1LZJA

Glycosyltransferase b + udp + h antigen acceptor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyltransferase B
publication title The structural basis for specificity in human ABO(H) blood group biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2002-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1lzjA00
2AH9A 3Q7UA 4G87A 1KWSA 2V0IA 2YQSA 1JYLA 2BO6A 1W77A 1TVYA 2BO8A 3OC9A 1WSZA 2ZU9A 1R81A 1H4DA 1HM0A 2RJ7A 3OKRA 3RMVA 4M28A 1OQMB 2V0HA 5C36A 3OH4A 3V0OA 2WE9A 1FGXA 1GQCA 3DJ4A 5CQNX 3USRA 1ZCUA 2Y4JA 4FRBA 2VSIA 4HCQA 1VZXA 1ZHJA 2AM3A 2APCA 3I0JA 5FU8A 5C4EA 5JQQA 2VFZA 5CQOA 1ZDGA 4B5BA 4Y9XA 1YP4A 3SX3A 1H7QA 2Y4KA 3I0GA 4BQHA 1WT1A 5C47A 3TZTA 2ICXA 1ZJOA 2ZU7A 3CKOA 4Y64A 4DECA 2V0KA 3U2WA 4DDZA 2I5KA 2Y4LA 1W57A 5C1HA 3SX8A 2WEEA 5C4BA 4B2XA 1GWVA 1VGTA 4KNRA 4B4BA 3U2UA 1LL2A 1MP4A 2JCOA 4HO3A 3SXDA 1G3LA 2XWNA 3ZGGA 1GQ9A 2OI7A 2RIXA 5CQPA 3ZGFA 3JUKA 1IIMA 2RJ5A 3OH1A 1XZ6A 1GA8A 2RJ9A 1H5SC 1VZUA 2VS3A 3OH2A 1I52A 3CU0A 3V0PA 1G0RA 1VGZA 1ZI1A 3I0DA 5C4CA 4NAKA 2BO7A 1S4OA 1INIA 2Y6PA 1JV1A 2XWMA 2ICYA 4Y7UA 3CKVA 2O1GA 2AM4A 2Y4MA 1NQIB 2NXVA 5C38A 4E1KA 1O7QA 3F1CA 3SXCA 4R7PA 4HOCA 1H7EA 4ECMA 1O7OA 1FXOA 1G93A 1LL3A 4CJ8A 2YC5A 4KPXA 5I1FA 1ZJ0A 3Q80A 2A8UA 4Y62A 2W0VA 1HM9A 5EJZA 3V0MA 1GX0A 4J18A 5J49A 3QVBA 2D7RA 2YQCA 4Y7GA 4KXOA 3T7MA 4IRPA 1VH1A 3O3PA 3V0QA 4LW6A 4AYLA 1EYRA 4XWIA 4HO0A 1WT2A 4FROA 4CJBA 2V0LA 3D5NA 3V91A 1FO9A 1FG5N 1LZ7A 1ZJPA 3OGZA 5FUHA 1H7TA 4DE7A 5C48A 3OAMA 1ON8A 1VGWA 2AM5A 2V0JA 3Q4SA 2PX7A 3PKPA 1R7UA 4Y6NA 3U0XA 2FFUA 1G1LA 4EE5A 4MNDA 1TZFA 3CGXA 2D0JA 2VSHA 2DPWA 1G2VA 4EE3A 4B42A 2QH5A 2RITA 2VXLA 