3Q7UA

Structure of mtb 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) complexed with ctp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
226
structure length
222
Chain Sequence
GEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLDEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase
publication title Crystal Structure of Mycobacterium tuberculosis 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD): a candidate antitubercular drug target
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 62
structure length 222
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3q7uA00
1G9RA 1NQIB 2P6WA 3KIAA 4MNDA 5C8RA 3T7MA 4KPXA 1YP2A 2E3DA 2WVMA 4KC4A 5FTSA 5IDSA 3Q7UA 2YQHA 1VGWA 3EE5A 1G97A 3V0MA 1H5RB 4B4BA 1VZXA 4M2AA 1GX4A 4HG6A 3IOHA 2Y4KA 2Y4MA 3D98A 2YC5A 1G95A 3U2XA 4KC2A 4NANA 1OQMB 4AYLA 1O23B 4FRBA 1HV9A 4KNRA 4EE3A 2BO7A 1H7HA 1H3MA 2V0LA 5C36A 4EEGA 3SXCA 2X60A 5AJNA 2VS3A 4Y6NA 1NKHB 1VZUA 4EEOA 1G0RA 3JTJA 3I0DA 1H7LA 3OH2A 1V84A 2O1HA 2V0IA 1JV3A 1LL3A 1R82A 3OC9A 3DJ4A 1VM8A 5C4FA 2YC3A 3I0FA 2QH5A 1OMXA 5C1GA 3R2WA 3IOJA 4BQHA 2I5EA 3Q4SA 2ICYA 2JCLA 2YESA 1SS9A 3DUVA 1ZI1A 2RJ1A 4E1KA 1G3LA 2ICXA 1EYRA 3SX5A 3V8ZA 2Y4LA 3OH1A 4Y62A 1GQ9A 1OMZA 2FYCB 2VS5A 2RJ7A 3SPTA 4EE4A 2OI7A 1ZJ2A 4M2BA 4B4MA 2RJ8A 1TVYA 1O7OA 2Y6PA 2PA4A 3TZTA 4NAKA 4AC3A 3CKJA 1LZ7A 1ZJPA 3CKQA 1JYKA 3U2VA 3OAMA 1HM8A 4B5BA 2BO8A 2GGQA 3OH3A 3U2WA 3CKNA 1H4CA 1H5SA 4Y9XA 3ZLKA 1O0RA 1INIA 4Y7FA 4DECA 3E25A 2VXMA 2WAWA 1JVGA 1QG8A 3PKQA 1H7EA 4BMAA 1FGXA 5C4DA 5FU8A 2P72A 3SXGA 4Y7GA 1HJJA 1QWJA 4ASJA 4FROA 1G1LA 1S4NA 5L6VA 2XMHA 1ON6A 5C49A 2XWLA 5C3DA 5J49A 2MZBA 4HO4A 5I1FA 4XWIA 3RSBA 4FRAA 1QGSA 3I0KA 4ZDQA 4HO0A 2RJ5A 1FR8A 4FRLA 1NF5B 1TW5A 3Q80A 3ZGGA 3LW6A 5CQLX 4B4GA 3D8VA 4HOCA 3CU0A 3O3PA 1WT3A 3RMWA 5CQNX 4LW6A 2PGVA 5CQMX 1TZFA 4FRQA 4HO9A 3V0LA 2Y7AA 1MP3A 2OEFA 4FCEA 4J18A 2AE7A 2YQJA 2JCOA 1LL2A 2PX7A 1H4EA 1ZDGA 5C1HA 1H5TA 1INJA 1G23A 1G8OA 3U0XA 1VPAA 3USQA 1R7TA 1EZIA 3U0YA 2PGYA 4Y7TA 2UX8A 4EEAA 5C3AA 1GX0A 2RIXA 1ZCTA 3OGZA 3ZF8A 1FWYA 4KT7A 4EVWA 5C3BA 4HO2A 1NMMB 5AJPA 3DK5A 3PKPA 4AYJA 5C1LA 5C4CA 2VD4A 3R3IA 4UEGA 1LVWA 2A8UA 1LZIA 1H5SC 1K4VA 1JYLA 2OI5A 3IOIA 3N9WA 1LZJA 1GWWA 2RJ0A 5FYEA 2WVKA 2APCA 1QGQA 1XHBA 2Q4JA 2X5SA 3V0PA 3JUJA 1TW1A 3OH4A 2FY7A 1H5SD 1WT0A 1WT1A 1IIMA 2AM5A 3V90A 5AJOA 1JV1A 1W57A 1R7XA 4KRVA 3BRKX 3OKRA 2FFVA 1YP4A 3I0CA 2RJ4A 2RIZA 5CMHA 4B3UA 1PZTA 4KC1A 4KPZA 4C2SA 5CMJA 3T7NA 4FRDA 4G3QA 1VGZA 2Z87A 2X65A 5EIYA 1Z90A 3V91A 4D0ZA 3F1CA 2BO6A 4Y64A 2ZU7A 4HO8A 3SXBA 4CJBA 3I0JA 5DDVA 1ZCVA 2FYAA 5CMFX 2RIYA 5C47A 4ECMA 4HCQA 3ZLLA 5EJ1A 1VZTA 2WVLA 1FG5N 4JISA 2YQSA 3SX3A 2AECA 1ON8A 1H5SB 1YROB 2O1FA 1FXJA 4FRPA 5C38A 4CJ8A 3SXEA 1ZI5A 2VFZA 3SX8A 4D11A 3JUKA 3D5NA 4R7PA 1H7QA 2XMEA 4YS8A 5FV9A 3I0GA 2E8BA 4Y7VA 2JCJA 2AM4A 4FCUA 4G87A 1LZ0A 1H7GA 3I0EA 1I52A 4DDZA 5IDTA 1ZJ3A 2Y4JA 4MYBA 4HO3A 2RJ6A 2AGDA 2CU2A 4L41C 2FYBA 3NGWA 3POLA 3OH0A 1FRWA 2O1GA 3GUEA 4JD0A 3E26A 2D0JA 3I0IX 1ZJ0A 2GGOA 3F1YA 2XWMA 1H5RA 4B2XA 3CGXA 2YQCA 4IRPA 4NAIA 5BXCA 3V0NA 1FOAA 1FO8A 4B2WA 3V8YA 4G3SA 5C4BA 2I7BA 1YP3A 3CKOA 2V0JA 2WEEA 1FXOA 2AESA 3HL3A 4DE7A 2WE9A 2VXLA 1E5KA 4M4KA 1MC3A 1NHEB 4NALA 2QGIA 1GQCA 2XWNA 1R7VA 2V0KA 4GBPA 1GWVA 4D48A 1H5TB 3U2TA 1PZYB 1VH1A 4FRHA 2I5KA 2YCMA 3USRA 2OEGA 1O7QA 1R7UA 1HJLA 5DDTA 3PNNA 4Y6UA 1VGTA 5C48A 3K8DA 4ASYA 4KQLA 1WT2A 4LW3A 1ZHJA 2P73A 5CMIA 4D0TA 4K6RA 4M28A 3FWWA 4KXOA 2D7RA 2QKXA 3V0QA 2FYDB 1V83A 1ZDFA 1ZJ1A 3I0LA 