3Q7UA

Structure of mtb 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) complexed with ctp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
226
structure length
222
Chain Sequence
GEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLDEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase
publication title Crystal Structure of Mycobacterium tuberculosis 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD): a candidate antitubercular drug target
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 62
structure length 222
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3q7uA00
1INJA 2MZBA 4D0ZA 5L6SA 4P02A 2V0LA 3R2WA 3O3PA 4NANA 5IDTA 2P6WA 1MC3A 1FR9A 5FTSA 1GWWA 1LVWA 3SXGA 4AYLA 3OAMA 1MP5A 2XWNA 3T7NA 1HM8A 3IOJA 2V0JA 1H5RB 1GX0A 2O1HA 2VXMA 5IFYA 3D5NA 3SX8A 4ECMA 3FOQA 1FR8A 4FCEA 4XWIA 1H4EA 1OMXA 1TZFA 2VSHA 3DUVA 1W55A 2E3DA 4FRQA 2AGDA 1O7OA 3I0FA 5I1FA 3USRA 4AC3A 1EZIA 4KC2A 2V0IA 1HJJA 2YQSA 2I5EA 2BO6A 4D0TA 1LL3A 4FQWA 4E1KA 1G97A 2YC3A 1V84A 2ICXA 5AJOA 5FU0A 2AH9A 4DECA 2Q4JA 4JD0A 4KC1A 2Y7AA 2O1GA 5AJPA 3V8ZA 3V8YA 4Y63A 1FRWA 3SXAA 3LW6A 2X5ZA 1H7LA 1WVCA 1NMMB 1IINA 2XMEA 3PNNA 2AM4A 4FRBA 4M2AA 4YS8A 1WT1A 1VGUA 5FTVA 3OGZA 1G93A 1HV9A 4ASYA 1R7XA 5CQPA 2Y4LA 3BCVA 2VS5A 1SS9A 5C4FA 2P73A 2WGZA 2D0JA 5IDSA 5JQQA 1R7YA 4Y7GA 3SX3A 3OH0A 1LZJA 2PX7A 4LW3A 2YQJA 2VFZA 2RIZA 1QGSA 2RIYA 5C8RA 2RJ8A 3F1YA 5FU8A 2AESA 4L41C 2QH5A 1GQCA 2Z87A 1WT3A 3SXCA 1VZTA 1H3MA 4K6RA 1INIA 5FV9A 3V0NA 2I7BA 2OI6A 5CQNX 3SX7A 4EEMA 3ZGFA 5C1LA 2A8WA 4HO6A 1G0RA 1ZJ2A 1FO8A 1H5SB 3SX5A 1LZIA 1H4DA 5C4BA 1ZI5A 3RSBA 4MYBA 2WVLA 2D7IA 5C1GA 3U2WA 5CMJA 1FO9A 4M28A 3PKQA 1H5SA 4NAKA 1ON6A 2OI7A 3TQDA 2YCMA 1YP3A 1Z90A 3DK5A 1JVGA 2WAWA 2YESA 4Y7TA 1ZJ0A 1R7UA 3K8DA 2V0KA 2FFUA 5C48A 3SXEA 2WVMA 2YC5A 4HO9A 3OH3A 4M2BA 3U0YA 1JVDA 1KWSA 5C47A 1WSZA 4KQLA 4Y64A 4DDZA 4KNXA 1IIMA 1JYKA 1OMZA 3V0OA 1FXJA 4M4KA 4HO8A 3R3IA 2YQHA 1V83A 4D11C 5C3DA 1ZI4A 1R82A 4EEGA 4D11A 1O7QA 1G23A 4EVWA 4KNRA 2UX8A 3Q80A 3T7MA 5AJNA 5L6VA 4ARWA 2RJ6A 1H7GA 5C49A 5C4DA 1E5KA 1ZJOA 4HOCA 4KXOA 5EJZA 3BRKX 3V0QA 2OI5A 3I0DA 1FWYA 2PA4A 4EEAA 1R80A 1VGTA 1H7FA 4G3SA 4EE3A 2FFVA 2FY7A 3U2VA 4ZDQA 1H4CA 3I0JA 1S4NA 1NWGB 4UEGA 4G3PA 1ZCUA 1H7EA 4Y6NA 1H7QA 2ZU9A 4KT7A 1FZWA 2VXLA 2VD4A 3CKNA 1O23B 2Y4KA 1NKHB 5EJ1A 4CJ8A 2DPWA 1R7VA 3JUJA 4Y7VA 4FROA 2E8BA 1S4PA 1GX4A 4Y7UA 2VS4A 3K8EA 4B4GA 3JUKA 4HO0A 3ST8A 1VPAA 1ZJ3A 3TZTA 1G3LA 1LZ7A 2O1FA 3OC9A 1ZI3A 4MNDA 4GBPA 2QKXA 1VM8A 1PZYB 3PKPA 2AE7A 3OH2A 3U0XA 2AM5A 5J49A 5CMFX 1R81A 3ZF8A 3OKRA 1VH1A 4BQHA 2QGIA 3NGWA 5DDVA 1NHEB 1LL2A 3FWWA 5HS2A 3I0LA 1FGXA 1WT2A 5C3BA 3V91A 4FREA 4FRLA 3CU0A 4CJBA 2RJ1A 4HO3A 4KRVA 2VSIA 3I0EA 1S4OA 4HO4A 1FGGA 1VZXA 1H7TA 3I0IX 1H5SC 1VGWA 2FYDB 4FCUA 2JCLA 1GA8A 4DE7A 1QGQA 5C1HA 4FRHA 3I0HA 4D48A 1I52A 1YP2A 1NQIB 2JCJA 1GWVA 1HM0A 4AAWA 1TW5A 1ZJPA 4FRPA 1H7HA 4ASJA 1W57A 3CKVA 1EYRA 4NALA 1G9RA 1ZDGA 2RIXA 3JTJA 4B2WA 1MP3A 3D98A 4BMAA 4EE4A 2WE9A 4B42A 5C4CA 1G1LA 4KC4A 3KIAA 1YROB 1H5TA 4B3UA 4LW6A 1LZ0A 1R7TA 3SXBA 1ZJ1A 4FRMA 1ZCTA 3ZLLA 4Y62A 3V0PA 5DDTA 2XMHA 3HL3A 2CU2A 5FUHA 4IRPA 4HCQA 3F1CA 5C3AA 4G3QA 2WEEA 3CKOA 4G87A 4CVHA 3E26A 2RITA 2APCA 3GUEA 4IRQA 2BO4A 2ICYA 5CQOA 2AM3A 2GGOA 4B2XA 3V90A 3T7OA 2X65A 3ZLKA 3D8VA 3EE5A 1HM9A 2RJ5A 4Y9XA 1H5RA 2X60A 4KPXA 1G95A 1LL0A 3U2XA 2Z86A 4AYJA 3RMWA 2FYCB 4KPZA 1PZTA 1ON8A 4NAIA 3I0KA 3CGXA 1OQMB 4Y6UA 1ZDFA 1G8OA 3IOHA 2ZU7A 4P00A 5FYEA 4B5BA 4EEOA 5CQLX 5CMGX 1NF5B 1HJLA 2BO8A 