3Q7UA

Structure of mtb 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) complexed with ctp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
226
structure length
222
Chain Sequence
GEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLDEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase
publication title Crystal Structure of Mycobacterium tuberculosis 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD): a candidate antitubercular drug target
rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 222
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3q7uA00
3IOHA 4HG6A 3RSBA 2APCA 3PNNA 2X5ZA 5C1GA 2E8BA 2WEEA 4CJBA 5CQPA 1G3LA 5CMJA 3OH1A 1R81A 1INIA 1R7TA 5CQLX 1H5SB 2I5EA 2Y4MA 3R3IA 4MNDA 1GWWA 3EE5A 4EE3A 2VXLA 2FFVA 3JTJA 4JISA 2RJ7A 1ZDFA 3K8EA 3V0MA 2QGIA 4Y7VA 4Y63A 2Y4KA 2CU2A 3SXAA 2ZU7A 4ARWA 5AJNA 1G23A 3NGWA 4DE7A 3I0KA 3USRA 3D98A 1R7VA 1HV9A 2WVMA 4UEGA 1LL2A 3RMVA 5CMHA 2E3DA 4G3SA 1ZI1A 2FFUA 2ZU9A 4B2WA 5IFYA 2PA4A 1QGQA 4HO5A 1S4OA 1YP4A 3SX5A 2RITA 1NHEB 1VZXA 1EZIA 2WGZA 2RJ8A 1LL0A 4NALA 3U2UA 4B5BA 1NKHB 4KPXA 1YROB 2I7BA 3I0GA 1ZIZA 1H5SC 1ZCUA 1WT0A 2FYCB 2V0HA 1SS9A 5C36A 1JVDA 1H7GA 2RJ5A 5CQMX 2V0IA 3KIAA 5FU8A 2WE9A 1R7UA 4G3PA 1H7EA 1LL3A 1ZJPA 1FWYA 1G93A 4D0TA 1PZTA 5EJZA 1FXOA 1W55A 1R7XA 3CKQA 1FZWA 1JYKA 1QWJA 1G97A 3DUVA 1VPAA 1ZCTA 2X65A 1OMXA 4IRQA 2NXVA 4KNXA 1ZHJA 3OKRA 1VH3A 4K6RA 1GQ9A 4FCEA 1FO9A 2RJ1A 5L6SA 3O3PA 4G87A 2RJ0A 3I0CA 4KXOA 4HO3A 4XWIA 3V8ZA 2P72A 3CKNA 2ICYA 2VSIA 3DK5A 3V8YA 5HS2A 4Y7GA 4B2XA 4HO6A 1H5TB 3PKQA 3U0YA 1LZ7A 5FTVA 2JCOA 1H5RA 4DECA 1O0RA 2QKXA 2RJ6A 2VXMA 3I0LA 3V0QA 4AYLA 2MZBA 2Z87A 3V0OA 1PZYB 3SXGA 4EE5A 5FUHA 2XMEA 5C4BA 1ZJ0A 4B4GA 1ZI3A 4Y9XA 3LW6A 1LVWA 1HJLA 4Y64A 1IINA 4R7PA 5FYEA 4G3QA 4Y7UA 4MYBA 4EE4A 3V91A 1H7TA 3I0DA 3IOIA 4KQLA 4E1KA 4CJCA 1H4DA 1TW5A 4FRAA 4M2BA 4KT7A 2QH5A 2VS5A 3RMWA 2BO4A 2OEFA 5C48A 2JCKA 1G1LA 4FRDA 2A8UA 1VICA 1ZCVA 4KRVA 4KC4A 1R80A 4EEGA 1O7QA 2WVLA 4KNRA 1H5RB 5J49A 4FRHA 4Y62A 1HM0A 5DDVA 5C1HA 1JV1A 1G8OA 2OEGA 1KWSA 2FYAA 1H4EA 2YQSA 3V90A 2O1FA 5FV9A 4HO9A 1GWVA 4D0ZA 3I0FA 1WT3A 5JQQA 2XWLA 3U2WA 3CGXA 1H7QA 2VSHA 4YS8A 4CJ8A 1ZCYA 5CMIA 3OH4A 2FYBA 1H5SD 4B4BA 4DDZA 5IDSA 3U2VA 4CVHA 1LZ0A 2D7IA 1ON8A 4B4MA 3N9WA 1LZIA 1OMZA 5CQOA 1ZJ2A 2D0JA 2YQHA 1I52A 1FGGA 2YCMA 1VGUA 1S4NA 3ZF8A 1G0RA 2V0LA 2OI5A 1HM9A 1HM8A 1V82A 2PGYA 1H5TA 1ZJ3A 3SX3A 1G9RA 4B3UA 5EIYA 2OI7A 2AM5A 1TW1A 3U2TA 2ICXA 5CQNX 3ZLKA 1YP3A 5I1FA 1TVYA 1ZI5A 4HCQA 1FR8A 2GGOA 4M28A 1XHBA 5AJOA 5CMGX 3POLA 2VS3A 2RJ4A 4P02A 4BMAA 1W77A 1H7FA 2X60A 4AAWA 4NAIA 1MC3A 1NF5B 3TQDA 2AGDA 3GUEA 3I0EA 3V0LA 4FRBA 4FRLA 2AE7A 2W0VA 2Y4JA 4J18A 4FRMA 5C4FA 3I0HA 3IOJA 1ZI4A 4ECMA 1FO8A 2RIYA 4EVWA 3SXCA 3U2XA 2YQCA 4ZDQA 3E26A 4FCUA 1VZUA 1FGXA 1GA8A 5C3DA 1H4CA 1FG5N 1GX0A 3BRKX 1JV3A 2XWNA 2Y4LA 3TZTA 2XMHA 2Q4JA 4EEOA 1IIMA 4KC2A 2DPWA 2W0WA 2FY7A 2AECA 3ZGGA 1S4PA 2FYDB 5BXCA 2YC3A 3SX8A 3U0XA 3R2WA 1FOAA 2I5KA 3T7MA 4HO2A 1VGTA 2RIXA 2V0KA 3K8DA 3D8VA 4JD0A 4P00A 5C38A 1FXJA 2YQJA 2UX8A 3I0JA 2WAWA 5C8RA 3DJ4A 4Y6NA 4D11C 3FWWA 4HO0A 4AC3A 5C4DA 2AH9A 1NWGB 2BO8A 1H7HA 4IRPA 5C3AA 3OAMA 5C4CA 3SXEA 4EEAA 4L41C 3F1YA 3Q7UA 4EEMA 3ZGFA 3SPTA 5C3BA 2O1HA 3OC9A 4KPZA 4AYJA 3JUKA 1YP2A 2OI6A 4ASYA 2PX7A 1Z90A 1ZDGA 1WT2A 4FRPA 3BCVA 4FQWA 3CKOA 3D5NA 2AM3A 1NMMB 2WVKA 3QVBA 1JYLA 5IDTA 4KC1A 2XWMA 2VS4A 4D48A 3HL3A 2D7RA 2A8WA 3ST8A 3SX7A 3V0PA 4D11A 3V0NA 4BQHA 4HO4A 2VFZA 2O1GA 2BO7A 3OGZA 3USQA 1G95A 1VH1A 3ZLLA 1GQCA 