5CMGX 2V0HA 4FQWA 1LL0A 2WGZA 2X5ZA 4Y63A 2ZU9A 4KNXA 1FZWA 1ZCUA 1W77A 4D11C 4Y7UA 1NWGB 3U2UA 3SX7A 3ZGFA 2W0VA 3V0OA 2W0WA 2A8WA 1ZI3A 4FRMA 5FU0A 1FR9A 1MP5A 4AAWA 1H4DA 1W55A 5HS2A 1V82A 4EE5A 3QVBA 1ZCYA 3FOQA 3CKVA 3RMVA 4G3PA 5C4EA 5FTVA 2RJ9A 2Z86A 1IINA 2JCKA 1MP4A 2ZU8A 2VS4A 1HM0A 1ZJOA 2VSIA 1R80A 1XZ6A 2RITA 2NXVA 4HO5A 3T7OA 1S4OA 4FREA 1JVDA 4ARWA 2FFUA 1ZI4A 1KWSA 1GA8A 5EJZA 1H7TA 4P02A 2D7IA 1FGGA 5L6SA 3SXAA 1FO9A 3BCVA 3ST8A 1VICA 2VSHA 1WSZA 1H7FA 2DPWA 3K8EA 4HO6A 4P00A 5IFYA 5JQQA 2AH9A 4IRQA 1R7YA 1ZIZA 1HM9A 2BO4A 3SXDA 4EEMA 1G93A 5CQOA 2OI6A 4B42A 1VH3A 5FUHA 4CVHA 1R81A 2AM3A 1G2VA 1VGUA 1WVCA 3TQDA 4CJCA 5CQPA 1S4PA 3I0HA
chains in the Genus database with same CATH superfamily
1G9RA 1NQIB 2P6WA 3KIAA 4MNDA 5C8RA 3T7MA 4KPXA 1YP2A 2E3DA 2WVMA 4KC4A 5FTSA 5IDSA 3Q7UA 2YQHA 1VGWA 3EE5A 4FIXA 1G97A 3V0MA 1H5RB 4B4BA 1VZXA 4M2AA 1GX4A 4HG6A 3IOHA 2Y4KA 2Y4MA 3D98A 2YC5A 1G95A 3U2XA 4KC2A 4NANA 1OQMB 4AYLA 1O23B 4FRBA 1HV9A 4KNRA 4EE3A 2BO7A 1H7HA 1H3MA 2V0LA 5C36A 4EEGA 3SXCA 2X60A 5AJNA 2VS3A 4Y6NA 1NKHB 1VZUA 4EEOA 1G0RA 3JTJA 3I0DA 1H7LA 3OH2A 1V84A 2O1HA 2V0IA 1JV3A 1LL3A 1R82A 3OC9A 3DJ4A 1VM8A 5C4FA 2YC3A 3I0FA 2QH5A 1OMXA 5C1GA 3R2WA 3IOJA 4BQHA 2I5EA 3Q4SA 2ICYA 2JCLA 2YESA 1SS9A 3DUVA 1ZI1A 2RJ1A 4E1KA 1G3LA 2ICXA 1EYRA 3SX5A 3V8ZA 2Y4LA 3OH1A 4Y62A 1GQ9A 1OMZA 2FYCB 2VS5A 2RJ7A 3SPTA 4EE4A 2OI7A 1ZJ2A 4M2BA 4B4MA 2RJ8A 1TVYA 1O7OA 2Y6PA 2PA4A 3TZTA 4NAKA 4AC3A 3CKJA 1LZ7A 1ZJPA 3CKQA 1JYKA 3U2VA 3OAMA 1HM8A 4B5BA 2BO8A 2GGQA 3OH3A 3U2WA 3CKNA 1H4CA 1H5SA 4Y9XA 3ZLKA 4O6NA 1O0RA 1INIA 4Y7FA 4DECA 3E25A 2VXMA 2WAWA 1JVGA 1QG8A 3PKQA 4O6MA 1H7EA 4BMAA 1FGXA 5C4DA 5FU8A 2P72A 3SXGA 4Y7GA 1HJJA 1QWJA 4ASJA 4FROA 1G1LA 1S4NA 5L6VA 2XMHA 1ON6A 5C49A 2XWLA 5C3DA 5J49A 2MZBA 4HO4A 5I1FA 4XWIA 3RSBA 4FRAA 1QGSA 3I0KA 4ZDQA 4HO0A 2RJ5A 1FR8A 4FRLA 1NF5B 1TW5A 3Q80A 3ZGGA 3LW6A 5CQLX 4B4GA 3D8VA 4HOCA 3CU0A 3O3PA 1WT3A 3RMWA 5CQNX 4LW6A 2PGVA 5CQMX 1TZFA 4FRQA 4HO9A 3V0LA 2Y7AA 1MP3A 2OEFA 4FCEA 4J18A 2AE7A 2YQJA 2JCOA 1LL2A 2PX7A 5D91A 1H4EA 1ZDGA 5C1HA 1H5TA 1INJA 1G23A 1G8OA 3U0XA 1VPAA 3USQA 1R7TA 2J0AA 1EZIA 3U0YA 2PGYA 4Y7TA 2UX8A 4EEAA 5C3AA 1GX0A 2RIXA 1ZCTA 3OGZA 3ZF8A 1FWYA 4KT7A 4EVWA 5C3BA 4HO2A 1NMMB 5AJPA 3DK5A 3PKPA 4AYJA 5C1LA 5C4CA 2VD4A 3R3IA 4UEGA 1LVWA 2A8UA 1LZIA 1H5SC 1K4VA 1JYLA 2OI5A 3IOIA 3N9WA 1LZJA 1GWWA 2RJ0A 5FYEA 2WVKA 2APCA 1QGQA 1XHBA 2Q4JA 2X5SA 3V0PA 3JUJA 1TW1A 3OH4A 2FY7A 1H5SD 1WT0A 1WT1A 1IIMA 2AM5A 3V90A 5AJOA 1JV1A 1W57A 1R7XA 4KRVA 3BRKX 3OKRA 2FFVA 1YP4A 3I0CA 5D92A 2RJ4A 2RIZA 5CMHA 4B3UA 1PZTA 4KC1A 4KPZA 4C2SA 5CMJA 3T7NA 4FRDA 4G3QA 1VGZA 2Z87A 2X65A 5EIYA 1Z90A 3V91A 4D0ZA 3F1CA 2BO6A 4Y64A 2ZU7A 4HO8A 3SXBA 4CJBA 3I0JA 5DDVA 1ZCVA 2FYAA 5CMFX 2RIYA 5C47A 4ECMA 4HCQA 3ZLLA 5EJ1A 1VZTA 2WVLA 1FG5N 4JISA 2YQSA 3SX3A 2AECA 1ON8A 1H5SB 1YROB 2O1FA 1FXJA 4FRPA 2VK9A 5C38A 4CJ8A 3SXEA 1ZI5A 2VFZA 3SX8A 4D11A 3JUKA 3D5NA 4R7PA 1H7QA 2XMEA 4YS8A 5FV9A 3I0GA 2E8BA 4Y7VA 2JCJA 2AM4A 4FCUA 4G87A 1LZ0A 1H7GA 3I0EA 1I52A 4DDZA 5IDTA 1ZJ3A 2Y4JA 4MYBA 4HO3A 2RJ6A 2AGDA 2CU2A 4L41C 2J0BA 2FYBA 3NGWA 3POLA 3OH0A 1FRWA 2O1GA 3GUEA 4JD0A 3E26A 2D0JA 3I0IX 1ZJ0A 2GGOA 3F1YA 2XWMA 1H5RA 4B2XA 3CGXA 2YQCA 4IRPA 4NAIA 5BXCA 3V0NA 1FOAA 1FO8A 4B2WA 3V8YA 4G3SA 5C4BA 2I7BA 1YP3A 3CKOA 2V0JA 2WEEA 1FXOA 2AESA 3HL3A 4DE7A 2WE9A 2VXLA 1E5KA 4M4KA 1MC3A 1NHEB 4NALA 2QGIA 1GQCA 2XWNA 1R7VA 2V0KA 4GBPA 1GWVA 4D48A 1H5TB 3U2TA 1PZYB 1VH1A 4FRHA 2I5KA 2YCMA 3USRA 2OEGA 1O7QA 1R7UA 