5BXCA 1XHBA 5FTVA 1SS9A 3E26A 1FZWA 4FCEA 1PZYB 3U0YA 4EEGA 1INJA 3FOQA 3V90A 1R82A 2UX8A 2WVKA 2VXMA 5C4DA 1VM8A 1LL0A 3V0LA 1H7HA 5CMFX 2GGQA 4M2AA 5CMHA 3BRKX 1E5KA 2XWLA 4ASJA 1FR9A 4IRQA 1QGQA 5C3DA 3I0HA 4D48A 3T7NA 2WGZA 2Q4JA 5FYEA 2OEFA 4M2BA 5C3AA 5IDTA 4FCUA 1H7FA 3POLA 1HV9A 2FYBA 2OI5A 4D11A 2YQHA 2OI6A 1H5TA 1R7YA 3FWWA 3ZLLA 1G95A 3BCVA 2RJ4A 3RMWA 1G8OA 1FWYA 5C1GA 1OMXA 3ST8A 4KQLA 1PZTA 1QGSA 3E25A 2E3DA 4KPZA 1K4VA 2YCMA 3K8EA 3SX7A 1H5SB 4HO6A 4MYBA 5AJNA 5FU0A 2JCLA 4C2SA 5FV9A 1ZCYA 1ZIZA 3D98A 3R3IA 3SXEA 2X65A 4NANA 1NHEB 1VGUA 1ZI3A 1ZDFA 1MC3A 1WT0A 1ZJ1A 4D0TA 4Y63A 3I0EA 1ZCTA 2WAWA 3N9WA 2FYDB 2D7IA 4B4GA 4FREA 1JV3A 2X60A 2AECA 2X5ZA 2RIZA 5C4FA 4JD0A 1H5TB 2YQJA 4HO4A 1VPAA 4KNXA 3T7OA 3USQA 5CQLX 1ZCVA 1GWWA 4BMAA 1G9RA 1TW5A 4HO9A 4D0ZA 1MP3A 4K6RA 4M4KA 1V82A 4CVHA 2ZU8A 1MP5A 2Z86A 2AGDA 1Z90A 5C3BA 1NF5B 1LVWA 1ZJ3A 5L6VA 2Y7AA 2FYAA 5EIYA 1IINA 5HS2A 1OMZA 5DDTA 2FYCB 2PA4A 2Z87A 4EVWA 3I0CA 2RJ8A 1G97A 3CKQA 3IOHA 3OH0A 2P73A 3U2TA 5CMIA 4Y7FA 4JISA 3SXBA 3PKQA 1LZ0A 1FOAA 3D8VA 2JCJA 2QKXA 5L6SA 3SX5A 5C8RA 5AJPA 5CMGX 2YESA 4HO8A 3ZF8A 4HO2A 4FQWA 2OEGA 2W0WA 3OH3A 3I0FA 4KC4A 1R7XA 1S4PA 1QWJA 4KC1A 2VD4A 1FRWA 1R7TA 1JYKA 2O1HA 3V8ZA 1H5SA 1VICA 4EEAA 3V0NA 5FTSA 1JVDA 1LZJA 2PGVA 4Y7TA 2AE7A 1JVGA 1YP2A 4L41C 4Y6UA 4P00A 4HO5A 3F1YA 4NALA 2MZBA 1H5SD 5AJOA 1H5RA 2XMEA 1NWGB 1YROB 3JTJA 2I7BA 5CQMX 2PGYA 2FY7A 4B4MA 4FRDA 5EJ1A 2WVLA 1NKHB 3GUEA 5CMJA 1LZIA 3I0LA 2GGOA 3U2VA 1V84A 4FRHA 4G3SA 3K8DA 4NAIA 3TQDA 5C49A 2E8BA 1W55A 3IOIA 1WT3A 1ON6A 3NGWA 3PNNA 4FRAA 1HJJA 4FRQA 4FRLA 1YP3A 2O1FA 4KRVA 5C1LA 1ZI4A 1VZTA 2JCKA 2RJ6A 