2V0HA 4B4BA 1VICA 3Q7UA 3V0MA 3Q4SA 5EIYA 2A8UA 1H5SD 4C2SA 2RJ7A 2GGQA 1W77A 4R7PA 5CQMX 1G2VA 2AECA 2XWLA 3ZGGA 1YP4A 1VH3A 1JYLA 1XZ6A 2WVKA 2YQCA 2PGYA 4HG6A 2Y4MA 1K4VA 2D7RA 3OH4A 1WT0A 3SXDA 1FG5N 4HO5A 2Y6PA 1TVYA 1FOAA 3E25A 3U2UA 4Y7FA 1ZIZA 3USQA 1QG8A 3IOIA 2X5SA 4FRDA 5BXCA 1VGZA 2NXVA 2Y4JA 2W0VA 3V0LA 3SPTA 2VS3A 1V82A 3CKQA 1XHBA 2PGVA 3POLA 3CKJA 1JV3A 1ZCYA 4FRAA 3N9WA 5C4EA 5C38A 1MP4A 2BO7A 1GQ9A 1ZCVA 3DJ4A 3I0GA 3RMVA 1H5TB 2RJ9A 2XWMA 1ZHJA 4HO2A 4EE5A 2JCKA 5CMHA 2RJ0A 1VZUA 2FYBA 2JCOA 1TW1A 2RJ4A 2FYAA 4CJCA 3QVBA 2W0WA 5CMIA 2ZU8A 3I0CA 1JV1A 3OH1A 4J18A 4B4MA 5C36A 1O0RA 3U2TA 1FXOA 1ZI1A 4JISA 2OEFA 2OEGA 2I5KA 1QWJA 2P72A
chains in the Genus database with same CATH superfamily
1INJA 2MZBA 4D0ZA 5L6SA 4P02A 2V0LA 3R2WA 3O3PA 4NANA 5IDTA 2P6WA 2J0BA 1MC3A 1FR9A 5FTSA 1GWWA 1LVWA 3SXGA 4AYLA 3OAMA 1MP5A 2XWNA 3T7NA 1HM8A 3IOJA 2V0JA 1H5RB 1GX0A 2O1HA 2VXMA 5IFYA 3D5NA 3SX8A 4ECMA 3FOQA 1FR8A 4FCEA 4XWIA 1H4EA 1OMXA 1TZFA 2VSHA 3DUVA 1W55A 2E3DA 4FRQA 2AGDA 1O7OA 3I0FA 5I1FA 3USRA 4AC3A 1EZIA 4KC2A 2V0IA 1HJJA 2YQSA 2I5EA 2BO6A 4D0TA 1LL3A 4FQWA 4E1KA 1G97A 2YC3A 1V84A 2ICXA 5AJOA 5FU0A 2AH9A 4DECA 2Q4JA 4JD0A 4KC1A 2Y7AA 2O1GA 5AJPA 3V8ZA 4FIXA 3V8YA 4Y63A 1FRWA 3SXAA 3LW6A 2X5ZA 1H7LA 1WVCA 1NMMB 1IINA 2XMEA 3PNNA 4FIYA 2AM4A 4FRBA 4M2AA 4YS8A 1WT1A 1VGUA 5FTVA 3OGZA 1G93A 1HV9A 2C0NA 4ASYA 1R7XA 5CQPA 2Y4LA 3BCVA 2VS5A 1SS9A 5C4FA 2P73A 2WGZA 2D0JA 5IDSA 5JQQA 1R7YA 4Y7GA 3SX3A 3OH0A 1LZJA 2PX7A 4LW3A 2YQJA 2VFZA 2RIZA 1QGSA 2RIYA 5C8RA 2RJ8A 3F1YA 5FU8A 2AESA 4L41C 2QH5A 1GQCA 2Z87A 1WT3A 3SXCA 1VZTA 1H3MA 4K6RA 1INIA 5FV9A 3V0NA 2I7BA 2OI6A 5CQNX 3SX7A 4EEMA 3ZGFA 5C1LA 2A8WA 4HO6A 1G0RA 1ZJ2A 1FO8A 1H5SB 3SX5A 1LZIA 1H4DA 5C4BA 1ZI5A 3RSBA 4MYBA 2WVLA 2D7IA 5C1GA 3U2WA 5CMJA 1FO9A 4M28A 3PKQA 1H5SA 4NAKA 1ON6A 2OI7A 3TQDA 2YCMA 1YP3A 1Z90A 3DK5A 1JVGA 2WAWA 2YESA 4Y7TA 1ZJ0A 1R7UA 3K8DA 2V0KA 2FFUA 5C48A 3SXEA 2WVMA 2YC5A 4HO9A 3OH3A 4M2BA 3U0YA 1JVDA 1KWSA 5C47A 1WSZA 4KQLA 4Y64A 4DDZA 4KNXA 1IIMA 1JYKA 1OMZA 3V0OA 1FXJA 4M4KA 4HO8A 3R3IA 2YQHA 1V83A 4D11C 5C3DA 1ZI4A 1R82A 4EEGA 4D11A 1O7QA 1G23A 4EVWA 4KNRA 2UX8A 3Q80A 3T7MA 5AJNA 5L6VA 4ARWA 2RJ6A 1H7GA 5C49A 5C4DA 1E5KA 1ZJOA 4HOCA 4KXOA 5EJZA 3BRKX 3V0QA 2OI5A 3I0DA 1FWYA 2PA4A 4EEAA 1R80A 1VGTA 1H7FA 4G3SA 4EE3A 2FFVA 2FY7A 3U2VA 4ZDQA 1H4CA 3I0JA 1S4NA 1NWGB 4UEGA 4G3PA 1ZCUA 1H7EA 4Y6NA 1H7QA 2ZU9A 4KT7A 1FZWA 2VXLA 2VD4A 3CKNA 1O23B 2Y4KA 1NKHB 5EJ1A 4CJ8A 2DPWA 1R7VA 3JUJA 4Y7VA 4FROA 2E8BA 1S4PA 1GX4A 4Y7UA 2VS4A 3K8EA 4B4GA 3JUKA 4HO0A 3ST8A 1VPAA 1ZJ3A 3TZTA 1G3LA 1LZ7A 2O1FA 3OC9A 1ZI3A 4MNDA 4GBPA 2QKXA 1VM8A 1PZYB 3PKPA 2AE7A 3OH2A 4O6NA 3U0XA 2AM5A 5J49A 5CMFX 1R81A 3ZF8A 3OKRA 1VH1A 4BQHA 2QGIA 3NGWA 5DDVA 1NHEB 1LL2A 3FWWA 5HS2A 3I0LA 1FGXA 1WT2A 5C3BA 3V91A 4FREA 4FRLA 3CU0A 4CJBA 2RJ1A 4HO3A 4KRVA 2VSIA 3I0EA 1S4OA 4HO4A 1FGGA 1VZXA 1H7TA 3I0IX 1H5SC 1VGWA 2FYDB 4FCUA 2JCLA 1GA8A 4DE7A 1QGQA 5C1HA 4FRHA 3I0HA 4D48A 1I52A 1YP2A 1NQIB 2JCJA 1GWVA 1HM0A 4AAWA 1TW5A 1ZJPA 4FRPA 1H7HA 4ASJA 1W57A 3CKVA 1EYRA 4NALA 1G9RA 4O6MA 1ZDGA 2RIXA 3JTJA 4B2WA 1MP3A 3D98A 4BMAA 4EE4A 2WE9A 4B42A 4Q7CA 5C4CA 1G1LA 4KC4A 3KIAA 1YROB 1H5TA 4B3UA 4LW6A 1LZ0A 1R7TA 3SXBA 1ZJ1A 2VK9A 4FRMA 1ZCTA 3ZLLA 4Y62A 3V0PA 5DDTA 2XMHA 3HL3A 2CU2A 5FUHA 4IRPA 4HCQA 3F1CA 5C3AA 4G3QA 2WEEA 3CKOA 4G87A 4CVHA 3E26A 2RITA 2APCA 3GUEA 4IRQA 2BO4A 2ICYA 5CQOA 2AM3A 2GGOA 4B2XA 3V90A 3T7OA 2X65A 3ZLKA 3D8VA 3EE5A 1HM9A 2RJ5A 4Y9XA 1H5RA 2X60A 4KPXA 1G95A 1LL0A 