1HJLA 5DDTA 3PNNA 4Y6UA 1VGTA 5C48A 3K8DA 4ASYA 4KQLA 1WT2A 4LW3A 1ZHJA 2P73A 5CMIA 4D0TA 4K6RA 4M28A 3FWWA 4KXOA 2D7RA 2QKXA 3V0QA 2FYDB 1V83A 1ZDFA 1ZJ1A 3I0LA 5CMGX 2V0HA 4FIYA 4FQWA 1LL0A 2WGZA 2X5ZA 4Y63A 2ZU9A 4KNXA 1FZWA 1ZCUA 1W77A 4D11C 4Y7UA 1NWGB 3U2UA 3SX7A 3ZGFA 2W0VA 3V0OA 2W0WA 2A8WA 1ZI3A 4FRMA 2C0NA 4MIXA 5FU0A 1FR9A 1MP5A 4AAWA 1H4DA 1W55A 5HS2A 1V82A 4EE5A 3QVBA 1ZCYA 3FOQA 3CKVA 3RMVA 4G3PA 5C4EA 5FTVA 2RJ9A 2Z86A 1IINA 2JCKA 1MP4A 2ZU8A 2VS4A 1HM0A 1ZJOA 2VSIA 1R80A 1XZ6A 2RITA 2NXVA 4HO5A 3T7OA 1S4OA 4FREA 1JVDA 4ARWA 2FFUA 1ZI4A 1KWSA 1GA8A 5EJZA 1H7TA 4P02A 2D7IA 1FGGA 5L6SA 3SXAA 1FO9A 3BCVA 3ST8A 1VICA 2VSHA 1WSZA 1H7FA 2DPWA 3K8EA 4HO6A 4P00A 5IFYA 5JQQA 2AH9A 4IRQA 1R7YA 1ZIZA 1HM9A 2BO4A 4Q7CA 3SXDA 4EEMA 1G93A 5CQOA 2OI6A 4B42A 1VH3A 5FUHA 4CVHA 1R81A 2AM3A 1G2VA 1VGUA 1WVCA 3TQDA 4CJCA 5CQPA 1S4PA 3I0HA
chains in the Genus database with same CATH topology
1G9RA 1NQIB 2P6WA 3KIAA 4MNDA 5C8RA 3T7MA 4KPXA 1YP2A 2E3DA 2WVMA 4KC4A 5FTSA 5IDSA 3Q7UA 2YQHA 1VGWA 3EE5A 4FIXA 1G97A 3V0MA 1H5RB 4B4BA 1VZXA 4M2AA 1GX4A 4HG6A 3IOHA 2Y4KA 2Y4MA 3D98A 2YC5A 1G95A 3U2XA 4KC2A 4NANA 1OQMB 4AYLA 1O23B 4FRBA 1HV9A 4KNRA 4EE3A 2BO7A 1H7HA 1H3MA 2V0LA 5C36A 4EEGA 3SXCA 2X60A 5AJNA 2VS3A 4Y6NA 1NKHB 1VZUA 4EEOA 1G0RA 3JTJA 3I0DA 1H7LA 3OH2A 1V84A 2O1HA 2V0IA 1JV3A 1LL3A 1R82A 3OC9A 3DJ4A 1VM8A 5C4FA 2YC3A 3I0FA 2QH5A 1OMXA 5C1GA 3R2WA 3IOJA 4BQHA 2I5EA 3Q4SA 2ICYA 2JCLA 2YESA 1SS9A 3DUVA 1ZI1A 2RJ1A 4E1KA 1G3LA 2ICXA 1EYRA 3SX5A 3V8ZA 2Y4LA 3OH1A 4Y62A 1GQ9A 1OMZA 2FYCB 2VS5A 2RJ7A 3SPTA 4EE4A 2OI7A 1ZJ2A 4M2BA 4B4MA 2RJ8A 1TVYA 1O7OA 2Y6PA 2PA4A 3TZTA 4NAKA 4AC3A 3CKJA 1LZ7A 1ZJPA 3CKQA 1JYKA 3U2VA 3OAMA 1HM8A 4B5BA 2BO8A 2GGQA 3OH3A 3U2WA 3CKNA 1H4CA 1H5SA 4Y9XA 3ZLKA 4O6NA 1O0RA 1INIA 4Y7FA 4DECA 3E25A 2VXMA 2WAWA 1JVGA 1QG8A 3PKQA 4O6MA 1H7EA 4BMAA 1FGXA 5C4DA 5FU8A 2P72A 3SXGA 4Y7GA 1HJJA 1QWJA 4ASJA 4FROA 1G1LA 1S4NA 5L6VA 2XMHA 1ON6A 5C49A 2XWLA 5C3DA 5J49A 2MZBA 4HO4A 5I1FA 4XWIA 3RSBA 4FRAA 1QGSA 3I0KA 4ZDQA 4HO0A 2RJ5A 1FR8A 4FRLA 1NF5B 1TW5A 3Q80A 3ZGGA 3LW6A 5CQLX 4B4GA 3D8VA 4HOCA 3CU0A 3O3PA 1WT3A 3RMWA 5CQNX 4LW6A 2PGVA 5CQMX 1TZFA 4FRQA 4HO9A 3V0LA 2Y7AA 1MP3A 2OEFA 4FCEA 4J18A 2AE7A 2YQJA 2JCOA 1LL2A 2PX7A 5D91A 1H4EA 1ZDGA 5C1HA 1H5TA 1INJA 1G23A 1G8OA 3U0XA 1VPAA 3USQA 1R7TA 2J0AA 1EZIA 3U0YA 2PGYA 4Y7TA 2UX8A 4EEAA 5C3AA 1GX0A 2RIXA 1ZCTA 3OGZA 3ZF8A 1FWYA 4KT7A 4EVWA 5C3BA 4HO2A 1NMMB 5AJPA 3DK5A 3PKPA 4AYJA 5C1LA 5C4CA 2VD4A 3R3IA 4UEGA 1LVWA 2A8UA 1LZIA 1H5SC 1K4VA 1JYLA 2OI5A 3IOIA 3N9WA 1LZJA 1GWWA 2RJ0A 5FYEA 2WVKA 2APCA 1QGQA 1XHBA 2Q4JA 2X5SA 3V0PA 3JUJA 1TW1A 3OH4A 2FY7A 1H5SD 1WT0A 1WT1A 1IIMA 2AM5A 3V90A 5AJOA 1JV1A 1W57A 1R7XA 4KRVA 3BRKX 3OKRA 2FFVA 1YP4A 3I0CA 5D92A 2RJ4A 2RIZA 5CMHA 4B3UA 1PZTA 4KC1A 4KPZA 4C2SA 5CMJA 3T7NA 4FRDA 4G3QA 1VGZA 2Z87A 2X65A 5EIYA 1Z90A 3V91A 4D0ZA 3F1CA 2BO6A 4Y64A 2ZU7A 4HO8A 3SXBA 4CJBA 3I0JA 5DDVA 1ZCVA 2FYAA 5CMFX 2RIYA 5C47A 4ECMA 4HCQA 3ZLLA 5EJ1A 1VZTA 2WVLA 1FG5N 4JISA 2YQSA 3SX3A 2AECA 1ON8A 1H5SB 1YROB 2O1FA 1FXJA 4FRPA 2VK9A 5C38A 4CJ8A 3SXEA 1ZI5A 2VFZA 3SX8A 4D11A 3JUKA 3D5NA 4R7PA 1H7QA 2XMEA 4YS8A 5FV9A 3I0GA 2E8BA 4Y7VA 2JCJA 2AM4A 4FCUA 4G87A 1LZ0A 1H7GA 3I0EA 1I52A 4DDZA 5IDTA 1ZJ3A 2Y4JA 4MYBA 4HO3A 2RJ6A 2AGDA 2CU2A 4L41C 2J0BA 2FYBA 3NGWA 3POLA 3OH0A 1FRWA 2O1GA 3GUEA 4JD0A 3E26A 2D0JA 3I0IX 1ZJ0A 2GGOA 3F1YA 2XWMA 1H5RA 4B2XA 3CGXA 2YQCA 4IRPA 4NAIA 5BXCA 3V0NA 1FOAA 1FO8A 4B2WA 3V8YA 4G3SA 5C4BA 2I7BA 1YP3A 3CKOA 2V0JA 2WEEA 1FXOA 