4ARWA 3SXGA 4ZDQA 1FXJA 1ZJ2A 2I5EA 4AYJA 3DUVA 1NMMB 4AC3A 4B3UA 4ASYA 4KT7A 2WVMA 5IDSA 1WVCA 1H3MA 3U2XA 2VS5A 3DK5A 1FO8A 2VS4A 3LW6A 3CKNA 4EE4A 2QGIA 2RJ1A 4KC2A 5DDVA 4EEOA 4FRMA 2BO4A 1H5RB 1H7GA 4FRPA 2P6WA 4YS8A 4EEMA 2RJ0A 1R7VA 4G3PA 4AAWA 1VH3A 3HL3A 1GX4A 3SXAA 3IOJA 3CKJA 1FGGA 4CJCA 3RSBA 4P02A 2RIYA 3SPTA 3V8YA 2FFVA 1ZI5A 1H4CA 2P72A 3KIAA 3JUJA 1H4EA 1G23A 2CU2A 4B2WA 2XMHA 4G3QA 4Y7VA 3I0KA 2AESA 2X5SA 4D11C 3ZLKA 2A8WA 4GBPA 1R80A 2YC3A 1FR8A 1HJLA 1EZIA 1HM8A 1S4NA 3I0IX 1O0RA 4HG6A 1TW1A 1H7LA 3EE5A 5IFYA 3R2WA 1V83A 4LW3A 1QG8A 1O23B 4UEGA
chains in the Genus database with same CATH superfamily
2AH9A 3Q7UA 5D91A 4FIYA 4G87A 1KWSA 2V0IA 2YQSA 1JYLA 2BO6A 1W77A 1TVYA 2BO8A 3OC9A 1WSZA 2ZU9A 1R81A 1H4DA 1HM0A 2RJ7A 3OKRA 3RMVA 4M28A 1OQMB 2V0HA 5C36A 3OH4A 3V0OA 2WE9A 1FGXA 2J0BA 1GQCA 3DJ4A 5CQNX 3USRA 1ZCUA 2Y4JA 4FRBA 2VSIA 4HCQA 1VZXA 1ZHJA 2AM3A 2APCA 3I0JA 5FU8A 5C4EA 5JQQA 2VFZA 5CQOA 1ZDGA 4B5BA 4Y9XA 1YP4A 3SX3A 1H7QA 2Y4KA 3I0GA 4BQHA 1WT1A 5C47A 3TZTA 2ICXA 1ZJOA 2ZU7A 3CKOA 4Y64A 4DECA 2V0KA 3U2WA 4DDZA 2I5KA 2Y4LA 4FIXA 1W57A 5C1HA 3SX8A 2WEEA 5C4BA 4B2XA 1GWVA 1VGTA 4KNRA 4B4BA 3U2UA 1LL2A 1MP4A 2JCOA 4HO3A 3SXDA 1G3LA 2XWNA 3ZGGA 1GQ9A 2OI7A 2RIXA 5CQPA 3ZGFA 3JUKA 1IIMA 2RJ5A 3OH1A 1XZ6A 1GA8A 2RJ9A 1H5SC 1VZUA 2VS3A 3OH2A 1I52A 3CU0A 3V0PA 1G0RA 1VGZA 1ZI1A 3I0DA 5C4CA 4NAKA 2BO7A 1S4OA 1INIA 2Y6PA 1JV1A 2XWMA 2ICYA 4Y7UA 3CKVA 2O1GA 2AM4A 2Y4MA 1NQIB 2NXVA 5C38A 4E1KA 1O7QA 3F1CA 3SXCA 4R7PA 4HOCA 1H7EA 4ECMA 1O7OA 1FXOA 1G93A 1LL3A 4CJ8A 2YC5A 4KPXA 5I1FA 1ZJ0A 3Q80A 2A8UA 4Y62A 2W0VA 4Q7CA 1HM9A 5EJZA 3V0MA 1GX0A 4J18A 5J49A 3QVBA 