3U2XA 2Z86A 4AYJA 3RMWA 2FYCB 4KPZA 1PZTA 1ON8A 4NAIA 3I0KA 3CGXA 5D92A 1OQMB 4Y6UA 1ZDFA 1G8OA 3IOHA 2ZU7A 4P00A 5FYEA 4B5BA 4EEOA 5CQLX 5CMGX 1NF5B 1HJLA 2BO8A 2V0HA 4B4BA 1VICA 3Q7UA 3V0MA 3Q4SA 5EIYA 2A8UA 1H5SD 4C2SA 2RJ7A 2GGQA 1W77A 4R7PA 5CQMX 1G2VA 2AECA 2XWLA 3ZGGA 1YP4A 1VH3A 1JYLA 1XZ6A 2WVKA 2YQCA 2PGYA 4HG6A 2Y4MA 1K4VA 2D7RA 3OH4A 1WT0A 3SXDA 1FG5N 4HO5A 2Y6PA 1TVYA 1FOAA 3E25A 3U2UA 4Y7FA 1ZIZA 3USQA 1QG8A 3IOIA 2X5SA 4FRDA 5BXCA 1VGZA 2NXVA 2Y4JA 2W0VA 3V0LA 5D91A 3SPTA 2VS3A 2J0AA 1V82A 3CKQA 1XHBA 2PGVA 3POLA 3CKJA 1JV3A 1ZCYA 4FRAA 3N9WA 5C4EA 5C38A 1MP4A 2BO7A 1GQ9A 1ZCVA 3DJ4A 3I0GA 3RMVA 1H5TB 2RJ9A 2XWMA 1ZHJA 4HO2A 4EE5A 2JCKA 5CMHA 2RJ0A 1VZUA 2FYBA 2JCOA 1TW1A 2RJ4A 2FYAA 4CJCA 3QVBA 2W0WA 5CMIA 2ZU8A 3I0CA 1JV1A 3OH1A 4J18A 4B4MA 5C36A 1O0RA 3U2TA 4MIXA 1FXOA 1ZI1A 4JISA 2OEFA 2OEGA 2I5KA 1QWJA 2P72A
chains in the Genus database with same CATH topology
1INJA 2MZBA 4D0ZA 5L6SA 4P02A 2V0LA 3R2WA 3O3PA 4NANA 5IDTA 2P6WA 2J0BA 1MC3A 1FR9A 5FTSA 1GWWA 1LVWA 3SXGA 4AYLA 3OAMA 1MP5A 2XWNA 3T7NA 1HM8A 3IOJA 2V0JA 1H5RB 1GX0A 2O1HA 2VXMA 5IFYA 3D5NA 3SX8A 4ECMA 3FOQA 1FR8A 4FCEA 4XWIA 1H4EA 1OMXA 1TZFA 2VSHA 3DUVA 1W55A 2E3DA 4FRQA 2AGDA 1O7OA 3I0FA 5I1FA 3USRA 4AC3A 1EZIA 4KC2A 2V0IA 1HJJA 2YQSA 2I5EA 2BO6A 4D0TA 1LL3A 4FQWA 4E1KA 1G97A 2YC3A 1V84A 2ICXA 5AJOA 5FU0A 2AH9A 4DECA 2Q4JA 4JD0A 4KC1A 2Y7AA 2O1GA 5AJPA 3V8ZA 4FIXA 3V8YA 4Y63A 1FRWA 3SXAA 3LW6A 2X5ZA 1H7LA 1WVCA 1NMMB 1IINA 2XMEA 3PNNA 4FIYA 2AM4A 4FRBA 4M2AA 4YS8A 1WT1A 1VGUA 5FTVA 3OGZA 1G93A 1HV9A 2C0NA 4ASYA 1R7XA 5CQPA 2Y4LA 3BCVA 2VS5A 1SS9A 5C4FA 2P73A 2WGZA 2D0JA 5IDSA 5JQQA 1R7YA 4Y7GA 3SX3A 3OH0A 1LZJA 2PX7A 4LW3A 2YQJA 2VFZA 2RIZA 1QGSA 2RIYA 5C8RA 2RJ8A 3F1YA 5FU8A 2AESA 4L41C 2QH5A 1GQCA 2Z87A 1WT3A 3SXCA 1VZTA 1H3MA 4K6RA 1INIA 5FV9A 3V0NA 2I7BA 2OI6A 5CQNX 3SX7A 4EEMA 3ZGFA 5C1LA 2A8WA 4HO6A 1G0RA 1ZJ2A 1FO8A 1H5SB 3SX5A 1LZIA 1H4DA 5C4BA 1ZI5A 3RSBA 4MYBA 2WVLA 2D7IA 5C1GA 3U2WA 5CMJA 1FO9A 4M28A 3PKQA 1H5SA 4NAKA 1ON6A 2OI7A 3TQDA 2YCMA 1YP3A 1Z90A 3DK5A 1JVGA 2WAWA 2YESA 4Y7TA 1ZJ0A 1R7UA 3K8DA 2V0KA 2FFUA 5C48A 3SXEA 2WVMA 2YC5A 4HO9A 3OH3A 4M2BA 3U0YA 1JVDA 1KWSA 5C47A 1WSZA 4KQLA 4Y64A 4DDZA 4KNXA 1IIMA 1JYKA 1OMZA 3V0OA 1FXJA 4M4KA 4HO8A 3R3IA 2YQHA 1V83A 4D11C 5C3DA 1ZI4A 1R82A 4EEGA 4D11A 1O7QA 1G23A 4EVWA 4KNRA 2UX8A 3Q80A 3T7MA 5AJNA 5L6VA 4ARWA 2RJ6A 1H7GA 5C49A 5C4DA 1E5KA 1ZJOA 4HOCA 4KXOA 5EJZA 3BRKX 3V0QA 2OI5A 3I0DA 1FWYA 2PA4A 4EEAA 1R80A 1VGTA 1H7FA 4G3SA 4EE3A 2FFVA 2FY7A 3U2VA 4ZDQA 1H4CA 3I0JA 1S4NA 1NWGB 4UEGA 4G3PA 1ZCUA 1H7EA 4Y6NA 1H7QA 2ZU9A 4KT7A 1FZWA 2VXLA 2VD4A 3CKNA 1O23B 2Y4KA 1NKHB 5EJ1A 4CJ8A 2DPWA 1R7VA 3JUJA 4Y7VA 4FROA 2E8BA 1S4PA 1GX4A 4Y7UA 2VS4A 3K8EA 4B4GA 3JUKA 4HO0A 3ST8A 1VPAA 1ZJ3A 3TZTA 1G3LA 1LZ7A 2O1FA 3OC9A 1ZI3A 4MNDA 4GBPA 2QKXA 1VM8A 1PZYB 3PKPA 2AE7A 3OH2A 4O6NA 3U0XA 2AM5A 5J49A 5CMFX 1R81A 3ZF8A 3OKRA 1VH1A 4BQHA 2QGIA 3NGWA 5DDVA 1NHEB 1LL2A 3FWWA 5HS2A 3I0LA 1FGXA 1WT2A 5C3BA 3V91A 4FREA 4FRLA 3CU0A 4CJBA 2RJ1A 4HO3A 4KRVA 2VSIA 3I0EA 1S4OA 4HO4A 1FGGA 1VZXA 1H7TA 3I0IX 1H5SC 1VGWA 2FYDB 4FCUA 2JCLA 1GA8A 4DE7A 1QGQA 5C1HA 4FRHA 3I0HA 4D48A 1I52A 1YP2A 1NQIB 2JCJA 1GWVA 1HM0A 4AAWA 1TW5A 1ZJPA 4FRPA 1H7HA 4ASJA 1W57A 3CKVA 1EYRA 4NALA 1G9RA 4O6MA 1ZDGA 2RIXA 3JTJA 4B2WA 1MP3A 3D98A 4BMAA 4EE4A 2WE9A 4B42A 4Q7CA 5C4CA 1G1LA 4KC4A 3KIAA 1YROB 1H5TA 4B3UA 4LW6A 1LZ0A 1R7TA 3SXBA 1ZJ1A 2VK9A 4FRMA 1ZCTA 3ZLLA 4Y62A 3V0PA 5DDTA 2XMHA 3HL3A 2CU2A 5FUHA 4IRPA 4HCQA 3F1CA 5C3AA 