2AESA 3HL3A 4DE7A 2WE9A 2VXLA 1E5KA 4M4KA 1MC3A 1NHEB 4NALA 2QGIA 1GQCA 2XWNA 1R7VA 2V0KA 4GBPA 1GWVA 4D48A 1H5TB 3U2TA 1PZYB 1VH1A 4FRHA 2I5KA 2YCMA 3USRA 2OEGA 1O7QA 1R7UA 1HJLA 5DDTA 3PNNA 4Y6UA 1VGTA 5C48A 3K8DA 4ASYA 4KQLA 1WT2A 4LW3A 1ZHJA 2P73A 5CMIA 4D0TA 4K6RA 4M28A 3FWWA 4KXOA 2D7RA 2QKXA 3V0QA 2FYDB 1V83A 1ZDFA 1ZJ1A 3I0LA 5CMGX 2V0HA 4FIYA 4FQWA 1LL0A 2WGZA 2X5ZA 4Y63A 2ZU9A 4KNXA 1FZWA 1ZCUA 1W77A 4D11C 4Y7UA 1NWGB 3U2UA 3SX7A 3ZGFA 2W0VA 3V0OA 2W0WA 2A8WA 1ZI3A 4FRMA 2C0NA 4MIXA 5FU0A 1FR9A 1MP5A 4AAWA 1H4DA 1W55A 5HS2A 1V82A 4EE5A 3QVBA 1ZCYA 3FOQA 3CKVA 3RMVA 4G3PA 5C4EA 5FTVA 2RJ9A 2Z86A 1IINA 2JCKA 1MP4A 2ZU8A 2VS4A 1HM0A 1ZJOA 2VSIA 1R80A 1XZ6A 2RITA 2NXVA 4HO5A 3T7OA 1S4OA 4FREA 1JVDA 4ARWA 2FFUA 1ZI4A 1KWSA 1GA8A 5EJZA 1H7TA 4P02A 2D7IA 1FGGA 5L6SA 3SXAA 1FO9A 3BCVA 3ST8A 1VICA 2VSHA 1WSZA 1H7FA 2DPWA 3K8EA 4HO6A 4P00A 5IFYA 5JQQA 2AH9A 4IRQA 1R7YA 1ZIZA 1HM9A 2BO4A 4Q7CA 3SXDA 4EEMA 1G93A 5CQOA 2OI6A 4B42A 1VH3A 5FUHA 4CVHA 1R81A 2AM3A 1G2VA 1VGUA 1WVCA 3TQDA 4CJCA 5CQPA 1S4PA 3I0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G9R A;  1NQI B;  2P6W A;  3KIA A;  4MND A;  5C8R A;  3T7M A;  4KPX A;  1YP2 A;  2E3D A;  2WVM A;  4KC4 A;  5FTS A;  5IDS A;  3Q7U A;  2YQH A;  1VGW A;  3EE5 A;  1G97 A;  3V0M A;  1H5R B;  4B4B A;  1VZX A;  4M2A A;  1GX4 A;  4HG6 A;  3IOH A;  2Y4K A;  2Y4M A;  3D98 A;  2YC5 A;  1G95 A;  3U2X A;  4KC2 A;  4NAN A;  1OQM B;  4AYL A;  1O23 B;  4FRB A;  1HV9 A;  4KNR A;  4EE3 A;  2BO7 A;  1H7H A;  1H3M A;  2V0L A;  5C36 A;  4EEG A;  3SXC A;  2X60 A;  5AJN A;  2VS3 A;  4Y6N A;  1NKH B;  1VZU A;  4EEO A;  1G0R A;  3JTJ A;  3I0D A;  1H7L A;  3OH2 A;  1V84 A;  2O1H A;  2V0I A;  1JV3 A;  1LL3 A;  1R82 A;  3OC9 A;  3DJ4 A;  1VM8 A;  5C4F A;  2YC3 A;  3I0F A;  2QH5 A;  1OMX A;  5C1G A;  3R2W A;  3IOJ A;  4BQH A;  2I5E A;  3Q4S A;  2ICY A;  2JCL A;  2YES A;  1SS9 A;  3DUV A;  1ZI1 A;  2RJ1 A;  4E1K A;  1G3L A;  2ICX A;  1EYR A;  3SX5 A;  3V8Z A;  2Y4L A;  3OH1 A;  4Y62 A;  1GQ9 A;  1OMZ A;  2FYC B;  2VS5 A;  2RJ7 A;  3SPT A;  4EE4 A;  2OI7 A;  1ZJ2 A;  4M2B A;  4B4M A;  2RJ8 A;  1TVY A;  1O7O A;  2Y6P A;  2PA4 A;  3TZT A;  4NAK A;  4AC3 A;  3CKJ A;  1LZ7 A;  1ZJP A;  3CKQ A;  1JYK A;  3U2V A;  3OAM A;  1HM8 A;  4B5B A;  2BO8 A;  2GGQ A;  3OH3 A;  3U2W A;  3CKN A;  1H4C A;  1H5S A;  4Y9X A;  3ZLK A;  1O0R A;  1INI A;  4Y7F A;  4DEC A;  3E25 A;  2VXM A;  2WAW A;  1JVG A;  1QG8 A;  3PKQ A;  1H7E A;  4BMA A;  1FGX A;  5C4D A;  5FU8 A;  2P72 A;  3SXG A;  4Y7G A;  1HJJ A;  1QWJ A;  4ASJ A;  4FRO A;  1G1L A;  1S4N A;  5L6V A;  2XMH A;  1ON6 A;  5C49 A;  2XWL A;  5C3D A;  5J49 A;  2MZB A;  4HO4 A;  5I1F A;  4XWI A;  3RSB A;  4FRA A;  1QGS A;  3I0K A;  4ZDQ A;  4HO0 A;  2RJ5 A;  1FR8 A;  4FRL A;  1NF5 B;  1TW5 A;  3Q80 A;  3ZGG A;  3LW6 A;  5CQL X;  4B4G A;  3D8V A;  4HOC A;  3CU0 A;  3O3P A;  1WT3 A;  3RMW A;  5CQN X;  4LW6 A;  2PGV A;  5CQM X;  1TZF A;  4FRQ A;  4HO9 A;  3V0L A;  2Y7A A;  1MP3 A;  2OEF A;  4FCE A;  4J18 A;  2AE7 A;  2YQJ A;  2JCO A;  1LL2 A;  2PX7 A;  1H4E A;  1ZDG A;  5C1H A;  1H5T A;  1INJ A;  1G23 A;  1G8O A;  3U0X A;  1VPA A;  3USQ A;  1R7T A;  1EZI A;  3U0Y A;  2PGY A;  4Y7T A;  2UX8 A;  4EEA A;  5C3A A;  1GX0 A;  2RIX A;  1ZCT A;  3OGZ A;  3ZF8 A;  1FWY A;  4KT7 A;  4EVW A;  5C3B A;  4HO2 A;  1NMM B;  5AJP A;  3DK5 A;  3PKP A;  4AYJ A;  5C1L A;  5C4C A;  2VD4 A;  3R3I A;  4UEG A;  1LVW A;  2A8U A;  1LZI A;  1H5S C;  1K4V A;  1JYL A;  2OI5 A;  3IOI A;  3N9W A;  1LZJ A;  