1ON6A 3SXDA 1O7OA 3F1CA 3T7OA 1QG8A 1TZFA 1V83A 2ZU8A 3Q80A 2YESA 2Y6PA 3CU0A 5C1LA 2AESA 3CKJA 3JUJA 4Y6UA 4LW3A 1NQIB 4HO8A 3E25A 4FREA 5DDTA 1VGZA 3OH2A 1XZ6A 5EJ1A 1OQMB 2PGVA 5AJPA 1MP5A 4C2SA 3CKVA 2RIZA 4Y7TA 2GGQA 3PKPA 1LZJA 1QGSA 4FROA 1R7YA 1WSZA 5FU0A 1ZJOA 2YC5A 3FOQA 3Q4SA 5C47A 1ZJ1A 2AM4A 1E5KA 3OH0A 1WT1A 1MP4A 4Y7FA 1H7LA 1VM8A 1V84A 4NAKA 1MP3A 1H5SA 2BO6A 1HJJA 1FR9A 5FTSA 2P73A 2Y7AA 2JCLA 4ASJA 1INJA 5CMFX 3T7NA 1O23B 1G2VA 2P6WA 2Z86A 1VGWA 4NANA 1R82A 2X5SA 2V0JA 2RJ9A 1GX4A 4M2AA 1JVGA 4M4KA 3I0IX 1WVCA 4B42A 3OH3A 4FRQA 1VZTA 1FRWA 4HOCA 1EYRA 4LW6A 3SXBA 2JCJA 5C4EA 1W57A 1H3MA 1K4VA 2VD4A 5C49A 5L6VA 4GBPA
chains in the Genus database with same CATH superfamily
3IOHA 4HG6A 3RSBA 2APCA 3PNNA 2X5ZA 5C1GA 2E8BA 2WEEA 4CJBA 5CQPA 1G3LA 5CMJA 3OH1A 1R81A 1INIA 1R7TA 5CQLX 1H5SB 2I5EA 2Y4MA 3R3IA 4FIXA 1GWWA 3EE5A 4MNDA 4EE3A 2VXLA 2FFVA 3JTJA 4JISA 2RJ7A 1ZDFA 3K8EA 3V0MA 2QGIA 4Y7VA 4Y63A 2Y4KA 2CU2A 3SXAA 2ZU7A 4ARWA 5AJNA 1G23A 3NGWA 4DE7A 3I0KA 3USRA 3D98A 1R7VA 1HV9A 2WVMA 4UEGA 1LL2A 3RMVA 5CMHA 2E3DA 4G3SA 1ZI1A 2FFUA 2ZU9A 4B2WA 5IFYA 2PA4A 1QGQA 4HO5A 1S4OA 1YP4A 3SX5A 2RITA 1NHEB 1VZXA 1EZIA 2WGZA 2RJ8A 1LL0A 4NALA 3U2UA 4B5BA 1NKHB 4KPXA 1YROB 2I7BA 3I0GA 1ZIZA 1H5SC 1ZCUA 1WT0A 2FYCB 2V0HA 1SS9A 5C36A 1JVDA 1H7GA 2RJ5A 5CQMX 2V0IA 3KIAA 5FU8A 2WE9A 1R7UA 4G3PA 1H7EA 1LL3A 1ZJPA 1FWYA 1G93A 4D0TA 1PZTA 5EJZA 1FXOA 1W55A 1R7XA 3CKQA 1FZWA 1JYKA 1QWJA 1G97A 3DUVA 1VPAA 1ZCTA 2X65A 1OMXA 4IRQA 4O6MA 2NXVA 5D92A 4KNXA 1ZHJA 3OKRA 1VH3A 4K6RA 1GQ9A 4FCEA 1FO9A 2RJ1A 5L6SA 3O3PA 4G87A 5D91A 2RJ0A 3I0CA 4KXOA 4HO3A 4XWIA 3V8ZA 2P72A 3CKNA 2ICYA 2VSIA 3DK5A 3V8YA 5HS2A 4Y7GA 4B2XA 4HO6A 1H5TB 3PKQA 3U0YA 1LZ7A 5FTVA 2JCOA 1H5RA 4DECA 1O0RA 2QKXA 2RJ6A 2VXMA 3I0LA 3V0QA 4AYLA 2MZBA 2Z87A 3V0OA 1PZYB 3SXGA 4EE5A 5FUHA 2XMEA 5C4BA 1ZJ0A 4B4GA 1ZI3A 4Y9XA 3LW6A 1LVWA 1HJLA 4Y64A 1IINA 4R7PA 5FYEA 4G3QA 4Y7UA 4MYBA 4EE4A 3V91A 1H7TA 3I0DA 3IOIA 4KQLA 4E1KA 4CJCA 4Q7CA 1H4DA 1TW5A 4FRAA 4O6NA 4M2BA 4KT7A 2QH5A 2VS5A 3RMWA 2BO4A 2OEFA 5C48A 2JCKA 2J0AA 1G1LA 4FRDA 2A8UA 1VICA 1ZCVA 4KRVA 4KC4A 1R80A 4EEGA 1O7QA 2WVLA 4KNRA 1H5RB 5J49A 4FRHA 4Y62A 1HM0A 5DDVA 5C1HA 1JV1A 1G8OA 2OEGA 1KWSA 2FYAA 1H4EA 2YQSA 3V90A 2O1FA 5FV9A 4HO9A 1GWVA 4D0ZA 3I0FA 1WT3A 5JQQA 2XWLA 3U2WA 3CGXA 1H7QA 2VSHA 4YS8A 4CJ8A 1ZCYA 5CMIA 3OH4A 2FYBA 1H5SD 4B4BA 4DDZA 5IDSA 2J0BA 3U2VA 4CVHA 1LZ0A 2D7IA 1ON8A 4B4MA 4FIYA 3N9WA 1LZIA 1OMZA 5CQOA 1ZJ2A 2D0JA 2YQHA 1I52A 1FGGA 2YCMA 1VGUA 1S4NA 3ZF8A 1G0RA 2V0LA 2OI5A 1HM9A 1HM8A 1V82A 2PGYA 1H5TA 1ZJ3A 3SX3A 1G9RA 4B3UA 5EIYA 2OI7A 2AM5A 2C0NA 1TW1A 3U2TA 2ICXA 5CQNX 3ZLKA 1YP3A 5I1FA 1TVYA 4MIXA 1ZI5A 4HCQA 1FR8A 2GGOA 4M28A 1XHBA 5AJOA 5CMGX 3POLA 2VS3A 2RJ4A 4P02A 4BMAA 1W77A 1H7FA 2X60A 4AAWA 4NAIA 1MC3A 1NF5B 3TQDA 2AGDA 3GUEA 3I0EA 3V0LA 4FRBA 4FRLA 2AE7A 2W0VA 2Y4JA 4J18A 4FRMA 5C4FA 3I0HA 3IOJA 1ZI4A 4ECMA 1FO8A 2RIYA 4EVWA 3SXCA 3U2XA 2YQCA 4ZDQA 3E26A 4FCUA 1VZUA 1FGXA 1GA8A 5C3DA 1H4CA 1FG5N 1GX0A 3BRKX 1JV3A 2XWNA 2Y4LA 3TZTA 2XMHA 2Q4JA 4EEOA 1IIMA 4KC2A 2DPWA 2W0WA 2FY7A 2AECA 3ZGGA 1S4PA 2FYDB 5BXCA 2YC3A 3SX8A 3U0XA 3R2WA 1FOAA 2I5KA 3T7MA 4HO2A 1VGTA 2RIXA 2V0KA 3K8DA 3D8VA 4JD0A 4P00A 5C38A 1FXJA 2YQJA 2UX8A 3I0JA 2WAWA 5C8RA 3DJ4A 4Y6NA 4D11C 3FWWA 4HO0A 4AC3A 5C4DA 2AH9A 1NWGB 2BO8A 1H7HA 4IRPA 5C3AA 3OAMA 5C4CA 3SXEA 4EEAA 4L41C 3F1YA 3Q7UA 4EEMA 3ZGFA 3SPTA 5C3BA 2O1HA 3OC9A 4KPZA 4AYJA 3JUKA 1YP2A 2OI6A 4ASYA 2PX7A 1Z90A 1ZDGA 1WT2A 4FRPA 3BCVA 4FQWA 3CKOA 