4G3QA 2WEEA 3CKOA 4G87A 4CVHA 3E26A 2RITA 2APCA 3GUEA 4IRQA 2BO4A 2ICYA 5CQOA 2AM3A 2GGOA 4B2XA 3V90A 3T7OA 2X65A 3ZLKA 3D8VA 3EE5A 1HM9A 2RJ5A 4Y9XA 1H5RA 2X60A 4KPXA 1G95A 1LL0A 3U2XA 2Z86A 4AYJA 3RMWA 2FYCB 4KPZA 1PZTA 1ON8A 4NAIA 3I0KA 3CGXA 5D92A 1OQMB 4Y6UA 1ZDFA 1G8OA 3IOHA 2ZU7A 4P00A 5FYEA 4B5BA 4EEOA 5CQLX 5CMGX 1NF5B 1HJLA 2BO8A 2V0HA 4B4BA 1VICA 3Q7UA 3V0MA 3Q4SA 5EIYA 2A8UA 1H5SD 4C2SA 2RJ7A 2GGQA 1W77A 4R7PA 5CQMX 1G2VA 2AECA 2XWLA 3ZGGA 1YP4A 1VH3A 1JYLA 1XZ6A 2WVKA 2YQCA 2PGYA 4HG6A 2Y4MA 1K4VA 2D7RA 3OH4A 1WT0A 3SXDA 1FG5N 4HO5A 2Y6PA 1TVYA 1FOAA 3E25A 3U2UA 4Y7FA 1ZIZA 3USQA 1QG8A 3IOIA 2X5SA 4FRDA 5BXCA 1VGZA 2NXVA 2Y4JA 2W0VA 3V0LA 5D91A 3SPTA 2VS3A 2J0AA 1V82A 3CKQA 1XHBA 2PGVA 3POLA 3CKJA 1JV3A 1ZCYA 4FRAA 3N9WA 5C4EA 5C38A 1MP4A 2BO7A 1GQ9A 1ZCVA 3DJ4A 3I0GA 3RMVA 1H5TB 2RJ9A 2XWMA 1ZHJA 4HO2A 4EE5A 2JCKA 5CMHA 2RJ0A 1VZUA 2FYBA 2JCOA 1TW1A 2RJ4A 2FYAA 4CJCA 3QVBA 2W0WA 5CMIA 2ZU8A 3I0CA 1JV1A 3OH1A 4J18A 4B4MA 5C36A 1O0RA 3U2TA 4MIXA 1FXOA 1ZI1A 4JISA 2OEFA 2OEGA 2I5KA 1QWJA 2P72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1INJ A;  2MZB A;  4D0Z A;  5L6S A;  4P02 A;  2V0L A;  3R2W A;  3O3P A;  4NAN A;  5IDT A;  2P6W A;  1MC3 A;  1FR9 A;  5FTS A;  1GWW A;  1LVW A;  3SXG A;  4AYL A;  3OAM A;  1MP5 A;  2XWN A;  3T7N A;  1HM8 A;  3IOJ A;  2V0J A;  1H5R B;  1GX0 A;  2O1H A;  2VXM A;  5IFY A;  3D5N A;  3SX8 A;  4ECM A;  3FOQ A;  1FR8 A;  4FCE A;  4XWI A;  1H4E A;  1OMX A;  1TZF A;  2VSH A;  3DUV A;  1W55 A;  2E3D A;  4FRQ A;  2AGD A;  1O7O A;  3I0F A;  5I1F A;  3USR A;  4AC3 A;  1EZI A;  4KC2 A;  2V0I A;  1HJJ A;  2YQS A;  2I5E A;  2BO6 A;  4D0T A;  1LL3 A;  4FQW A;  4E1K A;  1G97 A;  2YC3 A;  1V84 A;  2ICX A;  5AJO A;  5FU0 A;  2AH9 A;  4DEC A;  2Q4J A;  4JD0 A;  4KC1 A;  2Y7A A;  2O1G A;  5AJP A;  3V8Z A;  3V8Y A;  4Y63 A;  1FRW A;  3SXA A;  3LW6 A;  2X5Z A;  1H7L A;  1WVC A;  1NMM B;  1IIN A;  2XME A;  3PNN A;  2AM4 A;  4FRB A;  4M2A A;  4YS8 A;  1WT1 A;  1VGU A;  5FTV A;  3OGZ A;  1G93 A;  1HV9 A;  4ASY A;  1R7X A;  5CQP A;  2Y4L A;  3BCV A;  2VS5 A;  1SS9 A;  5C4F A;  2P73 A;  2WGZ A;  2D0J A;  5IDS A;  5JQQ A;  1R7Y A;  4Y7G A;  3SX3 A;  3OH0 A;  1LZJ A;  2PX7 A;  4LW3 A;  2YQJ A;  2VFZ A;  2RIZ A;  1QGS A;  2RIY A;  5C8R A;  2RJ8 A;  3F1Y A;  5FU8 A;  2AES A;  4L41 C;  2QH5 A;  1GQC A;  2Z87 A;  1WT3 A;  3SXC A;  1VZT A;  1H3M A;  4K6R A;  1INI A;  5FV9 A;  3V0N A;  2I7B A;  2OI6 A;  5CQN X;  3SX7 A;  4EEM A;  3ZGF A;  5C1L A;  2A8W A;  4HO6 A;  1G0R A;  1ZJ2 A;  1FO8 A;  1H5S B;  3SX5 A;  1LZI A;  1H4D A;  5C4B A;  1ZI5 A;  3RSB A;  4MYB A;  2WVL A;  2D7I A;  5C1G A;  3U2W A;  5CMJ A;  1FO9 A;  4M28 A;  3PKQ A;  1H5S A;  4NAK A;  1ON6 A;  2OI7 A;  3TQD A;  2YCM A;  1YP3 A;  1Z90 A;  3DK5 A;  1JVG A;  2WAW A;  2YES A;  4Y7T A;  1ZJ0 A;  1R7U A;  3K8D A;  2V0K A;  2FFU A;  5C48 A;  3SXE A;  2WVM A;  2YC5 A;  4HO9 A;  3OH3 A;  4M2B A;  3U0Y A;  1JVD A;  1KWS A;  5C47 A;  1WSZ A;  4KQL A;  4Y64 A;  4DDZ A;  4KNX A;  1IIM A;  1JYK A;  1OMZ A;  3V0O A;  1FXJ A;  4M4K A;  4HO8 A;  3R3I A;  2YQH A;  1V83 A;  4D11 C;  5C3D A;  1ZI4 A;  1R82 A;  4EEG A;  4D11 A;  1O7Q A;  1G23 A;  4EVW A;  4KNR A;  2UX8 A;  3Q80 A;  3T7M A;  5AJN A;  5L6V A;  4ARW A;  2RJ6 A;  1H7G A;  5C49 A;  5C4D A;  1E5K A;  1ZJO A;  4HOC A;  4KXO A;  5EJZ A;  3BRK X;  3V0Q A;  2OI5 A;  3I0D A;  1FWY A;  2PA4 A;  4EEA A;  1R80 A;  1VGT A;  1H7F A;  4G3S A;  4EE3 A;  2FFV A;  2FY7 A;  3U2V A;  4ZDQ A;  1H4C A;  3I0J A;  1S4N A;  