1GWW A;  2RJ0 A;  5FYE A;  2WVK A;  2APC A;  1QGQ A;  1XHB A;  2Q4J A;  2X5S A;  3V0P A;  3JUJ A;  1TW1 A;  3OH4 A;  2FY7 A;  1H5S D;  1WT0 A;  1WT1 A;  1IIM A;  2AM5 A;  3V90 A;  5AJO A;  1JV1 A;  1W57 A;  1R7X A;  4KRV A;  3BRK X;  3OKR A;  2FFV A;  1YP4 A;  3I0C A;  2RJ4 A;  2RIZ A;  5CMH A;  4B3U A;  1PZT A;  4KC1 A;  4KPZ A;  4C2S A;  5CMJ A;  3T7N A;  4FRD A;  4G3Q A;  1VGZ A;  2Z87 A;  2X65 A;  5EIY A;  1Z90 A;  3V91 A;  4D0Z A;  3F1C A;  2BO6 A;  4Y64 A;  2ZU7 A;  4HO8 A;  3SXB A;  4CJB A;  3I0J A;  5DDV A;  1ZCV A;  2FYA A;  5CMF X;  2RIY A;  5C47 A;  4ECM A;  4HCQ A;  3ZLL A;  5EJ1 A;  1VZT A;  2WVL A;  1FG5 N;  4JIS A;  2YQS A;  3SX3 A;  2AEC A;  1ON8 A;  1H5S B;  1YRO B;  2O1F A;  1FXJ A;  4FRP A;  5C38 A;  4CJ8 A;  3SXE A;  1ZI5 A;  2VFZ A;  3SX8 A;  4D11 A;  3JUK A;  3D5N A;  4R7P A;  1H7Q A;  2XME A;  4YS8 A;  5FV9 A;  3I0G A;  2E8B A;  4Y7V A;  2JCJ A;  2AM4 A;  4FCU A;  4G87 A;  1LZ0 A;  1H7G A;  3I0E A;  1I52 A;  4DDZ A;  5IDT A;  1ZJ3 A;  2Y4J A;  4MYB A;  4HO3 A;  2RJ6 A;  2AGD A;  2CU2 A;  4L41 C;  2FYB A;  3NGW A;  3POL A;  3OH0 A;  1FRW A;  2O1G A;  3GUE A;  4JD0 A;  3E26 A;  2D0J A;  3I0I X;  1ZJ0 A;  2GGO A;  3F1Y A;  2XWM A;  1H5R A;  4B2X A;  3CGX A;  2YQC A;  4IRP A;  4NAI A;  5BXC A;  3V0N A;  1FOA A;  1FO8 A;  4B2W A;  3V8Y A;  4G3S A;  5C4B A;  2I7B A;  1YP3 A;  3CKO A;  2V0J A;  2WEE A;  1FXO A;  2AES A;  3HL3 A;  4DE7 A;  2WE9 A;  2VXL A;  1E5K A;  4M4K A;  1MC3 A;  1NHE B;  4NAL A;  2QGI A;  1GQC A;  2XWN A;  1R7V A;  2V0K A;  4GBP A;  1GWV A;  4D48 A;  1H5T B;  3U2T A;  1PZY B;  1VH1 A;  4FRH A;  2I5K A;  2YCM A;  3USR A;  2OEG A;  1O7Q A;  1R7U A;  1HJL A;  5DDT A;  3PNN A;  4Y6U A;  1VGT A;  5C48 A;  3K8D A;  4ASY A;  4KQL A;  1WT2 A;  4LW3 A;  1ZHJ A;  2P73 A;  5CMI A;  4D0T A;  4K6R A;  4M28 A;  3FWW A;  4KXO A;  2D7R A;  2QKX A;  3V0Q A;  2FYD B;  1V83 A;  1ZDF A;  1ZJ1 A;  3I0L A;  5CMG X;  2V0H A;  4FQW A;  1LL0 A;  2WGZ A;  2X5Z A;  4Y63 A;  2ZU9 A;  4KNX A;  1FZW A;  1ZCU A;  1W77 A;  4D11 C;  4Y7U A;  1NWG B;  3U2U A;  3SX7 A;  3ZGF A;  2W0V A;  3V0O A;  2W0W A;  2A8W A;  1ZI3 A;  4FRM A;  5FU0 A;  1FR9 A;  1MP5 A;  4AAW A;  1H4D A;  1W55 A;  5HS2 A;  1V82 A;  4EE5 A;  3QVB A;  1ZCY A;  3FOQ A;  3CKV A;  3RMV A;  4G3P A;  5C4E A;  5FTV A;  2RJ9 A;  2Z86 A;  1IIN A;  2JCK A;  1MP4 A;  2ZU8 A;  2VS4 A;  1HM0 A;  1ZJO A;  2VSI A;  1R80 A;  1XZ6 A;  2RIT A;  2NXV A;  4HO5 A;  3T7O A;  1S4O A;  4FRE A;  1JVD A;  4ARW A;  2FFU A;  1ZI4 A;  1KWS A;  1GA8 A;  5EJZ A;  1H7T A;  4P02 A;  2D7I A;  1FGG A;  5L6S A;  3SXA A;  1FO9 A;  3BCV A;  3ST8 A;  1VIC A;  2VSH A;  1WSZ A;  1H7F A;  2DPW A;  3K8E A;  4HO6 A;  4P00 A;  5IFY A;  5JQQ A;  2AH9 A;  4IRQ A;  1R7Y A;  1ZIZ A;  1HM9 A;  2BO4 A;  3SXD A;  4EEM A;  1G93 A;  5CQO A;  2OI6 A;  4B42 A;  1VH3 A;  5FUH A;  4CVH A;  1R81 A;  2AM3 A;  1G2V A;  1VGU A;  1WVC A;  3TQD A;  4CJC A;  5CQP A;  1S4P A;  3I0H A; 
#chains in the Genus database with same CATH topology