3D5NA 2AM3A 1NMMB 2WVKA 3QVBA 1JYLA 5IDTA 4KC1A 2XWMA 2VS4A 4D48A 3HL3A 2D7RA 2A8WA 3ST8A 3SX7A 3V0PA 4D11A 3V0NA 4BQHA 4HO4A 2VFZA 2O1GA 2BO7A 3OGZA 3USQA 1G95A 1VH1A 3ZLLA 1GQCA 1ON6A 3SXDA 1O7OA 3F1CA 3T7OA 1QG8A 1TZFA 1V83A 2ZU8A 3Q80A 2YESA 2Y6PA 3CU0A 5C1LA 2AESA 3CKJA 3JUJA 4Y6UA 4LW3A 1NQIB 4HO8A 3E25A 4FREA 5DDTA 1VGZA 3OH2A 1XZ6A 5EJ1A 1OQMB 2PGVA 5AJPA 1MP5A 4C2SA 3CKVA 2RIZA 4Y7TA 2GGQA 3PKPA 1LZJA 1QGSA 4FROA 1R7YA 1WSZA 5FU0A 1ZJOA 2YC5A 3FOQA 3Q4SA 5C47A 1ZJ1A 2AM4A 1E5KA 3OH0A 1WT1A 1MP4A 4Y7FA 1H7LA 1VM8A 1V84A 4NAKA 1MP3A 1H5SA 2BO6A 1HJJA 1FR9A 2VK9A 5FTSA 2P73A 2Y7AA 2JCLA 4ASJA 1INJA 5CMFX 3T7NA 1O23B 1G2VA 2P6WA 2Z86A 1VGWA 4NANA 1R82A 2X5SA 2V0JA 2RJ9A 1GX4A 4M2AA 1JVGA 4M4KA 3I0IX 1WVCA 4B42A 3OH3A 4FRQA 1VZTA 1FRWA 4HOCA 1EYRA 4LW6A 3SXBA 2JCJA 5C4EA 1W57A 1H3MA 1K4VA 2VD4A 5C49A 5L6VA 4GBPA
chains in the Genus database with same CATH topology
3IOHA 4HG6A 3RSBA 2APCA 3PNNA 2X5ZA 5C1GA 2E8BA 2WEEA 4CJBA 5CQPA 1G3LA 5CMJA 3OH1A 1R81A 1INIA 1R7TA 5CQLX 1H5SB 2I5EA 2Y4MA 3R3IA 4FIXA 1GWWA 3EE5A 4MNDA 4EE3A 2VXLA 2FFVA 3JTJA 4JISA 2RJ7A 1ZDFA 3K8EA 3V0MA 2QGIA 4Y7VA 4Y63A 2Y4KA 2CU2A 3SXAA 2ZU7A 4ARWA 5AJNA 1G23A 3NGWA 4DE7A 3I0KA 3USRA 3D98A 1R7VA 1HV9A 2WVMA 4UEGA 1LL2A 3RMVA 5CMHA 2E3DA 4G3SA 1ZI1A 2FFUA 2ZU9A 4B2WA 5IFYA 2PA4A 1QGQA 4HO5A 1S4OA 1YP4A 3SX5A 2RITA 1NHEB 1VZXA 1EZIA 2WGZA 2RJ8A 1LL0A 4NALA 3U2UA 4B5BA 1NKHB 4KPXA 1YROB 2I7BA 3I0GA 1ZIZA 1H5SC 1ZCUA 1WT0A 2FYCB 2V0HA 1SS9A 5C36A 1JVDA 1H7GA 2RJ5A 5CQMX 2V0IA 3KIAA 5FU8A 2WE9A 1R7UA 4G3PA 1H7EA 1LL3A 1ZJPA 1FWYA 1G93A 4D0TA 1PZTA 5EJZA 1FXOA 1W55A 1R7XA 3CKQA 1FZWA 1JYKA 1QWJA 1G97A 3DUVA 1VPAA 1ZCTA 2X65A 1OMXA 4IRQA 4O6MA 2NXVA 5D92A 4KNXA 1ZHJA 3OKRA 1VH3A 4K6RA 1GQ9A 4FCEA 1FO9A 2RJ1A 5L6SA 3O3PA 4G87A 5D91A 2RJ0A 3I0CA 4KXOA 4HO3A 4XWIA 3V8ZA 2P72A 3CKNA 2ICYA 2VSIA 3DK5A 3V8YA 5HS2A 4Y7GA 4B2XA 4HO6A 1H5TB 3PKQA 3U0YA 1LZ7A 5FTVA 2JCOA 1H5RA 4DECA 1O0RA 2QKXA 2RJ6A 2VXMA 3I0LA 3V0QA 4AYLA 2MZBA 2Z87A 3V0OA 1PZYB 3SXGA 4EE5A 5FUHA 2XMEA 5C4BA 1ZJ0A 4B4GA 1ZI3A 4Y9XA 3LW6A 1LVWA 1HJLA 4Y64A 1IINA 4R7PA 5FYEA 4G3QA 4Y7UA 4MYBA 4EE4A 3V91A 1H7TA 3I0DA 3IOIA 4KQLA 4E1KA 4CJCA 4Q7CA 1H4DA 1TW5A 4FRAA 4O6NA 4M2BA 4KT7A 2QH5A 2VS5A 3RMWA 2BO4A 2OEFA 5C48A 2JCKA 2J0AA 1G1LA 4FRDA 2A8UA 1VICA 1ZCVA 4KRVA 4KC4A 1R80A 4EEGA 1O7QA 2WVLA 4KNRA 1H5RB 5J49A 4FRHA 4Y62A 1HM0A 5DDVA 5C1HA 1JV1A 1G8OA 2OEGA 1KWSA 2FYAA 1H4EA 2YQSA 3V90A 2O1FA 5FV9A 4HO9A 1GWVA 4D0ZA 3I0FA 1WT3A 5JQQA 2XWLA 3U2WA 3CGXA 1H7QA 2VSHA 4YS8A 4CJ8A 1ZCYA 5CMIA 3OH4A 2FYBA 1H5SD 4B4BA 4DDZA 5IDSA 2J0BA 3U2VA 4CVHA 1LZ0A 2D7IA 1ON8A 4B4MA 4FIYA 3N9WA 1LZIA 1OMZA 5CQOA 1ZJ2A 2D0JA 2YQHA 1I52A 1FGGA 2YCMA 1VGUA 1S4NA 3ZF8A 1G0RA 2V0LA 2OI5A 1HM9A 1HM8A 1V82A 2PGYA 1H5TA 1ZJ3A 3SX3A 1G9RA 4B3UA 5EIYA 2OI7A 2AM5A 2C0NA 1TW1A 3U2TA 2ICXA 5CQNX 3ZLKA 1YP3A 5I1FA 1TVYA 4MIXA 1ZI5A 4HCQA 1FR8A 2GGOA 4M28A 1XHBA 5AJOA 5CMGX 3POLA 2VS3A 2RJ4A 4P02A 4BMAA 1W77A 1H7FA 2X60A 4AAWA 4NAIA 1MC3A 1NF5B 3TQDA 2AGDA 3GUEA 3I0EA 3V0LA 4FRBA 4FRLA 2AE7A 2W0VA 2Y4JA 4J18A 4FRMA 5C4FA 3I0HA 3IOJA 1ZI4A 4ECMA 1FO8A 2RIYA 4EVWA 3SXCA 3U2XA 2YQCA 4ZDQA 3E26A 4FCUA 1VZUA 1FGXA 1GA8A 5C3DA 1H4CA 1FG5N 1GX0A 3BRKX 1JV3A 2XWNA 2Y4LA 3TZTA 2XMHA 2Q4JA 4EEOA 1IIMA 4KC2A 2DPWA 2W0WA 2FY7A 2AECA 3ZGGA 1S4PA 2FYDB 5BXCA 2YC3A 3SX8A 3U0XA 3R2WA 1FOAA 2I5KA 3T7MA 4HO2A 1VGTA 2RIXA 2V0KA 3K8DA 3D8VA 4JD0A 4P00A 5C38A 1FXJA 2YQJA 2UX8A 3I0JA 2WAWA 5C8RA 3DJ4A 4Y6NA 4D11C 3FWWA 4HO0A 4AC3A 5C4DA 2AH9A 1NWGB 