A;  2V0H A;  2XWN A;  2YES A;  1FO8 A;  2X5S A;  5C1H A;  1FOA A;  1ZJO A;  2BO4 A;  2BO6 A;  2AM5 A;  3U2V A;  1XHB A;  2YQJ A;  1GWW A;  3SXG A;  2P72 A;  5C4D A;  2D7I A;  1FRW A;  2Z86 A;  4M2B A;  1QG8 A;  1H7T A;  4JIS A;  1OMZ A;  1ZCU A;  3V0N A;  2BO7 A;  4HO4 A;  2I5K A;  1MP3 A;  2Y7A A;  2Y6P A;  2PA4 A;  4NAI A;  2RJ4 A;  1G8O A;  1H7E A;  2XME A;  2AEC A;  2WGZ A;  1G93 A;  5C4F A;  3GUE A;  1ZIZ A;  1VIC A;  5HS2 A;  1JV3 A;  1ZI1 A;  1TVY A;  4O6M A;  1JVG A;  1MP4 A;  4DEC A;  3V0Q A;  4Y64 A;  3JUK A;  4FCU A;  2RJ1 A;  1GX0 A;  2PGY A;  3RSB A;  2Z87 A;  1FXJ A;  3V91 A;  5C3A A;  3D8V A;  5DDV A;  3SXA A;  3FOQ A;  2V0J A;  3PKQ A;  1ZDG A;  1GQ9 A;  1FR8 A;  1YP4 A;  3ZGF A;  1JVD A;  4ZDQ A;  5C8R A;  5CMJ A;  1VGZ A;  5C3D A;  5CQN X;  2RIY A;  3DUV A;  1KWS A;  2WE9 A;  2AE7 A;  4Y9X A;  3I0D A;  3ST8 A;  3OC9 A;  3CGX A;  2Q4J A;  3I0I X;  3F1C A;  3IOJ A;  4FCE A;  1VZT A;  5DDT A;  4L41 C;  4KRV A;  4HO9 A;  1S4O A;  1ZHJ A;  1YRO B;  3CKQ A;  4UEG A;  1EYR A;  2FYA A;  1NMM B;  3SXE A;  4CJC A;  2I7B A;  1ZJ1 A;  4CVH A;  5IDS A;  4CJB A;  1HV9 A;  1GX4 A;  4FRE A;  5C4E A;  4Y6N A;  3ZLL A;  4FIY A;  4D11 C;  3SXC A;  3N9W A;  4FQW A;  4HO6 A;  2ICY A;  3I0J A;  4HG6 A;  4EEO A;  1ZJP A;  3V8Z A;  4MYB A;  2YC3 A;  4NAN A;  1H5T B;  4Y6U A;  4BQH A;  1G97 A;  1H4C A;  3CU0 A;  2RJ0 A;  3LW6 A;  4FRL A;  4AYJ A;  1MC3 A;  4HO2 A;  1WVC A;  5FU8 A;  5IFY A;  1ON8 A;  1VH3 A;  3KIA A;  1FG5 N;  3SX3 A;  3PKP A;  1ZJ2 A;  2VK9 A;  1WT2 A;  3OGZ A;  1G2V A;  1H3M A;  2Y4J A;  1VPA A;  3TQD A;  2E8B A;  2AM3 A;  2YQH A;  3SX5 A;  1O0R A;  2FY7 A;  1MP5 A;  1H7H A;  3U2U A;  5C4B A;  1ZI3 A;  4M28 A;  1INI A;  4NAL A;  2WVL A;  3D5N A;  4D11 A;  2WVM A;  2Y4M A;  2XWM A;  1VZU A;  1LZ0 A;  1OQM B;  3U2X A;  1PZY B;  2JCJ A;  4LW6 A;  2V0K A;  2CU2 A;  4KPZ A;  4NAK A;  4FRH A;  1K4V A;  4FRQ A;  2FYD B;  1IIN A;  1R7V A;  3DJ4 A;  1ZCV A;  2Y4L A;  5CQO A;  5D92 A;  5IDT A;  3I0E A;  2V0I A;  3I0L A;  4D0T A;  3OH4 A;  2V0L A;  1INJ A;  2NXV A;  3I0H A;  1XZ6 A;  3IOI A;  1V82 A;  2E3D A;  4EE4 A;  2RJ6 A;  1TZF A;  2O1G A;  4FRO A;  4D0Z A;  2AH9 A;  3U0Y A;  4FRM A;  2YQS A;  1ZCT A;  1H4E A;  3I0K A;  2PGV A;  1G3L A;  1WT1 A;  5D91 A;  1H5S D;  