 1G9R A;  1NQI B;  2P6W A;  3KIA A;  4MND A;  5C8R A;  3T7M A;  4KPX A;  1YP2 A;  2E3D A;  2WVM A;  4KC4 A;  5FTS A;  5IDS A;  3Q7U A;  2YQH A;  1VGW A;  3EE5 A;  4FIX A;  1G97 A;  3V0M A;  1H5R B;  4B4B A;  1VZX A;  4M2A A;  1GX4 A;  4HG6 A;  3IOH A;  2Y4K A;  2Y4M A;  3D98 A;  2YC5 A;  1G95 A;  3U2X A;  4KC2 A;  4NAN A;  1OQM B;  4AYL A;  1O23 B;  4FRB A;  1HV9 A;  4KNR A;  4EE3 A;  2BO7 A;  1H7H A;  1H3M A;  2V0L A;  5C36 A;  4EEG A;  3SXC A;  2X60 A;  5AJN A;  2VS3 A;  4Y6N A;  1NKH B;  1VZU A;  4EEO A;  1G0R A;  3JTJ A;  3I0D A;  1H7L A;  3OH2 A;  1V84 A;  2O1H A;  2V0I A;  1JV3 A;  1LL3 A;  1R82 A;  3OC9 A;  3DJ4 A;  1VM8 A;  5C4F A;  2YC3 A;  3I0F A;  2QH5 A;  1OMX A;  5C1G A;  3R2W A;  3IOJ A;  4BQH A;  2I5E A;  3Q4S A;  2ICY A;  2JCL A;  2YES A;  1SS9 A;  3DUV A;  1ZI1 A;  2RJ1 A;  4E1K A;  1G3L A;  2ICX A;  1EYR A;  3SX5 A;  3V8Z A;  2Y4L A;  3OH1 A;  4Y62 A;  1GQ9 A;  1OMZ A;  2FYC B;  2VS5 A;  2RJ7 A;  3SPT A;  4EE4 A;  2OI7 A;  1ZJ2 A;  4M2B A;  4B4M A;  2RJ8 A;  1TVY A;  1O7O A;  2Y6P A;  2PA4 A;  3TZT A;  4NAK A;  4AC3 A;  3CKJ A;  1LZ7 A;  1ZJP A;  3CKQ A;  1JYK A;  3U2V A;  3OAM A;  1HM8 A;  4B5B A;  2BO8 A;  2GGQ A;  3OH3 A;  3U2W A;  3CKN A;  1H4C A;  1H5S A;  4Y9X A;  3ZLK A;  4O6N A;  1O0R A;  1INI A;  4Y7F A;  4DEC A;  3E25 A;  2VXM A;  2WAW A;  1JVG A;  1QG8 A;  3PKQ A;  4O6M A;  1H7E A;  4BMA A;  1FGX A;  5C4D A;  5FU8 A;  2P72 A;  3SXG A;  4Y7G A;  1HJJ A;  1QWJ A;  4ASJ A;  4FRO A;  1G1L A;  1S4N A;  5L6V A;  2XMH A;  1ON6 A;  5C49 A;  2XWL A;  5C3D A;  5J49 A;  2MZB A;  4HO4 A;  5I1F A;  4XWI A;  3RSB A;  4FRA A;  1QGS A;  3I0K A;  4ZDQ A;  4HO0 A;  2RJ5 A;  1FR8 A;  4FRL A;  1NF5 B;  1TW5 A;  3Q80 A;  3ZGG A;  3LW6 A;  5CQL X;  4B4G A;  3D8V A;  4HOC A;  3CU0 A;  3O3P A;  1WT3 A;  3RMW A;  5CQN X;  4LW6 A;  2PGV A;  5CQM X;  1TZF A;  4FRQ A;  4HO9 A;  3V0L A;  2Y7A A;  1MP3 A;  2OEF A;  4FCE A;  4J18 A;  2AE7 A;  2YQJ A;  2JCO A;  1LL2 A;  2PX7 A;  5D91 A;  1H4E A;  1ZDG A;  5C1H A;  1H5T A;  1INJ A;  1G23 A;  1G8O A;  3U0X A;  1VPA A;  3USQ A;  1R7T A;  2J0A A;  1EZI A;  3U0Y A;  2PGY A;  4Y7T A;  2UX8 A;  4EEA A;  5C3A A;  1GX0 A;  2RIX A;  1ZCT A;  3OGZ A;  3ZF8 A;  1FWY A;  4KT7 A;  4EVW A;  5C3B A;  4HO2 A;  1NMM B;  5AJP A;  3DK5 A;  3PKP A;  4AYJ A;  5C1L A;  5C4C A;  2VD4 A;  3R3I A;  4UEG A;  1LVW A;  2A8U A;  1LZI A;  1H5S C;  1K4V A;  1JYL A;  2OI5 A;  3IOI A;  3N9W A;  1LZJ A;  1GWW A;  2RJ0 A;  5FYE A;  2WVK A;  2APC A;  1QGQ A;  1XHB A;  2Q4J A;  2X5S A;  3V0P A;  3JUJ A;  1TW1 A;  3OH4 A;  2FY7 A;  1H5S D;  1WT0 A;  1WT1 A;  1IIM A;  2AM5 A;  3V90 A;  5AJO A;  1JV1 A;  1W57 A;  1R7X A;  4KRV A;  3BRK X;  3OKR A;  2FFV A;  1YP4 A;  3I0C A;  5D92 A;  2RJ4 A;  2RIZ A;  5CMH A;  4B3U A;  1PZT A;  4KC1 A;  4KPZ A;  4C2S A;  5CMJ A;  3T7N A;  4FRD A;  4G3Q A;  1VGZ A;  2Z87 A;  2X65 A;  5EIY A;  1Z90 A;  3V91 A;  4D0Z A;  3F1C A;  2BO6 A;  4Y64 A;  2ZU7 A;  4HO8 A;  3SXB A;  4CJB A;  3I0J A;  5DDV A;  1ZCV A;  2FYA A;  5CMF X;  2RIY A;  5C47 A;  4ECM A;  4HCQ A;  3ZLL A;  5EJ1 A;  1VZT A;  2WVL A;  1FG5 N;  4JIS A;  2YQS A;  3SX3 A;  2AEC A;  1ON8 A;  1H5S B;  1YRO B;  2O1F A;  1FXJ A;  4FRP A;  2VK9 A;  5C38 A;  4CJ8 A;  3SXE A;  1ZI5 A;  2VFZ A;  3SX8 A;  4D11 A;  3JUK A;  3D5N A;  4R7P A;  1H7Q A;  2XME A;  4YS8 A;  5FV9 A;  3I0G A;  2E8B A;  4Y7V A;  2JCJ A;  2AM4 A;  4FCU A;  4G87 A;  1LZ0 A;  1H7G A;  3I0E A;  1I52 A;  4DDZ A;  5IDT A;  1ZJ3 A;  2Y4J A;  4MYB A;  4HO3 A;  2RJ6 A;  2AGD A;  2CU2 A;  4L41 C;  2J0B A;  2FYB A;  3NGW A;  3POL A;  3OH0 A;  1FRW A;  2O1G A;  3GUE A;  4JD0 A;  3E26 A;  2D0J A;  3I0I X;  1ZJ0 A;  2GGO A;  3F1Y A;  2XWM A;  1H5R A;  4B2X A;  3CGX A;  2YQC A;  4IRP A;  4NAI A;  5BXC A;  3V0N A;  1FOA A;  1FO8 A;  4B2W A;  3V8Y A;  4G3S A;  5C4B A;  2I7B A;  1YP3 A;  3CKO A;  2V0J A;  2WEE A;  1FXO A;  2AES A;  3HL3 A;  4DE7 A;  2WE9 A;  2VXL A;  1E5K A;  4M4K A;  1MC3 A;  1NHE B;  4NAL A;  2QGI A;  1GQC A;  2XWN A;  1R7V A;  2V0K