2BO8A 1H7HA 4IRPA 5C3AA 3OAMA 5C4CA 3SXEA 4EEAA 4L41C 3F1YA 3Q7UA 4EEMA 3ZGFA 3SPTA 5C3BA 2O1HA 3OC9A 4KPZA 4AYJA 3JUKA 1YP2A 2OI6A 4ASYA 2PX7A 1Z90A 1ZDGA 1WT2A 4FRPA 3BCVA 4FQWA 3CKOA 3D5NA 2AM3A 1NMMB 2WVKA 3QVBA 1JYLA 5IDTA 4KC1A 2XWMA 2VS4A 4D48A 3HL3A 2D7RA 2A8WA 3ST8A 3SX7A 3V0PA 4D11A 3V0NA 4BQHA 4HO4A 2VFZA 2O1GA 2BO7A 3OGZA 3USQA 1G95A 1VH1A 3ZLLA 1GQCA 1ON6A 3SXDA 1O7OA 3F1CA 3T7OA 1QG8A 1TZFA 1V83A 2ZU8A 3Q80A 2YESA 2Y6PA 3CU0A 5C1LA 2AESA 3CKJA 3JUJA 4Y6UA 4LW3A 1NQIB 4HO8A 3E25A 4FREA 5DDTA 1VGZA 3OH2A 1XZ6A 5EJ1A 1OQMB 2PGVA 5AJPA 1MP5A 4C2SA 3CKVA 2RIZA 4Y7TA 2GGQA 3PKPA 1LZJA 1QGSA 4FROA 1R7YA 1WSZA 5FU0A 1ZJOA 2YC5A 3FOQA 3Q4SA 5C47A 1ZJ1A 2AM4A 1E5KA 3OH0A 1WT1A 1MP4A 4Y7FA 1H7LA 1VM8A 1V84A 4NAKA 1MP3A 1H5SA 2BO6A 1HJJA 1FR9A 2VK9A 5FTSA 2P73A 2Y7AA 2JCLA 4ASJA 1INJA 5CMFX 3T7NA 1O23B 1G2VA 2P6WA 2Z86A 1VGWA 4NANA 1R82A 2X5SA 2V0JA 2RJ9A 1GX4A 4M2AA 1JVGA 4M4KA 3I0IX 1WVCA 4B42A 3OH3A 4FRQA 1VZTA 1FRWA 4HOCA 1EYRA 4LW6A 3SXBA 2JCJA 5C4EA 1W57A 1H3MA 1K4VA 2VD4A 5C49A 5L6VA 4GBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOH A;  4HG6 A;  3RSB A;  2APC A;  3PNN A;  2X5Z A;  5C1G A;  2E8B A;  2WEE A;  4CJB A;  5CQP A;  1G3L A;  5CMJ A;  3OH1 A;  1R81 A;  1INI A;  1R7T A;  5CQL X;  1H5S B;  2I5E A;  2Y4M A;  3R3I A;  4MND A;  1GWW A;  3EE5 A;  4EE3 A;  2VXL A;  2FFV A;  3JTJ A;  4JIS A;  2RJ7 A;  1ZDF A;  3K8E A;  3V0M A;  2QGI A;  4Y7V A;  4Y63 A;  2Y4K A;  2CU2 A;  3SXA A;  2ZU7 A;  4ARW A;  5AJN A;  1G23 A;  3NGW A;  4DE7 A;  3I0K A;  3USR A;  3D98 A;  1R7V A;  1HV9 A;  2WVM A;  4UEG A;  1LL2 A;  3RMV A;  5CMH A;  2E3D A;  4G3S A;  1ZI1 A;  2FFU A;  2ZU9 A;  4B2W A;  5IFY A;  2PA4 A;  1QGQ A;  4HO5 A;  1S4O A;  1YP4 A;  3SX5 A;  2RIT A;  1NHE B;  1VZX A;  1EZI A;  2WGZ A;  2RJ8 A;  1LL0 A;  4NAL A;  3U2U A;  4B5B A;  1NKH B;  4KPX A;  1YRO B;  2I7B A;  3I0G A;  1ZIZ A;  1H5S C;  1ZCU A;  1WT0 A;  2FYC B;  2V0H A;  1SS9 A;  5C36 A;  1JVD A;  1H7G A;  2RJ5 A;  5CQM X;  2V0I A;  3KIA A;  5FU8 A;  2WE9 A;  1R7U A;  4G3P A;  1H7E A;  1LL3 A;  1ZJP A;  1FWY A;  1G93 A;  4D0T A;  1PZT A;  5EJZ A;  1FXO A;  1W55 A;  1R7X A;  3CKQ A;  1FZW A;  1JYK A;  1QWJ A;  1G97 A;  3DUV A;  1VPA A;  1ZCT A;  2X65 A;  1OMX A;  4IRQ A;  2NXV A;  4KNX A;  1ZHJ A;  3OKR A;  1VH3 A;  4K6R A;  1GQ9 A;  4FCE A;  1FO9 A;  2RJ1 A;  5L6S A;  3O3P A;  4G87 A;  2RJ0 A;  3I0C A;  4KXO A;  4HO3 A;  4XWI A;  3V8Z A;  2P72 A;  3CKN A;  2ICY A;  2VSI A;  3DK5 A;  3V8Y A;  5HS2 A;  4Y7G A;  4B2X A;  4HO6 A;  1H5T B;  3PKQ A;  3U0Y A;  1LZ7 A;  5FTV A;  2JCO A;  1H5R A;  4DEC A;  1O0R A;  2QKX A;  2RJ6 A;  2VXM A;  3I0L A;  3V0Q A;  4AYL A;  2MZB A;  2Z87 A;  3V0O A;  1PZY B;  3SXG A;  4EE5 A;  5FUH A;  2XME A;  5C4B A;  1ZJ0 A;  4B4G A;  1ZI3 A;  4Y9X A;  3LW6 A;  1LVW A;  1HJL A;  4Y64 A;  1IIN A;  4R7P A;  5FYE A;  4G3Q A;  4Y7U A;  4MYB A;  4EE4 A;  3V91 A;  1H7T A;  3I0D A;  3IOI A;  4KQL A;  4E1K A;  4CJC A;  1H4D A;  1TW5 A;  4FRA A;  4M2B A;  4KT7 A;  2QH5 A;  2VS5 A;  3RMW A;  2BO4 A;  2OEF A;  5C48 A;  2JCK A;  1G1L A;  4FRD A;  2A8U A;  1VIC A;  1ZCV A;  4KRV A;  4KC4 A;  1R80 A;  4EEG A;  1O7Q A;  2WVL A;  4KNR A;  1H5R B;  5J49 A;  4FRH A;  4Y62 A;  1HM0 A;  5DDV A;  5C1H A;  1JV1 A;  1G8O A;  2OEG A;  1KWS A;  2FYA A;  1H4E A;  2YQS A;  3V90 A;  2O1F A;  5FV9 A;  4HO9 A;  1GWV A;  4D0Z A;  3I0F A;  1WT3 A;  5JQQ A;  2XWL A;  3U2W A;  3CGX A;  1H7Q A;  2VSH A;  4YS8 A;  4CJ8 A;  1ZCY A;  5CMI A;  3OH4 A;  2FYB A;  1H5S D;  