2D7RA 2YQCA 4Y7GA 4KXOA 3T7MA 4IRPA 1VH1A 3O3PA 3V0QA 4LW6A 4AYLA 1EYRA 4XWIA 4HO0A 1WT2A 4FROA 4CJBA 2V0LA 3D5NA 3V91A 1FO9A 1FG5N 1LZ7A 1ZJPA 3OGZA 5FUHA 1H7TA 4DE7A 5C48A 3OAMA 1ON8A 1VGWA 2AM5A 2V0JA 3Q4SA 2PX7A 3PKPA 1R7UA 4Y6NA 3U0XA 2FFUA 1G1LA 4EE5A 4MNDA 1TZFA 3CGXA 2D0JA 2VSHA 2DPWA 1G2VA 4EE3A 4B42A 2QH5A 2RITA 2VXLA 5BXCA 1XHBA 5FTVA 1SS9A 3E26A 1FZWA 4FCEA 1PZYB 3U0YA 4EEGA 1INJA 3FOQA 3V90A 1R82A 2UX8A 2WVKA 2VXMA 5C4DA 1VM8A 1LL0A 3V0LA 1H7HA 5CMFX 2GGQA 4M2AA 5CMHA 3BRKX 1E5KA 2XWLA 4ASJA 1FR9A 4IRQA 1QGQA 5C3DA 3I0HA 4D48A 3T7NA 2WGZA 2Q4JA 5FYEA 2OEFA 4M2BA 5C3AA 5IDTA 4FCUA 1H7FA 3POLA 1HV9A 2FYBA 2OI5A 4D11A 2YQHA 2OI6A 1H5TA 1R7YA 3FWWA 3ZLLA 1G95A 3BCVA 2RJ4A 3RMWA 1G8OA 1FWYA 5C1GA 1OMXA 3ST8A 4KQLA 1PZTA 1QGSA 3E25A 2E3DA 4KPZA 1K4VA 2YCMA 3K8EA 3SX7A 1H5SB 4HO6A 4MYBA 5AJNA 5FU0A 2JCLA 4C2SA 5FV9A 1ZCYA 1ZIZA 3D98A 3R3IA 3SXEA 2X65A 4NANA 1NHEB 1VGUA 1ZI3A 1ZDFA 1MC3A 1WT0A 1ZJ1A 4D0TA 4Y63A 3I0EA 1ZCTA 2WAWA 3N9WA 2FYDB 2D7IA 4B4GA 4FREA 1JV3A 2X60A 2AECA 2X5ZA 2RIZA 5C4FA 4JD0A 1H5TB 2YQJA 4HO4A 1VPAA 4KNXA 3T7OA 3USQA 5CQLX 1ZCVA 1GWWA 4BMAA 1G9RA 1TW5A 4HO9A 4D0ZA 1MP3A 4K6RA 4M4KA 1V82A 4CVHA 2ZU8A 1MP5A 2Z86A 2AGDA 1Z90A 5D92A 5C3BA 1NF5B 1LVWA 1ZJ3A 5L6VA 2Y7AA 2FYAA 5EIYA 1IINA 5HS2A 1OMZA 4O6MA 5DDTA 2FYCB 2PA4A 2Z87A 4EVWA 3I0CA 2RJ8A 1G97A 3CKQA 3IOHA 3OH0A 2P73A 3U2TA 5CMIA 4Y7FA 4JISA 3SXBA 3PKQA 1LZ0A 1FOAA 3D8VA 2JCJA 2QKXA 5L6SA 3SX5A 5C8RA 5AJPA 5CMGX 2YESA 4HO8A 3ZF8A 4HO2A 4FQWA 2OEGA 4O6NA 2W0WA 3OH3A 3I0FA 4KC4A 1R7XA 1S4PA 1QWJA 4KC1A 2VD4A 1FRWA 2J0AA 1R7TA 1JYKA 2O1HA 3V8ZA 1H5SA 1VICA 4EEAA 3V0NA 5FTSA 1JVDA 1LZJA 2PGVA 4Y7TA 