A;  4GBP A;  1GWV A;  4D48 A;  1H5T B;  3U2T A;  1PZY B;  1VH1 A;  4FRH A;  2I5K A;  2YCM A;  3USR A;  2OEG A;  1O7Q A;  1R7U A;  1HJL A;  5DDT A;  3PNN A;  4Y6U A;  1VGT A;  5C48 A;  3K8D A;  4ASY A;  4KQL A;  1WT2 A;  4LW3 A;  1ZHJ A;  2P73 A;  5CMI A;  4D0T A;  4K6R A;  4M28 A;  3FWW A;  4KXO A;  2D7R A;  2QKX A;  3V0Q A;  2FYD B;  1V83 A;  1ZDF A;  1ZJ1 A;  3I0L A;  5CMG X;  2V0H A;  4FIY A;  4FQW A;  1LL0 A;  2WGZ A;  2X5Z A;  4Y63 A;  2ZU9 A;  4KNX A;  1FZW A;  1ZCU A;  1W77 A;  4D11 C;  4Y7U A;  1NWG B;  3U2U A;  3SX7 A;  3ZGF A;  2W0V A;  3V0O A;  2W0W A;  2A8W A;  1ZI3 A;  4FRM A;  2C0N A;  4MIX A;  5FU0 A;  1FR9 A;  1MP5 A;  4AAW A;  1H4D A;  1W55 A;  5HS2 A;  1V82 A;  4EE5 A;  3QVB A;  1ZCY A;  3FOQ A;  3CKV A;  3RMV A;  4G3P A;  5C4E A;  5FTV A;  2RJ9 A;  2Z86 A;  1IIN A;  2JCK A;  1MP4 A;  2ZU8 A;  2VS4 A;  1HM0 A;  1ZJO A;  2VSI A;  1R80 A;  1XZ6 A;  2RIT A;  2NXV A;  4HO5 A;  3T7O A;  1S4O A;  4FRE A;  1JVD A;  4ARW A;  2FFU A;  1ZI4 A;  1KWS A;  1GA8 A;  5EJZ A;  1H7T A;  4P02 A;  2D7I A;  1FGG A;  5L6S A;  3SXA A;  1FO9 A;  3BCV A;  3ST8 A;  1VIC A;  2VSH A;  1WSZ A;  1H7F A;  2DPW A;  3K8E A;  4HO6 A;  4P00 A;  5IFY A;  5JQQ A;  2AH9 A;  4IRQ A;  1R7Y A;  1ZIZ A;  1HM9 A;  2BO4 A;  4Q7C A;  3SXD A;  4EEM A;  1G93 A;  5CQO A;  2OI6 A;  4B42 A;  1VH3 A;  5FUH A;  4CVH A;  1R81 A;  2AM3 A;  1G2V A;  1VGU A;  1WVC A;  3TQD A;  4CJC A;  5CQP A;  1S4P A;  3I0H A; 
#chains in the Genus database with same CATH homology
 1G9R A;  1NQI B;  2P6W A;  3KIA A;  4MND A;  5C8R A;  3T7M A;  4KPX A;  1YP2 A;  2E3D A;  2WVM A;  4KC4 A;  5FTS A;  5IDS A;  3Q7U A;  2YQH A;  1VGW A;  3EE5 A;  4FIX A;  1G97 A;  3V0M A;  1H5R B;  4B4B A;  1VZX A;  4M2A A;  1GX4 A;  4HG6 A;  3IOH A;  2Y4K A;  2Y4M A;  3D98 A;  2YC5 A;  1G95 A;  3U2X A;  4KC2 A;  4NAN A;  1OQM B;  4AYL A;  1O23 B;  4FRB A;  1HV9 A;  4KNR A;  4EE3 A;  2BO7 A;  1H7H A;  1H3M A;  2V0L A;  5C36 A;  4EEG A;  3SXC A;  2X60 A;  5AJN A;  2VS3 A;  4Y6N A;  1NKH B;  1VZU A;  4EEO A;  1G0R A;  3JTJ A;  3I0D A;  1H7L A;  3OH2 A;  1V84 A;  2O1H A;  2V0I A;  1JV3 A;  1LL3 A;  1R82 A;  3OC9 A;  3DJ4 A;  1VM8 A;  5C4F A;  2YC3 A;  3I0F A;  2QH5 A;  1OMX A;  5C1G A;  3R2W A;  3IOJ A;  4BQH A;  2I5E A;  3Q4S A;  2ICY A;  2JCL A;  2YES A;  1SS9 A;  3DUV A;  1ZI1 A;  2RJ1 A;  4E1K A;  1G3L A;  2ICX A;  1EYR A;  3SX5 A;  3V8Z A;  2Y4L A;  3OH1 A;  4Y62 A;  1GQ9 A;  1OMZ A;  2FYC B;  2VS5 A;  2RJ7 A;  3SPT A;  4EE4 A;  2OI7 A;  1ZJ2 A;  4M2B A;  4B4M A;  2RJ8 A;  1TVY A;  1O7O A;  2Y6P A;  2PA4 A;  3TZT A;  4NAK A;  4AC3 A;  3CKJ A;  1LZ7 A;  1ZJP A;  3CKQ A;  1JYK A;  3U2V A;  3OAM A;  1HM8 A;  4B5B A;  2BO8 A;  2GGQ A;  3OH3 A;  3U2W A;  3CKN A;  1H4C A;  1H5S A;  4Y9X A;  3ZLK A;  4O6N A;  1O0R A;  1INI A;  4Y7F A;  4DEC A;  3E25 A;  2VXM A;  2WAW A;  1JVG A;  1QG8 A;  3PKQ A;  4O6M A;  1H7E A;  4BMA A;  1FGX A;  5C4D A;  5FU8 A;  2P72 A;  3SXG A;  4Y7G A;  1HJJ A;  1QWJ A;  4ASJ A;  4FRO A;  1G1L A;  1S4N A;  5L6V A;  2XMH A;  1ON6 A;  5C49 A;  2XWL A;  5C3D A;  5J49 A;  2MZB A;  4HO4 A;  5I1F A;  4XWI A;  3RSB A;  4FRA A;  1QGS A;  3I0K A;  4ZDQ A;  4HO0 A;  2RJ5 A;  1FR8 A;  4FRL A;  1NF5 B;  1TW5 A;  3Q80 A;  3ZGG A;  3LW6 A;  5CQL X;  4B4G A;  3D8V A;  4HOC A;  3CU0 A;  3O3P A;  1WT3 A;  3RMW A;  5CQN X;  4LW6 A;  2PGV A;  5CQM X;  1TZF A;  4FRQ A;  4HO9 A;  3V0L A;  2Y7A A;  1MP3 A;  2OEF A;  4FCE A;  4J18 A;  2AE7 A;  2YQJ A;  2JCO A;  1LL2 A;  2PX7 A;  5D91 A;  1H4E A;  1ZDG