4B4B A;  4DDZ A;  5IDS A;  3U2V A;  4CVH A;  1LZ0 A;  2D7I A;  1ON8 A;  4B4M A;  3N9W A;  1LZI A;  1OMZ A;  5CQO A;  1ZJ2 A;  2D0J A;  2YQH A;  1I52 A;  1FGG A;  2YCM A;  1VGU A;  1S4N A;  3ZF8 A;  1G0R A;  2V0L A;  2OI5 A;  1HM9 A;  1HM8 A;  1V82 A;  2PGY A;  1H5T A;  1ZJ3 A;  3SX3 A;  1G9R A;  4B3U A;  5EIY A;  2OI7 A;  2AM5 A;  1TW1 A;  3U2T A;  2ICX A;  5CQN X;  3ZLK A;  1YP3 A;  5I1F A;  1TVY A;  1ZI5 A;  4HCQ A;  1FR8 A;  2GGO A;  4M28 A;  1XHB A;  5AJO A;  5CMG X;  3POL A;  2VS3 A;  2RJ4 A;  4P02 A;  4BMA A;  1W77 A;  1H7F A;  2X60 A;  4AAW A;  4NAI A;  1MC3 A;  1NF5 B;  3TQD A;  2AGD A;  3GUE A;  3I0E A;  3V0L A;  4FRB A;  4FRL A;  2AE7 A;  2W0V A;  2Y4J A;  4J18 A;  4FRM A;  5C4F A;  3I0H A;  3IOJ A;  1ZI4 A;  4ECM A;  1FO8 A;  2RIY A;  4EVW A;  3SXC A;  3U2X A;  2YQC A;  4ZDQ A;  3E26 A;  4FCU A;  1VZU A;  1FGX A;  1GA8 A;  5C3D A;  1H4C A;  1FG5 N;  1GX0 A;  3BRK X;  1JV3 A;  2XWN A;  2Y4L A;  3TZT A;  2XMH A;  2Q4J A;  4EEO A;  1IIM A;  4KC2 A;  2DPW A;  2W0W A;  2FY7 A;  2AEC A;  3ZGG A;  1S4P A;  2FYD B;  5BXC A;  2YC3 A;  3SX8 A;  3U0X A;  3R2W A;  1FOA A;  2I5K A;  3T7M A;  4HO2 A;  1VGT A;  2RIX A;  2V0K A;  3K8D A;  3D8V A;  4JD0 A;  4P00 A;  5C38 A;  1FXJ A;  2YQJ A;  2UX8 A;  3I0J A;  2WAW A;  5C8R A;  3DJ4 A;  4Y6N A;  4D11 C;  3FWW A;  4HO0 A;  4AC3 A;  5C4D A;  2AH9 A;  1NWG B;  2BO8 A;  1H7H A;  4IRP A;  5C3A A;  3OAM A;  5C4C A;  3SXE A;  4EEA A;  4L41 C;  3F1Y A;  3Q7U A;  4EEM A;  3ZGF A;  3SPT A;  5C3B A;  2O1H A;  3OC9 A;  4KPZ A;  4AYJ A;  3JUK A;  1YP2 A;  2OI6 A;  4ASY A;  2PX7 A;  1Z90 A;  1ZDG A;  1WT2 A;  4FRP A;  3BCV A;  4FQW A;  3CKO A;  3D5N A;  2AM3 A;  1NMM B;  2WVK A;  3QVB A;  1JYL A;  5IDT A;  4KC1 A;  2XWM A;  2VS4 A;  4D48 A;  3HL3 A;  2D7R A;  2A8W A;  3ST8 A;  3SX7 A;  3V0P A;  4D11 A;  3V0N A;  4BQH A;  4HO4 A;  2VFZ A;  2O1G A;  2BO7 A;  3OGZ A;  3USQ A;  1G95 A;  1VH1 A;  3ZLL A;  1GQC A;  1ON6 A;  3SXD A;  1O7O A;  3F1C A;  3T7O A;  1QG8 A;  1TZF A;  1V83 A;  2ZU8 A;  3Q80 A;  2YES A;  2Y6P A;  3CU0 A;  5C1L A;  2AES A;  3CKJ A;  3JUJ A;  4Y6U A;  4LW3 A;  1NQI B;  4HO8 A;  3E25 A;  4FRE A;  5DDT A;  1VGZ A;  3OH2 A;  1XZ6 A;  5EJ1 A;  1OQM B;  2PGV A;  5AJP A;  1MP5 A;  4C2S A;  3CKV A;  2RIZ A;  4Y7T A;  2GGQ A;  3PKP A;  1LZJ A;  1QGS A;  4FRO A;  1R7Y A;  1WSZ A;  5FU0 A;  1ZJO A;  2YC5 A;  3FOQ A;  3Q4S A;  5C47 A;  1ZJ1 A;  2AM4 A;  1E5K A;  3OH0 A;  1WT1 A;  1MP4 A;  4Y7F A;  1H7L A;  1VM8 A;  1V84 A;  4NAK A;  1MP3 A;  1H5S A;  2BO6 A;  1HJJ A;  1FR9 A;  5FTS A;  2P73 A;  2Y7A A;  2JCL A;  4ASJ A;  1INJ A;  5CMF X;  3T7N A;  1O23 B;  1G2V A;  2P6W A;  2Z86 A;  1VGW A;  4NAN A;  1R82 A;  2X5S A;  2V0J A;  2RJ9 A;  1GX4 A;  4M2A A;  1JVG A;  4M4K A;  3I0I X;  1WVC A;  4B42 A;  3OH3 A;  4FRQ A;  1VZT A;  1FRW A;  4HOC A;  1EYR A;  4LW6 A;  3SXB A;  2JCJ A;  5C4E A;  1W57 A;  1H3M A;  1K4V A;  2VD4 A;  5C49 A;  5L6V A;  4GBP A; 
#chains in the Genus database with same CATH topology