2AE7A 2VK9A 1JVGA 1YP2A 4L41C 4Y6UA 4P00A 4HO5A 3F1YA 4NALA 2MZBA 1H5SD 5AJOA 1H5RA 2XMEA 1NWGB 1YROB 3JTJA 4MIXA 2I7BA 5CQMX 2PGYA 2FY7A 4B4MA 4FRDA 5EJ1A 2WVLA 1NKHB 3GUEA 5CMJA 1LZIA 3I0LA 2GGOA 3U2VA 1V84A 4FRHA 4G3SA 3K8DA 4NAIA 3TQDA 5C49A 2E8BA 1W55A 3IOIA 1WT3A 1ON6A 3NGWA 3PNNA 4FRAA 1HJJA 4FRQA 4FRLA 1YP3A 2O1FA 4KRVA 5C1LA 1ZI4A 1VZTA 2JCKA 2RJ6A 4ARWA 3SXGA 4ZDQA 1FXJA 1ZJ2A 2I5EA 4AYJA 3DUVA 1NMMB 4AC3A 4B3UA 4ASYA 4KT7A 2WVMA 5IDSA 1WVCA 1H3MA 3U2XA 2VS5A 3DK5A 1FO8A 2VS4A 3LW6A 3CKNA 4EE4A 2QGIA 2RJ1A 4KC2A 5DDVA 4EEOA 4FRMA 2BO4A 1H5RB 1H7GA 4FRPA 2P6WA 4YS8A 4EEMA 2RJ0A 1R7VA 4G3PA 4AAWA 1VH3A 3HL3A 1GX4A 3SXAA 3IOJA 3CKJA 1FGGA 4CJCA 3RSBA 4P02A 2RIYA 3SPTA 3V8YA 2FFVA 1ZI5A 1H4CA 2P72A 3KIAA 3JUJA 1H4EA 1G23A 2CU2A 4B2WA 2XMHA 4G3QA 4Y7VA 3I0KA 2AESA 2X5SA 4D11C 3ZLKA 2A8WA 4GBPA 1R80A 2YC3A 1FR8A 1HJLA 1EZIA 1HM8A 1S4NA 3I0IX 1O0RA 4HG6A 1TW1A 1H7LA 3EE5A 2C0NA 5IFYA 3R2WA 1V83A 4LW3A 1QG8A 1O23B 4UEGA
chains in the Genus database with same CATH topology
2AH9A 3Q7UA 5D91A 4FIYA 4G87A 1KWSA 2V0IA 2YQSA 1JYLA 2BO6A 1W77A 1TVYA 2BO8A 3OC9A 1WSZA 2ZU9A 1R81A 1H4DA 1HM0A 2RJ7A 3OKRA 3RMVA 4M28A 1OQMB 2V0HA 5C36A 3OH4A 3V0OA 2WE9A 1FGXA 2J0BA 1GQCA 3DJ4A 5CQNX 3USRA 1ZCUA 2Y4JA 4FRBA 2VSIA 4HCQA 1VZXA 1ZHJA 2AM3A 2APCA 3I0JA 5FU8A 5C4EA 5JQQA 2VFZA 5CQOA 1ZDGA 4B5BA 4Y9XA 1YP4A 3SX3A 1H7QA 2Y4KA 3I0GA 4BQHA 1WT1A 5C47A 3TZTA 2ICXA 1ZJOA 2ZU7A 3CKOA 4Y64A 4DECA 2V0KA 3U2WA 4DDZA 2I5KA 2Y4LA 4FIXA 1W57A 5C1HA 3SX8A 2WEEA 5C4BA 4B2XA 1GWVA 1VGTA 4KNRA 4B4BA 3U2UA 1LL2A 1MP4A 2JCOA 4HO3A 3SXDA 1G3LA 2XWNA 3ZGGA 1GQ9A 2OI7A 2RIXA 5CQPA 3ZGFA 3JUKA 1IIMA 2RJ5A 