1NWG B;  4UEG A;  4G3P A;  1ZCU A;  1H7E A;  4Y6N A;  1H7Q A;  2ZU9 A;  4KT7 A;  1FZW A;  2VXL A;  2VD4 A;  3CKN A;  1O23 B;  2Y4K A;  1NKH B;  5EJ1 A;  4CJ8 A;  2DPW A;  1R7V A;  3JUJ A;  4Y7V A;  4FRO A;  2E8B A;  1S4P A;  1GX4 A;  4Y7U A;  2VS4 A;  3K8E A;  4B4G A;  3JUK A;  4HO0 A;  3ST8 A;  1VPA A;  1ZJ3 A;  3TZT A;  1G3L A;  1LZ7 A;  2O1F A;  3OC9 A;  1ZI3 A;  4MND A;  4GBP A;  2QKX A;  1VM8 A;  1PZY B;  3PKP A;  2AE7 A;  3OH2 A;  3U0X A;  2AM5 A;  5J49 A;  5CMF X;  1R81 A;  3ZF8 A;  3OKR A;  1VH1 A;  4BQH A;  2QGI A;  3NGW A;  5DDV A;  1NHE B;  1LL2 A;  3FWW A;  5HS2 A;  3I0L A;  1FGX A;  1WT2 A;  5C3B A;  3V91 A;  4FRE A;  4FRL A;  3CU0 A;  4CJB A;  2RJ1 A;  4HO3 A;  4KRV A;  2VSI A;  3I0E A;  1S4O A;  4HO4 A;  1FGG A;  1VZX A;  1H7T A;  3I0I X;  1H5S C;  1VGW A;  2FYD B;  4FCU A;  2JCL A;  1GA8 A;  4DE7 A;  1QGQ A;  5C1H A;  4FRH A;  3I0H A;  4D48 A;  1I52 A;  1YP2 A;  1NQI B;  2JCJ A;  1GWV A;  1HM0 A;  4AAW A;  1TW5 A;  1ZJP A;  4FRP A;  1H7H A;  4ASJ A;  1W57 A;  3CKV A;  1EYR A;  4NAL A;  1G9R A;  1ZDG A;  2RIX A;  3JTJ A;  4B2W A;  1MP3 A;  3D98 A;  4BMA A;  4EE4 A;  2WE9 A;  4B42 A;  5C4C A;  1G1L A;  4KC4 A;  3KIA A;  1YRO B;  1H5T A;  4B3U A;  4LW6 A;  1LZ0 A;  1R7T A;  3SXB A;  1ZJ1 A;  4FRM A;  1ZCT A;  3ZLL A;  4Y62 A;  3V0P A;  5DDT A;  2XMH A;  3HL3 A;  2CU2 A;  5FUH A;  4IRP A;  4HCQ A;  3F1C A;  5C3A A;  4G3Q A;  2WEE A;  3CKO A;  4G87 A;  4CVH A;  3E26 A;  2RIT A;  2APC A;  3GUE A;  4IRQ A;  2BO4 A;  2ICY A;  5CQO A;  2AM3 A;  2GGO A;  4B2X A;  3V90 A;  3T7O A;  2X65 A;  3ZLK A;  3D8V A;  3EE5 A;  1HM9 A;  2RJ5 A;  4Y9X A;  1H5R A;  2X60 A;  4KPX A;  1G95 A;  1LL0 A;  3U2X A;  2Z86 A;  4AYJ A;  3RMW A;  2FYC B;  4KPZ A;  1PZT A;  1ON8 A;  4NAI A;  3I0K A;  3CGX A;  1OQM B;  4Y6U A;  1ZDF A;  1G8O A;  3IOH A;  2ZU7 A;  4P00 A;  5FYE A;  4B5B A;  4EEO A;  5CQL X;  5CMG X;  1NF5 B;  1HJL A;  2BO8 A;  2V0H A;  4B4B A;  1VIC A;  3Q7U A;  3V0M A;  3Q4S A;  5EIY A;  2A8U A;  1H5S D;  4C2S A;  2RJ7 A;  2GGQ A;  1W77 A;  4R7P A;  5CQM X;  1G2V A;  2AEC A;  2XWL A;  3ZGG A;  1YP4 A;  1VH3 A;  1JYL A;  1XZ6 A;  2WVK A;  2YQC A;  2PGY A;  4HG6 A;  2Y4M A;  1K4V A;  2D7R A;  3OH4 A;  1WT0 A;  3SXD A;  1FG5 N;  4HO5 A;  2Y6P A;  1TVY A;  1FOA A;  3E25 A;  3U2U A;  4Y7F A;  1ZIZ A;  3USQ A;  1QG8 A;  3IOI A;  2X5S A;  4FRD A;  5BXC A;  1VGZ A;  2NXV A;  2Y4J A;  2W0V A;  3V0L A;  3SPT A;  2VS3 A;  1V82 A;  3CKQ A;  1XHB A;  2PGV A;  3POL A;  3CKJ A;  1JV3 A;  1ZCY A;  4FRA A;  3N9W A;  5C4E A;  5C38 A;  1MP4 A;  2BO7 A;  1GQ9 A;  1ZCV A;  3DJ4 A;  3I0G A;  3RMV A;  1H5T B;  2RJ9 A;  2XWM A;  1ZHJ A;  4HO2 A;  4EE5 A;  2JCK A;  5CMH A;  2RJ0 A;  1VZU A;  2FYB A;  2JCO A;  1TW1 A;  2RJ4 A;  2FYA A;  4CJC A;  3QVB A;  2W0W A;  5CMI A;  2ZU8 A;  3I0C A;  1JV1 A;  3OH1 A;  4J18 A;  4B4M A;  5C36 A;  1O0R A;  3U2T A;  1FXO A;  1ZI1 A;  4JIS A;  2OEF A;  2OEG A;  2I5K A;  1QWJ A;  2P72 A; 
#chains in the Genus database with same CATH topology