 3IOH A;  4HG6 A;  3RSB A;  2APC A;  3PNN A;  2X5Z A;  5C1G A;  2E8B A;  2WEE A;  4CJB A;  5CQP A;  1G3L A;  5CMJ A;  3OH1 A;  1R81 A;  1INI A;  1R7T A;  5CQL X;  1H5S B;  2I5E A;  2Y4M A;  3R3I A;  4FIX A;  1GWW A;  3EE5 A;  4MND A;  4EE3 A;  2VXL A;  2FFV A;  3JTJ A;  4JIS A;  2RJ7 A;  1ZDF A;  3K8E A;  3V0M A;  2QGI A;  4Y7V A;  4Y63 A;  2Y4K A;  2CU2 A;  3SXA A;  2ZU7 A;  4ARW A;  5AJN A;  1G23 A;  3NGW A;  4DE7 A;  3I0K A;  3USR A;  3D98 A;  1R7V A;  1HV9 A;  2WVM A;  4UEG A;  1LL2 A;  3RMV A;  5CMH A;  2E3D A;  4G3S A;  1ZI1 A;  2FFU A;  2ZU9 A;  4B2W A;  5IFY A;  2PA4 A;  1QGQ A;  4HO5 A;  1S4O A;  1YP4 A;  3SX5 A;  2RIT A;  1NHE B;  1VZX A;  1EZI A;  2WGZ A;  2RJ8 A;  1LL0 A;  4NAL A;  3U2U A;  4B5B A;  1NKH B;  4KPX A;  1YRO B;  2I7B A;  3I0G A;  1ZIZ A;  1H5S C;  1ZCU A;  1WT0 A;  2FYC B;  2V0H A;  1SS9 A;  5C36 A;  1JVD A;  1H7G A;  2RJ5 A;  5CQM X;  2V0I A;  3KIA A;  5FU8 A;  2WE9 A;  1R7U A;  4G3P A;  1H7E A;  1LL3 A;  1ZJP A;  1FWY A;  1G93 A;  4D0T A;  1PZT A;  5EJZ A;  1FXO A;  1W55 A;  1R7X A;  3CKQ A;  1FZW A;  1JYK A;  1QWJ A;  1G97 A;  3DUV A;  1VPA A;  1ZCT A;  2X65 A;  1OMX A;  4IRQ A;  4O6M A;  2NXV A;  5D92 A;  4KNX A;  1ZHJ A;  3OKR A;  1VH3 A;  4K6R A;  1GQ9 A;  4FCE A;  1FO9 A;  2RJ1 A;  5L6S A;  3O3P A;  4G87 A;  5D91 A;  2RJ0 A;  3I0C A;  4KXO A;  4HO3 A;  4XWI A;  3V8Z A;  2P72 A;  3CKN A;  2ICY A;  2VSI A;  3DK5 A;  3V8Y A;  5HS2 A;  4Y7G A;  4B2X A;  4HO6 A;  1H5T B;  3PKQ A;  3U0Y A;  1LZ7 A;  5FTV A;  2JCO A;  1H5R A;  4DEC A;  1O0R A;  2QKX A;  2RJ6 A;  2VXM A;  3I0L A;  3V0Q A;  4AYL A;  2MZB A;  2Z87 A;  3V0O A;  1PZY B;  3SXG A;  4EE5 A;  5FUH A;  2XME A;  5C4B A;  1ZJ0 A;  4B4G A;  1ZI3 A;  4Y9X A;  3LW6 A;  1LVW A;  1HJL A;  4Y64 A;  1IIN A;  4R7P A;  5FYE A;  4G3Q A;  4Y7U A;  4MYB A;  4EE4 A;  3V91 A;  1H7T A;  3I0D A;  3IOI A;  4KQL A;  4E1K A;  4CJC A;  4Q7C A;  1H4D A;  1TW5 A;  4FRA A;  4O6N A;  4M2B A;  4KT7 A;  2QH5 A;  2VS5 A;  3RMW A;  2BO4 A;  2OEF A;  5C48 A;  2JCK A;  2J0A A;  1G1L A;  4FRD A;  2A8U A;  1VIC A;  1ZCV A;  4KRV A;  4KC4 A;  1R80 A;  4EEG A;  1O7Q A;  2WVL A;  4KNR A;  1H5R B;  5J49 A;  4FRH A;  4Y62 A;  1HM0 A;  5DDV A;  5C1H A;  1JV1 A;  1G8O A;  2OEG A;  1KWS A;  2FYA A;  1H4E A;  2YQS A;  3V90 A;  2O1F A;  5FV9 A;  4HO9 A;  1GWV A;  4D0Z A;  3I0F A;  1WT3 A;  5JQQ A;  2XWL A;  3U2W A;  3CGX A;  1H7Q A;  2VSH A;  4YS8 A;  4CJ8 A;  1ZCY A;  5CMI A;  3OH4 A;  2FYB A;  1H5S D;  4B4B A;  4DDZ A;  5IDS A;  2J0B A;  3U2V A;  4CVH A;  1LZ0 A;  2D7I A;  1ON8 A;  4B4M A;  4FIY A;  3N9W A;  1LZI A;  1OMZ A;  5CQO A;  1ZJ2 A;  2D0J A;  2YQH A;  1I52 A;  1FGG A;  2YCM A;  1VGU A;  1S4N A;  3ZF8 A;  1G0R A;  2V0L A;  2OI5 A;  1HM9 A;  1HM8 A;  1V82 A;  2PGY A;  1H5T A;  1ZJ3 A;  3SX3 A;  1G9R A;  4B3U A;  5EIY A;  2OI7 A;  2AM5 A;  2C0N A;  1TW1 A;  3U2T A;  2ICX A;  5CQN X;  3ZLK A;  1YP3 A;  5I1F A;  1TVY A;  4MIX A;  1ZI5 A;  4HCQ A;  1FR8 A;  2GGO A;  4M28 A;  1XHB A;  5AJO A;  5CMG X;  3POL A;  2VS3 A;  2RJ4 A;  4P02 A;  4BMA A;  1W77 A;  1H7F A;  2X60 A;  4AAW A;  4NAI A;  1MC3 A;  1NF5 B;  3TQD A;  2AGD A;  3GUE A;  3I0E A;  3V0L A;  4FRB A;  4FRL A;  2AE7 A;  2W0V A;  2Y4J A;  4J18 A;  4FRM A;  5C4F A;  3I0H A;  3IOJ A;  1ZI4 A;  4ECM A;  1FO8 A;  2RIY A;  4EVW A;  3SXC A;  3U2X A;  2YQC A;  4ZDQ A;  3E26 A;  4FCU A;  1VZU A;  1FGX A;  1GA8 A;  5C3D A;  1H4C A;  1FG5 N;  1GX0 A;  3BRK X;  1JV3 A;  2XWN A;  2Y4L A;  3TZT A;  2XMH A;  2Q4J A;  4EEO A;  1IIM A;  4KC2 A;  2DPW A;  2W0W A;  2FY7 A;  2AEC A;  3ZGG A;  1S4P A;  2FYD B;  5BXC A;  2YC3 A;  3SX8 A;  3U0X A;  3R2W A;  1FOA A;  2I5K A;  3T7M A;  4HO2 A;  1VGT A;  2RIX A;  2V0K A;  3K8D A;  3D8V A;  4JD0 A;  4P00 A;  5C38 A;  1FXJ A;  2YQJ A;  2UX8 A;  3I0J A;  2WAW A;  5C8R A;  3DJ4 A;  4Y6N A;  4D11 C;  3FWW A;  4HO0 A;  4AC3 A;  5C4D A;  2AH9 A;  1NWG B;  2BO8 A;  1H7H A;  4IRP A;  5C3A A;  3OAM A;  5C4C A;  3SXE A;  4EEA A;  4L41 C;  3F1Y A;  3Q7U A;  4EEM A;  3ZGF A;  3SPT A;  