3OH1A 1XZ6A 1GA8A 2RJ9A 1H5SC 1VZUA 2VS3A 3OH2A 1I52A 3CU0A 3V0PA 1G0RA 1VGZA 1ZI1A 3I0DA 5C4CA 4NAKA 2BO7A 1S4OA 1INIA 2Y6PA 1JV1A 2XWMA 2ICYA 4Y7UA 3CKVA 2O1GA 2AM4A 2Y4MA 1NQIB 2NXVA 5C38A 4E1KA 1O7QA 3F1CA 3SXCA 4R7PA 4HOCA 1H7EA 4ECMA 1O7OA 1FXOA 1G93A 1LL3A 4CJ8A 2YC5A 4KPXA 5I1FA 1ZJ0A 3Q80A 2A8UA 4Y62A 2W0VA 4Q7CA 1HM9A 5EJZA 3V0MA 1GX0A 4J18A 5J49A 3QVBA 2D7RA 2YQCA 4Y7GA 4KXOA 3T7MA 4IRPA 1VH1A 3O3PA 3V0QA 4LW6A 4AYLA 1EYRA 4XWIA 4HO0A 1WT2A 4FROA 4CJBA 2V0LA 3D5NA 3V91A 1FO9A 1FG5N 1LZ7A 1ZJPA 3OGZA 5FUHA 1H7TA 4DE7A 5C48A 3OAMA 1ON8A 1VGWA 2AM5A 2V0JA 3Q4SA 2PX7A 3PKPA 1R7UA 4Y6NA 3U0XA 2FFUA 1G1LA 4EE5A 4MNDA 1TZFA 3CGXA 2D0JA 2VSHA 2DPWA 1G2VA 4EE3A 4B42A 2QH5A 2RITA 2VXLA 5BXCA 1XHBA 5FTVA 1SS9A 3E26A 1FZWA 4FCEA 1PZYB 3U0YA 4EEGA 1INJA 3FOQA 3V90A 1R82A 2UX8A 2WVKA 2VXMA 5C4DA 1VM8A 1LL0A 3V0LA 1H7HA 5CMFX 2GGQA 4M2AA 5CMHA 3BRKX 1E5KA 2XWLA 4ASJA 1FR9A 4IRQA 1QGQA 5C3DA 3I0HA 4D48A 3T7NA 2WGZA 2Q4JA 5FYEA 2OEFA 4M2BA 5C3AA 5IDTA 4FCUA 1H7FA 3POLA 1HV9A 2FYBA 2OI5A 4D11A 2YQHA 2OI6A 1H5TA 1R7YA 3FWWA 3ZLLA 1G95A 3BCVA 2RJ4A 3RMWA 1G8OA 1FWYA 5C1GA 1OMXA 3ST8A 4KQLA 1PZTA 1QGSA 3E25A 2E3DA 4KPZA 1K4VA 2YCMA 3K8EA 3SX7A 1H5SB 4HO6A 4MYBA 5AJNA 5FU0A 2JCLA 4C2SA 5FV9A 1ZCYA 1ZIZA 3D98A 3R3IA 3SXEA 2X65A 4NANA 1NHEB 1VGUA 1ZI3A 1ZDFA 1MC3A 1WT0A 1ZJ1A 4D0TA 4Y63A 3I0EA 1ZCTA 2WAWA 3N9WA 2FYDB 2D7IA 4B4GA 4FREA 1JV3A 2X60A 2AECA 2X5ZA 2RIZA 5C4FA 4JD0A 1H5TB 2YQJA 4HO4A 1VPAA 4KNXA 3T7OA 3USQA 5CQLX 1ZCVA 1GWWA 4BMAA 1G9RA 1TW5A 4HO9A 4D0ZA 1MP3A 4K6RA 4M4KA 1V82A 4CVHA 2ZU8A 1MP5A 2Z86A 2AGDA 1Z90A 5D92A 5C3BA 1NF5B 1LVWA 1ZJ3A 5L6VA 2Y7AA 2FYAA 5EIYA 1IINA 5HS2A 