 1INJ A;  2MZB A;  4D0Z A;  5L6S A;  4P02 A;  2V0L A;  3R2W A;  3O3P A;  4NAN A;  5IDT A;  2P6W A;  2J0B A;  1MC3 A;  1FR9 A;  5FTS A;  1GWW A;  1LVW A;  3SXG A;  4AYL A;  3OAM A;  1MP5 A;  2XWN A;  3T7N A;  1HM8 A;  3IOJ A;  2V0J A;  1H5R B;  1GX0 A;  2O1H A;  2VXM A;  5IFY A;  3D5N A;  3SX8 A;  4ECM A;  3FOQ A;  1FR8 A;  4FCE A;  4XWI A;  1H4E A;  1OMX A;  1TZF A;  2VSH A;  3DUV A;  1W55 A;  2E3D A;  4FRQ A;  2AGD A;  1O7O A;  3I0F A;  5I1F A;  3USR A;  4AC3 A;  1EZI A;  4KC2 A;  2V0I A;  1HJJ A;  2YQS A;  2I5E A;  2BO6 A;  4D0T A;  1LL3 A;  4FQW A;  4E1K A;  1G97 A;  2YC3 A;  1V84 A;  2ICX A;  5AJO A;  5FU0 A;  2AH9 A;  4DEC A;  2Q4J A;  4JD0 A;  4KC1 A;  2Y7A A;  2O1G A;  5AJP A;  3V8Z A;  4FIX A;  3V8Y A;  4Y63 A;  1FRW A;  3SXA A;  3LW6 A;  2X5Z A;  1H7L A;  1WVC A;  1NMM B;  1IIN A;  2XME A;  3PNN A;  4FIY A;  2AM4 A;  4FRB A;  4M2A A;  4YS8 A;  1WT1 A;  1VGU A;  5FTV A;  3OGZ A;  1G93 A;  1HV9 A;  2C0N A;  4ASY A;  1R7X A;  5CQP A;  2Y4L A;  3BCV A;  2VS5 A;  1SS9 A;  5C4F A;  2P73 A;  2WGZ A;  2D0J A;  5IDS A;  5JQQ A;  1R7Y A;  4Y7G A;  3SX3 A;  3OH0 A;  1LZJ A;  2PX7 A;  4LW3 A;  2YQJ A;  2VFZ A;  2RIZ A;  1QGS A;  2RIY A;  5C8R A;  2RJ8 A;  3F1Y A;  5FU8 A;  2AES A;  4L41 C;  2QH5 A;  1GQC A;  2Z87 A;  1WT3 A;  3SXC A;  1VZT A;  1H3M A;  4K6R A;  1INI A;  5FV9 A;  3V0N A;  2I7B A;  2OI6 A;  5CQN X;  3SX7 A;  4EEM A;  3ZGF A;  5C1L A;  2A8W A;  4HO6 A;  1G0R A;  1ZJ2 A;  1FO8 A;  1H5S B;  3SX5 A;  1LZI A;  1H4D A;  5C4B A;  1ZI5 A;  3RSB A;  4MYB A;  2WVL A;  2D7I A;  5C1G A;  3U2W A;  5CMJ A;  1FO9 A;  4M28 A;  3PKQ A;  1H5S A;  4NAK A;  1ON6 A;  2OI7 A;  3TQD A;  2YCM A;  1YP3 A;  1Z90 A;  3DK5 A;  1JVG A;  2WAW A;  2YES A;  4Y7T A;  1ZJ0 A;  1R7U A;  3K8D A;  2V0K A;  2FFU A;  5C48 A;  3SXE A;  2WVM A;  2YC5 A;  4HO9 A;  3OH3 A;  4M2B A;  3U0Y A;  1JVD A;  1KWS A;  5C47 A;  1WSZ A;  4KQL A;  4Y64 A;  4DDZ A;  4KNX A;  1IIM A;  1JYK A;  1OMZ A;  3V0O A;  1FXJ A;  4M4K A;  4HO8 A;  3R3I A;  2YQH A;  1V83 A;  4D11 C;  5C3D A;  1ZI4 A;  1R82 A;  4EEG A;  4D11 A;  1O7Q A;  1G23 A;  4EVW A;  4KNR A;  2UX8 A;  3Q80 A;  3T7M A;  5AJN A;  5L6V A;  4ARW A;  2RJ6 A;  1H7G A;  5C49 A;  5C4D A;  1E5K A;  1ZJO A;  4HOC A;  4KXO A;  5EJZ A;  3BRK X;  3V0Q A;  2OI5 A;  3I0D A;  1FWY A;  2PA4 A;  4EEA A;  1R80 A;  1VGT A;  1H7F A;  4G3S A;  4EE3 A;  2FFV A;  2FY7 A;  3U2V A;  4ZDQ A;  1H4C A;  3I0J A;  1S4N A;  1NWG B;  4UEG A;  4G3P A;  1ZCU A;  1H7E A;  4Y6N A;  1H7Q A;  2ZU9 A;  4KT7 A;  1FZW A;  2VXL A;  2VD4 A;  3CKN A;  1O23 B;  2Y4K A;  1NKH B;  5EJ1 A;  4CJ8 A;  2DPW A;  1R7V A;  3JUJ A;  4Y7V A;  4FRO A;  2E8B A;  1S4P A;  1GX4 A;  4Y7U A;  2VS4 A;  3K8E A;  4B4G A;  3JUK A;  4HO0 A;  3ST8 A;  1VPA A;  1ZJ3 A;  3TZT A;  1G3L A;  1LZ7 A;  2O1F A;  3OC9 A;  1ZI3 A;  4MND A;  4GBP A;  2QKX A;  1VM8 A;  1PZY B;  3PKP A;  2AE7 A;  3OH2 A;  4O6N A;  3U0X A;  2AM5 A;  5J49 A;  5CMF X;  1R81 A;  3ZF8 A;  3OKR A;  1VH1 A;  4BQH A;  2QGI A;  3NGW A;  5DDV A;  1NHE B;  1LL2 A;  3FWW A;  5HS2 A;  3I0L A;  1FGX A;  1WT2 A;  5C3B A;  3V91 A;  4FRE A;  4FRL A;  3CU0 A;  4CJB A;  2RJ1 A;  4HO3 A;  4KRV A;  2VSI A;  3I0E A;  1S4O A;  4HO4 A;  1FGG A;  1VZX A;  1H7T A;  3I0I X;  1H5S C;  1VGW A;  2FYD B;  4FCU A;  2JCL A;  1GA8 A;  4DE7 A;  1QGQ A;  5C1H A;  4FRH A;  3I0H A;  4D48 A;  1I52 A;  1YP2 A;  1NQI B;  2JCJ A;  1GWV A;  1HM0 A;  4AAW A;  1TW5 A;  1ZJP A;  4FRP A;  1H7H A;  4ASJ A;  1W57 A;  3CKV A;  1EYR A;  4NAL A;  1G9R A;  4O6M A;  1ZDG A;  2RIX A;  3JTJ A;  4B2W A;  1MP3 A;  3D98 A;  4BMA A;  4EE4 A;  2WE9 A;  4B42 A;  4Q7C A;  5C4C A;  1G1L A;  4KC4 A;  3KIA A;  1YRO B;  1H5T A;  4B3U A;  4LW6 A;  1LZ0 A;  1R7T A;  3SXB A;  1ZJ1 A;  2VK9 A;  4FRM A;  1ZCT A;  3ZLL A;  4Y62 A;  3V0P A;  5DDT A;  2XMH A;  3HL3 A;  2CU2 A;  5FUH A;  4IRP A;  4HCQ A;  3F1C A;  5C3A A;  4G3Q A;  2WEE A;  3CKO A;  4G87 A;  4CVH A;  3E26 A;  2RIT A;  2APC A;  3GUE A;  4IRQ A;  2BO4 A;  2ICY A;  5CQO A;  2AM3 A;  2GGO