5C3B A;  2O1H A;  3OC9 A;  4KPZ A;  4AYJ A;  3JUK A;  1YP2 A;  2OI6 A;  4ASY A;  2PX7 A;  1Z90 A;  1ZDG A;  1WT2 A;  4FRP A;  3BCV A;  4FQW A;  3CKO A;  3D5N A;  2AM3 A;  1NMM B;  2WVK A;  3QVB A;  1JYL A;  5IDT A;  4KC1 A;  2XWM A;  2VS4 A;  4D48 A;  3HL3 A;  2D7R A;  2A8W A;  3ST8 A;  3SX7 A;  3V0P A;  4D11 A;  3V0N A;  4BQH A;  4HO4 A;  2VFZ A;  2O1G A;  2BO7 A;  3OGZ A;  3USQ A;  1G95 A;  1VH1 A;  3ZLL A;  1GQC A;  1ON6 A;  3SXD A;  1O7O A;  3F1C A;  3T7O A;  1QG8 A;  1TZF A;  1V83 A;  2ZU8 A;  3Q80 A;  2YES A;  2Y6P A;  3CU0 A;  5C1L A;  2AES A;  3CKJ A;  3JUJ A;  4Y6U A;  4LW3 A;  1NQI B;  4HO8 A;  3E25 A;  4FRE A;  5DDT A;  1VGZ A;  3OH2 A;  1XZ6 A;  5EJ1 A;  1OQM B;  2PGV A;  5AJP A;  1MP5 A;  4C2S A;  3CKV A;  2RIZ A;  4Y7T A;  2GGQ A;  3PKP A;  1LZJ A;  1QGS A;  4FRO A;  1R7Y A;  1WSZ A;  5FU0 A;  1ZJO A;  2YC5 A;  3FOQ A;  3Q4S A;  5C47 A;  1ZJ1 A;  2AM4 A;  1E5K A;  3OH0 A;  1WT1 A;  1MP4 A;  4Y7F A;  1H7L A;  1VM8 A;  1V84 A;  4NAK A;  1MP3 A;  1H5S A;  2BO6 A;  1HJJ A;  1FR9 A;  2VK9 A;  5FTS A;  2P73 A;  2Y7A A;  2JCL A;  4ASJ A;  1INJ A;  5CMF X;  3T7N A;  1O23 B;  1G2V A;  2P6W A;  2Z86 A;  1VGW A;  4NAN A;  1R82 A;  2X5S A;  2V0J A;  2RJ9 A;  1GX4 A;  4M2A A;  1JVG A;  4M4K A;  3I0I X;  1WVC A;  4B42 A;  3OH3 A;  4FRQ A;  1VZT A;  1FRW A;  4HOC A;  1EYR A;  4LW6 A;  3SXB A;  2JCJ A;  5C4E A;  1W57 A;  1H3M A;  1K4V A;  2VD4 A;  5C49 A;  5L6V A;  4GBP A; 
#chains in the Genus database with same CATH homology
 3IOH A;  4HG6 A;  3RSB A;  2APC A;  3PNN A;  2X5Z A;  5C1G A;  2E8B A;  2WEE A;  4CJB A;  5CQP A;  1G3L A;  5CMJ A;  3OH1 A;  1R81 A;  1INI A;  1R7T A;  5CQL X;  1H5S B;  2I5E A;  2Y4M A;  3R3I A;  4FIX A;  1GWW A;  3EE5 A;  4MND A;  4EE3 A;  2VXL A;  2FFV A;  3JTJ A;  4JIS A;  2RJ7 A;  1ZDF A;  3K8E A;  3V0M A;  2QGI A;  4Y7V A;  4Y63 A;  2Y4K A;  2CU2 A;  3SXA A;  2ZU7 A;  4ARW A;  5AJN A;  1G23 A;  3NGW A;  4DE7 A;  3I0K A;  3USR A;  3D98 A;  1R7V A;  1HV9 A;  2WVM A;  4UEG A;  1LL2 A;  3RMV A;  5CMH A;  2E3D A;  4G3S A;  1ZI1 A;  2FFU A;  2ZU9 A;  4B2W A;  5IFY A;  2PA4 A;  1QGQ A;  4HO5 A;  1S4O A;  1YP4 A;  3SX5 A;  2RIT A;  1NHE B;  1VZX A;  1EZI A;  2WGZ A;  2RJ8 A;  1LL0 A;  4NAL A;  3U2U A;  4B5B A;  1NKH B;  4KPX A;  1YRO B;  2I7B A;  3I0G A;  1ZIZ A;  1H5S C;  1ZCU A;  1WT0 A;  2FYC B;  2V0H A;  1SS9 A;  5C36 A;  1JVD A;  1H7G A;  2RJ5 A;  5CQM X;  2V0I A;  3KIA A;  5FU8 A;  2WE9 A;  1R7U A;  4G3P A;  1H7E A;  1LL3 A;  1ZJP A;  1FWY A;  1G93 A;  4D0T A;  1PZT A;  5EJZ A;  1FXO A;  1W55 A;  1R7X A;  3CKQ A;  1FZW A;  1JYK A;  1QWJ A;  1G97 A;  3DUV A;  1VPA A;  1ZCT A;  2X65 A;  1OMX A;  4IRQ A;  4O6M A;  2NXV A;  5D92 A;  4KNX A;  1ZHJ A;  3OKR A;  1VH3 A;  4K6R A;  1GQ9 A;  4FCE A;  1FO9 A;  2RJ1 A;  5L6S A;  3O3P A;  4G87 A;  5D91 A;  2RJ0 A;  3I0C A;  4KXO A;  4HO3 A;  4XWI A;  3V8Z A;  2P72 A;  3CKN A;  2ICY A;  2VSI A;  3DK5 A;  3V8Y A;  5HS2 A;  4Y7G A;  4B2X A;  4HO6 A;  1H5T B;  3PKQ A;  3U0Y A;  1LZ7 A;  5FTV A;  2JCO A;  1H5R A;  4DEC A;  1O0R A;  2QKX A;  2RJ6 A;  2VXM A;  3I0L A;  3V0Q A;  4AYL A;  2MZB A;  2Z87 A;  3V0O A;  1PZY B;  3SXG A;  4EE5 A;  5FUH A;  2XME A;  5C4B A;  1ZJ0 A;  4B4G A;  1ZI3 A;  4Y9X A;  3LW6 A;  1LVW A;  1HJL A;  4Y64 A;  1IIN A;  4R7P A;  5FYE A;  4G3Q A;  4Y7U A;  4MYB A;  4EE4 A;  3V91 A;  1H7T A;  3I0D A;  3IOI A;  4KQL A;  4E1K A;  4CJC A;  4Q7C A;  1H4D A;  1TW5 A;  4FRA A;  4O6N A;  4M2B A;  4KT7 A;  2QH5 A;  2VS5 A;  3RMW A;  2BO4 A;  2OEF A;  