A;  5C1H A;  1H5T A;  1INJ A;  1G23 A;  1G8O A;  3U0X A;  1VPA A;  3USQ A;  1R7T A;  2J0A A;  1EZI A;  3U0Y A;  2PGY A;  4Y7T A;  2UX8 A;  4EEA A;  5C3A A;  1GX0 A;  2RIX A;  1ZCT A;  3OGZ A;  3ZF8 A;  1FWY A;  4KT7 A;  4EVW A;  5C3B A;  4HO2 A;  1NMM B;  5AJP A;  3DK5 A;  3PKP A;  4AYJ A;  5C1L A;  5C4C A;  2VD4 A;  3R3I A;  4UEG A;  1LVW A;  2A8U A;  1LZI A;  1H5S C;  1K4V A;  1JYL A;  2OI5 A;  3IOI A;  3N9W A;  1LZJ A;  1GWW A;  2RJ0 A;  5FYE A;  2WVK A;  2APC A;  1QGQ A;  1XHB A;  2Q4J A;  2X5S A;  3V0P A;  3JUJ A;  1TW1 A;  3OH4 A;  2FY7 A;  1H5S D;  1WT0 A;  1WT1 A;  1IIM A;  2AM5 A;  3V90 A;  5AJO A;  1JV1 A;  1W57 A;  1R7X A;  4KRV A;  3BRK X;  3OKR A;  2FFV A;  1YP4 A;  3I0C A;  5D92 A;  2RJ4 A;  2RIZ A;  5CMH A;  4B3U A;  1PZT A;  4KC1 A;  4KPZ A;  4C2S A;  5CMJ A;  3T7N A;  4FRD A;  4G3Q A;  1VGZ A;  2Z87 A;  2X65 A;  5EIY A;  1Z90 A;  3V91 A;  4D0Z A;  3F1C A;  2BO6 A;  4Y64 A;  2ZU7 A;  4HO8 A;  3SXB A;  4CJB A;  3I0J A;  5DDV A;  1ZCV A;  2FYA A;  5CMF X;  2RIY A;  5C47 A;  4ECM A;  4HCQ A;  3ZLL A;  5EJ1 A;  1VZT A;  2WVL A;  1FG5 N;  4JIS A;  2YQS A;  3SX3 A;  2AEC A;  1ON8 A;  1H5S B;  1YRO B;  2O1F A;  1FXJ A;  4FRP A;  2VK9 A;  5C38 A;  4CJ8 A;  3SXE A;  1ZI5 A;  2VFZ A;  3SX8 A;  4D11 A;  3JUK A;  3D5N A;  4R7P A;  1H7Q A;  2XME A;  4YS8 A;  5FV9 A;  3I0G A;  2E8B A;  4Y7V A;  2JCJ A;  2AM4 A;  4FCU A;  4G87 A;  1LZ0 A;  1H7G A;  3I0E A;  1I52 A;  4DDZ A;  5IDT A;  1ZJ3 A;  2Y4J A;  4MYB A;  4HO3 A;  2RJ6 A;  2AGD A;  2CU2 A;  4L41 C;  2J0B A;  2FYB A;  3NGW A;  3POL A;  3OH0 A;  1FRW A;  2O1G A;  3GUE A;  4JD0 A;  3E26 A;  2D0J A;  3I0I X;  1ZJ0 A;  2GGO A;  3F1Y A;  2XWM A;  1H5R A;  4B2X A;  3CGX A;  2YQC A;  4IRP A;  4NAI A;  5BXC A;  3V0N A;  1FOA A;  1FO8 A;  4B2W A;  3V8Y A;  4G3S A;  5C4B A;  2I7B A;  1YP3 A;  3CKO A;  2V0J A;  2WEE A;  1FXO A;  2AES A;  3HL3 A;  4DE7 A;  2WE9 A;  2VXL A;  1E5K A;  4M4K A;  1MC3 A;  1NHE B;  4NAL A;  2QGI A;  1GQC A;  2XWN A;  1R7V A;  2V0K A;  4GBP A;  1GWV A;  4D48 A;  1H5T B;  3U2T A;  1PZY B;  1VH1 A;  4FRH A;  2I5K A;  2YCM A;  3USR A;  2OEG A;  1O7Q A;  1R7U A;  1HJL A;  5DDT A;  3PNN A;  4Y6U A;  1VGT A;  5C48 A;  3K8D A;  4ASY A;  4KQL A;  1WT2 A;  4LW3 A;  1ZHJ A;  2P73 A;  5CMI A;  4D0T A;  4K6R A;  4M28 A;  3FWW A;  4KXO A;  2D7R A;  2QKX A;  3V0Q A;  2FYD B;  1V83 A;  1ZDF A;  1ZJ1 A;  3I0L A;  5CMG X;  2V0H A;  4FIY A;  4FQW A;  1LL0 A;  2WGZ A;  2X5Z A;  4Y63 A;  2ZU9 A;  4KNX A;  1FZW A;  1ZCU A;  1W77 A;  4D11 C;  4Y7U A;  1NWG B;  3U2U A;  3SX7 A;  3ZGF A;  2W0V A;  3V0O A;  2W0W A;  2A8W A;  1ZI3 A;  4FRM A;  2C0N A;  4MIX A;  5FU0 A;  1FR9 A;  1MP5 A;  4AAW A;  1H4D A;  1W55 A;  5HS2 A;  1V82 A;  4EE5 A;  3QVB A;  1ZCY A;  3FOQ A;  3CKV A;  3RMV A;  4G3P A;  5C4E A;  5FTV A;  2RJ9 A;  2Z86 A;  1IIN A;  2JCK A;  1MP4 A;  2ZU8 A;  2VS4 A;  1HM0 A;  1ZJO A;  2VSI A;  1R80 A;  1XZ6 A;  2RIT A;  2NXV A;  4HO5 A;  3T7O A;  1S4O A;  4FRE A;  1JVD A;  4ARW A;  2FFU A;  1ZI4 A;  1KWS A;  1GA8 A;  5EJZ A;  1H7T A;  4P02 A;  2D7I A;  1FGG A;  5L6S A;  3SXA A;  1FO9 A;  3BCV A;  3ST8 A;  1VIC A;  2VSH A;  1WSZ A;  1H7F A;  2DPW A;  3K8E A;  4HO6 A;  4P00 A;  5IFY A;  5JQQ A;  2AH9 A;  4IRQ A;  1R7Y A;  1ZIZ A;  1HM9 A;  2BO4 A;  4Q7C A;  3SXD A;  4EEM A;  1G93 A;  5CQO A;  2OI6 A;  4B42 A;  1VH3 A;  5FUH A;  4CVH A;  1R81 A;  2AM3 A;  1G2V A;  1VGU A;  1WVC A;  3TQD A;  4CJC A;  5CQP A;  1S4P A;  3I0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...