A;  4B2X A;  3V90 A;  3T7O A;  2X65 A;  3ZLK A;  3D8V A;  3EE5 A;  1HM9 A;  2RJ5 A;  4Y9X A;  1H5R A;  2X60 A;  4KPX A;  1G95 A;  1LL0 A;  3U2X A;  2Z86 A;  4AYJ A;  3RMW A;  2FYC B;  4KPZ A;  1PZT A;  1ON8 A;  4NAI A;  3I0K A;  3CGX A;  5D92 A;  1OQM B;  4Y6U A;  1ZDF A;  1G8O A;  3IOH A;  2ZU7 A;  4P00 A;  5FYE A;  4B5B A;  4EEO A;  5CQL X;  5CMG X;  1NF5 B;  1HJL A;  2BO8 A;  2V0H A;  4B4B A;  1VIC A;  3Q7U A;  3V0M A;  3Q4S A;  5EIY A;  2A8U A;  1H5S D;  4C2S A;  2RJ7 A;  2GGQ A;  1W77 A;  4R7P A;  5CQM X;  1G2V A;  2AEC A;  2XWL A;  3ZGG A;  1YP4 A;  1VH3 A;  1JYL A;  1XZ6 A;  2WVK A;  2YQC A;  2PGY A;  4HG6 A;  2Y4M A;  1K4V A;  2D7R A;  3OH4 A;  1WT0 A;  3SXD A;  1FG5 N;  4HO5 A;  2Y6P A;  1TVY A;  1FOA A;  3E25 A;  3U2U A;  4Y7F A;  1ZIZ A;  3USQ A;  1QG8 A;  3IOI A;  2X5S A;  4FRD A;  5BXC A;  1VGZ A;  2NXV A;  2Y4J A;  2W0V A;  3V0L A;  5D91 A;  3SPT A;  2VS3 A;  2J0A A;  1V82 A;  3CKQ A;  1XHB A;  2PGV A;  3POL A;  3CKJ A;  1JV3 A;  1ZCY A;  4FRA A;  3N9W A;  5C4E A;  5C38 A;  1MP4 A;  2BO7 A;  1GQ9 A;  1ZCV A;  3DJ4 A;  3I0G A;  3RMV A;  1H5T B;  2RJ9 A;  2XWM A;  1ZHJ A;  4HO2 A;  4EE5 A;  2JCK A;  5CMH A;  2RJ0 A;  1VZU A;  2FYB A;  2JCO A;  1TW1 A;  2RJ4 A;  2FYA A;  4CJC A;  3QVB A;  2W0W A;  5CMI A;  2ZU8 A;  3I0C A;  1JV1 A;  3OH1 A;  4J18 A;  4B4M A;  5C36 A;  1O0R A;  3U2T A;  4MIX A;  1FXO A;  1ZI1 A;  4JIS A;  2OEF A;  2OEG A;  2I5K A;  1QWJ A;  2P72 A; 
#chains in the Genus database with same CATH homology
 1INJ A;  2MZB A;  4D0Z A;  5L6S A;  4P02 A;  2V0L A;  3R2W A;  3O3P A;  4NAN A;  5IDT A;  2P6W A;  2J0B A;  1MC3 A;  1FR9 A;  5FTS A;  1GWW A;  1LVW A;  3SXG A;  4AYL A;  3OAM A;  1MP5 A;  2XWN A;  3T7N A;  1HM8 A;  3IOJ A;  2V0J A;  1H5R B;  1GX0 A;  2O1H A;  2VXM A;  5IFY A;  3D5N A;  3SX8 A;  4ECM A;  3FOQ A;  1FR8 A;  4FCE A;  4XWI A;  1H4E A;  1OMX A;  1TZF A;  2VSH A;  3DUV A;  1W55 A;  2E3D A;  4FRQ A;  2AGD A;  1O7O A;  3I0F A;  5I1F A;  3USR A;  4AC3 A;  1EZI A;  4KC2 A;  2V0I A;  1HJJ A;  2YQS A;  2I5E A;  2BO6 A;  4D0T A;  1LL3 A;  4FQW A;  4E1K A;  1G97 A;  2YC3 A;  1V84 A;  2ICX A;  5AJO A;  5FU0 A;  2AH9 A;  4DEC A;  2Q4J A;  4JD0 A;  4KC1 A;  2Y7A A;  2O1G A;  5AJP A;  3V8Z A;  4FIX A;  3V8Y A;  4Y63 A;  1FRW A;  3SXA A;  3LW6 A;  2X5Z A;  1H7L A;  1WVC A;  1NMM B;  1IIN A;  2XME A;  3PNN A;  4FIY A;  2AM4 A;  4FRB A;  4M2A A;  4YS8 A;  1WT1 A;  1VGU A;  5FTV A;  3OGZ A;  1G93 A;  1HV9 A;  2C0N A;  4ASY A;  1R7X A;  5CQP A;  2Y4L A;  3BCV A;  2VS5 A;  1SS9 A;  5C4F A;  2P73 A;  2WGZ A;  2D0J A;  5IDS A;  5JQQ A;  1R7Y A;  4Y7G A;  3SX3 A;  3OH0 A;  1LZJ A;  2PX7 A;  4LW3 A;  2YQJ A;  2VFZ A;  2RIZ A;  1QGS A;  2RIY A;  5C8R A;  2RJ8 A;  3F1Y A;  5FU8 A;  2AES A;  4L41 C;  2QH5 A;  1GQC A;  2Z87 A;  1WT3 A;  3SXC A;  1VZT A;  1H3M A;  4K6R A;  1INI A;  5FV9 A;  3V0N A;  2I7B A;  2OI6 A;  5CQN X;  3SX7 A;  4EEM A;  3ZGF A;  5C1L A;  2A8W A;  4HO6 A;  1G0R A;  1ZJ2 A;  1FO8 A;  1H5S B;  3SX5 A;  1LZI A;  1H4D A;  5C4B A;  1ZI5 A;  3RSB A;  4MYB A;  2WVL A;  2D7I A;  5C1G A;  3U2W A;  5CMJ A;  1FO9 A;  4M28 A;  3PKQ A;  1H5S A;  4NAK A;  1ON6 A;  2OI7 A;  3TQD A;  2YCM A;  1YP3 A;  1Z90 A;  3DK5 A;  1JVG A;  2WAW A;  2YES A;  4Y7T A;  1ZJ0 A;  1R7U A;  3K8D A;  2V0K A;  2FFU A;  5C48 A;  3SXE A;  2WVM A;  2YC5 A;  4HO9 A;  3OH3 A;  4M2B A;  3U0Y A;  1JVD A;  1KWS A;  5C47 A;  1WSZ A;  4KQL A;  4Y64 A;  4DDZ A;  4KNX A;  1IIM A;  1JYK A;  1OMZ A;  3V0O A;  1FXJ A;  4M4K A;  4HO8 A;  3R3I