5C48 A;  2JCK A;  2J0A A;  1G1L A;  4FRD A;  2A8U A;  1VIC A;  1ZCV A;  4KRV A;  4KC4 A;  1R80 A;  4EEG A;  1O7Q A;  2WVL A;  4KNR A;  1H5R B;  5J49 A;  4FRH A;  4Y62 A;  1HM0 A;  5DDV A;  5C1H A;  1JV1 A;  1G8O A;  2OEG A;  1KWS A;  2FYA A;  1H4E A;  2YQS A;  3V90 A;  2O1F A;  5FV9 A;  4HO9 A;  1GWV A;  4D0Z A;  3I0F A;  1WT3 A;  5JQQ A;  2XWL A;  3U2W A;  3CGX A;  1H7Q A;  2VSH A;  4YS8 A;  4CJ8 A;  1ZCY A;  5CMI A;  3OH4 A;  2FYB A;  1H5S D;  4B4B A;  4DDZ A;  5IDS A;  2J0B A;  3U2V A;  4CVH A;  1LZ0 A;  2D7I A;  1ON8 A;  4B4M A;  4FIY A;  3N9W A;  1LZI A;  1OMZ A;  5CQO A;  1ZJ2 A;  2D0J A;  2YQH A;  1I52 A;  1FGG A;  2YCM A;  1VGU A;  1S4N A;  3ZF8 A;  1G0R A;  2V0L A;  2OI5 A;  1HM9 A;  1HM8 A;  1V82 A;  2PGY A;  1H5T A;  1ZJ3 A;  3SX3 A;  1G9R A;  4B3U A;  5EIY A;  2OI7 A;  2AM5 A;  2C0N A;  1TW1 A;  3U2T A;  2ICX A;  5CQN X;  3ZLK A;  1YP3 A;  5I1F A;  1TVY A;  4MIX A;  1ZI5 A;  4HCQ A;  1FR8 A;  2GGO A;  4M28 A;  1XHB A;  5AJO A;  5CMG X;  3POL A;  2VS3 A;  2RJ4 A;  4P02 A;  4BMA A;  1W77 A;  1H7F A;  2X60 A;  4AAW A;  4NAI A;  1MC3 A;  1NF5 B;  3TQD A;  2AGD A;  3GUE A;  3I0E A;  3V0L A;  4FRB A;  4FRL A;  2AE7 A;  2W0V A;  2Y4J A;  4J18 A;  4FRM A;  5C4F A;  3I0H A;  3IOJ A;  1ZI4 A;  4ECM A;  1FO8 A;  2RIY A;  4EVW A;  3SXC A;  3U2X A;  2YQC A;  4ZDQ A;  3E26 A;  4FCU A;  1VZU A;  1FGX A;  1GA8 A;  5C3D A;  1H4C A;  1FG5 N;  1GX0 A;  3BRK X;  1JV3 A;  2XWN A;  2Y4L A;  3TZT A;  2XMH A;  2Q4J A;  4EEO A;  1IIM A;  4KC2 A;  2DPW A;  2W0W A;  2FY7 A;  2AEC A;  3ZGG A;  1S4P A;  2FYD B;  5BXC A;  2YC3 A;  3SX8 A;  3U0X A;  3R2W A;  1FOA A;  2I5K A;  3T7M A;  4HO2 A;  1VGT A;  2RIX A;  2V0K A;  3K8D A;  3D8V A;  4JD0 A;  4P00 A;  5C38 A;  1FXJ A;  2YQJ A;  2UX8 A;  3I0J A;  2WAW A;  5C8R A;  3DJ4 A;  4Y6N A;  4D11 C;  3FWW A;  4HO0 A;  4AC3 A;  5C4D A;  2AH9 A;  1NWG B;  2BO8 A;  1H7H A;  4IRP A;  5C3A A;  3OAM A;  5C4C A;  3SXE A;  4EEA A;  4L41 C;  3F1Y A;  3Q7U A;  4EEM A;  3ZGF A;  3SPT A;  5C3B A;  2O1H A;  3OC9 A;  4KPZ A;  4AYJ A;  3JUK A;  1YP2 A;  2OI6 A;  4ASY A;  2PX7 A;  1Z90 A;  1ZDG A;  1WT2 A;  4FRP A;  3BCV A;  4FQW A;  3CKO A;  3D5N A;  2AM3 A;  1NMM B;  2WVK A;  3QVB A;  1JYL A;  5IDT A;  4KC1 A;  2XWM A;  2VS4 A;  4D48 A;  3HL3 A;  2D7R A;  2A8W A;  3ST8 A;  3SX7 A;  3V0P A;  4D11 A;  3V0N A;  4BQH A;  4HO4 A;  2VFZ A;  2O1G A;  2BO7 A;  3OGZ A;  3USQ A;  1G95 A;  1VH1 A;  3ZLL A;  1GQC A;  1ON6 A;  3SXD A;  1O7O A;  3F1C A;  3T7O A;  1QG8 A;  1TZF A;  1V83 A;  2ZU8 A;  3Q80 A;  2YES A;  2Y6P A;  3CU0 A;  5C1L A;  2AES A;  3CKJ A;  3JUJ A;  4Y6U A;  4LW3 A;  1NQI B;  4HO8 A;  3E25 A;  4FRE A;  5DDT A;  1VGZ A;  3OH2 A;  1XZ6 A;  5EJ1 A;  1OQM B;  2PGV A;  5AJP A;  1MP5 A;  4C2S A;  3CKV A;  2RIZ A;  4Y7T A;  2GGQ A;  3PKP A;  1LZJ A;  1QGS A;  4FRO A;  1R7Y A;  1WSZ A;  5FU0 A;  1ZJO A;  2YC5 A;  3FOQ A;  3Q4S A;  5C47 A;  1ZJ1 A;  2AM4 A;  1E5K A;  3OH0 A;  1WT1 A;  1MP4 A;  4Y7F A;  1H7L A;  1VM8 A;  1V84 A;  4NAK A;  1MP3 A;  1H5S A;  2BO6 A;  1HJJ A;  1FR9 A;  2VK9 A;  5FTS A;  2P73 A;  2Y7A A;  2JCL A;  4ASJ A;  1INJ A;  5CMF X;  3T7N A;  1O23 B;  1G2V A;  2P6W A;  2Z86 A;  1VGW A;  4NAN A;  1R82 A;  2X5S A;  2V0J A;  2RJ9 A;  1GX4 A;  4M2A A;  1JVG A;  4M4K A;  3I0I X;  1WVC A;  4B42 A;  3OH3 A;  4FRQ A;  1VZT A;  1FRW A;  4HOC A;  1EYR A;  4LW6 A;  3SXB A;  2JCJ A;  5C4E A;  1W57 A;  1H3M A;  1K4V A;  2VD4 A;  5C49 A;  5L6V A;  4GBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...