1WSZ A;  5EJ1 A;  3I0C A;  2C0N A;  4M2A A;  1ZCY A;  1W77 A;  3SPT A;  4GBP A;  2RIT A;  3ZLK A;  2QH5 A;  1G9R A;  2PX7 A;  3V90 A;  3K8E A;  3T7M A;  4YS8 A;  2QKX A;  1YP3 A;  3BRK X;  2YC5 A;  2WAW A;  2VXL A;  1PZT A;  4IRP A;  5EIY A;  5BXC A;  1FGX A;  2ICX A;  1H5R B;  2XWL A;  1HM8 A;  1NWG B;  1H5S C;  1LL2 A;  3CKJ A;  1W57 A;  4KC4 A;  5AJO A;  1GWV A;  2AES A;  2RIZ A;  3FWW A;  3I0F A;  5C3B A;  2J0A A;  3BCV A;  1H5R A;  1NQI B;  3POL A;  5CMG X;  3OH0 A;  1TW1 A;  4EEG A;  3SX7 A;  1JYK A;  1I52 A;  2WEE A;  1TW5 A;  1HJJ A;  2FFU A;  4M4K A;  4KT7 A;  1OMX A;  1H7G A;  4Y7F A;  4KNX A;  4DDZ A;  1LZI A;  4ECM A;  3ZGG A;  4EE3 A;  1H7L A;  1HM9 A;  4Y7G A;  1H5S B;  3JTJ A;  4EEM A;  1QGS A;  1JYL A;  1ZDF A;  4G3Q A;  3T7O A;  4B2W A;  5C48 A;  5FYE A;  2VFZ A;  4EVW A;  1GQC A;  2APC A;  2A8U A;  2OEF A;  5CQL X;  5C1L A;  4Y7V A;  1H5S A;  4KC1 A;  5CMH A;  4Y63 A;  3Q80 A;  4IRQ A;  4AAW A;  1VGU A;  4E1K A;  4K6R A;  1H5T A;  5AJN A;  4Q7C A;  4B3U A;  1FR9 A;  1FO9 A;  1ZI5 A;  3HL3 A;  2AM4 A;  5C1G A;  3SXD A;  4FRP A;  1FZW A;  4G3P A;  5FU0 A;  1ZJ3 A;  4B4B A;  1GA8 A;  2O1F A;  4KXO A;  4B2X A;  2ZU8 A;  2D0J A;  4Y62 A;  2VSI A;  1VH1 A;  2AGD A;  2FYC B;  5FTV A;  1H7F A;  3I0G A;  1WT3 A;  5CQP A;  4Y7U A;  3OH1 A;  1EZI A;  2D7R A;  4AC3 A;  2XMH A;  2X60 A;  3QVB A;  3USQ A;  2VXM A;  1R7U A;  4G3S A;  4MND A;  4AYL A;  2OEG A;  4CJ8 A;  1HM0 A;  4O6N A;  5C36 A;  4B5B A;  3SXB A;  1VGW A;  4HO0 A;  1LL3 A;  3IOH A;  3JUJ A;  4HO5 A;  4JD0 A;  3RMV A;  1H7Q A;  2RIX A;  1ON6 A;  3CKN A;  1G95 A;  1FXO A;  1R7X A;  2OI5 A;  3T7N A;  3R3I A;  2ZU7 A;  2GGO A;  4ARW A;  3F1Y A;  5JQQ A;  3V0O A;  3OH3 A;  1HJL A;  1WT0 A;  2YCM A;  3Q4S A;  1R7Y A;  3RMW A;  3NGW A;  2W0V A;  1VM8 A;  1H4D A;  4KNR A;  3U2W A;  5AJP A;  1R82 A;  3V8Y A;  4HO3 A;  2VSH A;  4HCQ A;  4KC2 A;  2JCL A;  1G0R A;  4B42 A;  4EEA A;  2WVK A;  3CKO A;  3U2T A;  4HO8 A;  1R7T A;  3E25 A;  1LL0 A;  1Z90 A;  4BMA A;  2RJ8 A;  3OAM A;  2FYB A;  3K8D A;  1YP2 A;  2VS3 A;  1SS9 A;  3E26 A;  4P02 A;  2YQC A;  1W55 A;  1E5K A;  5C49 A;  4B4M A;  3CKV A;  1G1L A;  2X5Z A;  4FIX A;  3V0L A;  5L6S A;  1IIM A;  1V83 A;  2VD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...