A;  2YQH A;  1V83 A;  4D11 C;  5C3D A;  1ZI4 A;  1R82 A;  4EEG A;  4D11 A;  1O7Q A;  1G23 A;  4EVW A;  4KNR A;  2UX8 A;  3Q80 A;  3T7M A;  5AJN A;  5L6V A;  4ARW A;  2RJ6 A;  1H7G A;  5C49 A;  5C4D A;  1E5K A;  1ZJO A;  4HOC A;  4KXO A;  5EJZ A;  3BRK X;  3V0Q A;  2OI5 A;  3I0D A;  1FWY A;  2PA4 A;  4EEA A;  1R80 A;  1VGT A;  1H7F A;  4G3S A;  4EE3 A;  2FFV A;  2FY7 A;  3U2V A;  4ZDQ A;  1H4C A;  3I0J A;  1S4N A;  1NWG B;  4UEG A;  4G3P A;  1ZCU A;  1H7E A;  4Y6N A;  1H7Q A;  2ZU9 A;  4KT7 A;  1FZW A;  2VXL A;  2VD4 A;  3CKN A;  1O23 B;  2Y4K A;  1NKH B;  5EJ1 A;  4CJ8 A;  2DPW A;  1R7V A;  3JUJ A;  4Y7V A;  4FRO A;  2E8B A;  1S4P A;  1GX4 A;  4Y7U A;  2VS4 A;  3K8E A;  4B4G A;  3JUK A;  4HO0 A;  3ST8 A;  1VPA A;  1ZJ3 A;  3TZT A;  1G3L A;  1LZ7 A;  2O1F A;  3OC9 A;  1ZI3 A;  4MND A;  4GBP A;  2QKX A;  1VM8 A;  1PZY B;  3PKP A;  2AE7 A;  3OH2 A;  4O6N A;  3U0X A;  2AM5 A;  5J49 A;  5CMF X;  1R81 A;  3ZF8 A;  3OKR A;  1VH1 A;  4BQH A;  2QGI A;  3NGW A;  5DDV A;  1NHE B;  1LL2 A;  3FWW A;  5HS2 A;  3I0L A;  1FGX A;  1WT2 A;  5C3B A;  3V91 A;  4FRE A;  4FRL A;  3CU0 A;  4CJB A;  2RJ1 A;  4HO3 A;  4KRV A;  2VSI A;  3I0E A;  1S4O A;  4HO4 A;  1FGG A;  1VZX A;  1H7T A;  3I0I X;  1H5S C;  1VGW A;  2FYD B;  4FCU A;  2JCL A;  1GA8 A;  4DE7 A;  1QGQ A;  5C1H A;  4FRH A;  3I0H A;  4D48 A;  1I52 A;  1YP2 A;  1NQI B;  2JCJ A;  1GWV A;  1HM0 A;  4AAW A;  1TW5 A;  1ZJP A;  4FRP A;  1H7H A;  4ASJ A;  1W57 A;  3CKV A;  1EYR A;  4NAL A;  1G9R A;  4O6M A;  1ZDG A;  2RIX A;  3JTJ A;  4B2W A;  1MP3 A;  3D98 A;  4BMA A;  4EE4 A;  2WE9 A;  4B42 A;  4Q7C A;  5C4C A;  1G1L A;  4KC4 A;  3KIA A;  1YRO B;  1H5T A;  4B3U A;  4LW6 A;  1LZ0 A;  1R7T A;  3SXB A;  1ZJ1 A;  2VK9 A;  4FRM A;  1ZCT A;  3ZLL A;  4Y62 A;  3V0P A;  5DDT A;  2XMH A;  3HL3 A;  2CU2 A;  5FUH A;  4IRP A;  4HCQ A;  3F1C A;  5C3A A;  4G3Q A;  2WEE A;  3CKO A;  4G87 A;  4CVH A;  3E26 A;  2RIT A;  2APC A;  3GUE A;  4IRQ A;  2BO4 A;  2ICY A;  5CQO A;  2AM3 A;  2GGO A;  4B2X A;  3V90 A;  3T7O A;  2X65 A;  3ZLK A;  3D8V A;  3EE5 A;  1HM9 A;  2RJ5 A;  4Y9X A;  1H5R A;  2X60 A;  4KPX A;  1G95 A;  1LL0 A;  3U2X A;  2Z86 A;  4AYJ A;  3RMW A;  2FYC B;  4KPZ A;  1PZT A;  1ON8 A;  4NAI A;  3I0K A;  3CGX A;  5D92 A;  1OQM B;  4Y6U A;  1ZDF A;  1G8O A;  3IOH A;  2ZU7 A;  4P00 A;  5FYE A;  4B5B A;  4EEO A;  5CQL X;  5CMG X;  1NF5 B;  1HJL A;  2BO8 A;  2V0H A;  4B4B A;  1VIC A;  3Q7U A;  3V0M A;  3Q4S A;  5EIY A;  2A8U A;  1H5S D;  4C2S A;  2RJ7 A;  2GGQ A;  1W77 A;  4R7P A;  5CQM X;  1G2V A;  2AEC A;  2XWL A;  3ZGG A;  1YP4 A;  1VH3 A;  1JYL A;  1XZ6 A;  2WVK A;  2YQC A;  2PGY A;  4HG6 A;  2Y4M A;  1K4V A;  2D7R A;  3OH4 A;  1WT0 A;  3SXD A;  1FG5 N;  4HO5 A;  2Y6P A;  1TVY A;  1FOA A;  3E25 A;  3U2U A;  4Y7F A;  1ZIZ A;  3USQ A;  1QG8 A;  3IOI A;  2X5S A;  4FRD A;  5BXC A;  1VGZ A;  2NXV A;  2Y4J A;  2W0V A;  3V0L A;  5D91 A;  3SPT A;  2VS3 A;  2J0A A;  1V82 A;  3CKQ A;  1XHB A;  2PGV A;  3POL A;  3CKJ A;  1JV3 A;  1ZCY A;  4FRA A;  3N9W A;  5C4E A;  5C38 A;  1MP4 A;  2BO7 A;  1GQ9 A;  1ZCV A;  3DJ4 A;  3I0G A;  3RMV A;  1H5T B;  2RJ9 A;  2XWM A;  1ZHJ A;  4HO2 A;  4EE5 A;  2JCK A;  5CMH A;  2RJ0 A;  1VZU A;  2FYB A;  2JCO A;  1TW1 A;  2RJ4 A;  2FYA A;  4CJC A;  3QVB A;  2W0W A;  5CMI A;  2ZU8 A;  3I0C A;  1JV1 A;  3OH1 A;  4J18 A;  4B4M A;  5C36 A;  1O0R A;  3U2T A;  4MIX A;  1FXO A;  1ZI1 A;  4JIS A;  2OEF A;  2OEG A;  2I5K A;  1QWJ A;  2P72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...