1OMZA 4O6MA 5DDTA 2FYCB 2PA4A 2Z87A 4EVWA 3I0CA 2RJ8A 1G97A 3CKQA 3IOHA 3OH0A 2P73A 3U2TA 5CMIA 4Y7FA 4JISA 3SXBA 3PKQA 1LZ0A 1FOAA 3D8VA 2JCJA 2QKXA 5L6SA 3SX5A 5C8RA 5AJPA 5CMGX 2YESA 4HO8A 3ZF8A 4HO2A 4FQWA 2OEGA 4O6NA 2W0WA 3OH3A 3I0FA 4KC4A 1R7XA 1S4PA 1QWJA 4KC1A 2VD4A 1FRWA 2J0AA 1R7TA 1JYKA 2O1HA 3V8ZA 1H5SA 1VICA 4EEAA 3V0NA 5FTSA 1JVDA 1LZJA 2PGVA 4Y7TA 2AE7A 2VK9A 1JVGA 1YP2A 4L41C 4Y6UA 4P00A 4HO5A 3F1YA 4NALA 2MZBA 1H5SD 5AJOA 1H5RA 2XMEA 1NWGB 1YROB 3JTJA 4MIXA 2I7BA 5CQMX 2PGYA 2FY7A 4B4MA 4FRDA 5EJ1A 2WVLA 1NKHB 3GUEA 5CMJA 1LZIA 3I0LA 2GGOA 3U2VA 1V84A 4FRHA 4G3SA 3K8DA 4NAIA 3TQDA 5C49A 2E8BA 1W55A 3IOIA 1WT3A 1ON6A 3NGWA 3PNNA 4FRAA 1HJJA 4FRQA 4FRLA 1YP3A 2O1FA 4KRVA 5C1LA 1ZI4A 1VZTA 2JCKA 2RJ6A 4ARWA 3SXGA 4ZDQA 1FXJA 1ZJ2A 2I5EA 4AYJA 3DUVA 1NMMB 4AC3A 4B3UA 4ASYA 4KT7A 2WVMA 5IDSA 1WVCA 1H3MA 3U2XA 2VS5A 3DK5A 1FO8A 2VS4A 3LW6A 3CKNA 4EE4A 2QGIA 2RJ1A 4KC2A 5DDVA 4EEOA 4FRMA 2BO4A 1H5RB 1H7GA 4FRPA 2P6WA 4YS8A 4EEMA 2RJ0A 1R7VA 4G3PA 4AAWA 1VH3A 3HL3A 1GX4A 3SXAA 3IOJA 3CKJA 1FGGA 4CJCA 3RSBA 4P02A 2RIYA 3SPTA 3V8YA 2FFVA 1ZI5A 1H4CA 2P72A 3KIAA 3JUJA 1H4EA 1G23A 2CU2A 4B2WA 2XMHA 4G3QA 4Y7VA 3I0KA 2AESA 2X5SA 4D11C 3ZLKA 2A8WA 4GBPA 1R80A 2YC3A 1FR8A 1HJLA 1EZIA 1HM8A 1S4NA 3I0IX 1O0RA 4HG6A 1TW1A 1H7LA 3EE5A 2C0NA 5IFYA 3R2WA 1V83A 4LW3A 1QG8A 1O23B 4UEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH9 A;  3Q7U A;  4G87 A;  1KWS A;  2V0I A;  2YQS A;  1JYL A;  2BO6 A;  1W77 A;  1TVY A;  2BO8 A;  3OC9 A;  1WSZ A;  2ZU9 A;  1R81 A;  1H4D A;  1HM0 A;  2RJ7 A;  3OKR A;  3RMV A;  4M28 A;  1OQM B;  2V0H A;  5C36 A;  3OH4 A;  3V0O A;  2WE9 A;  1FGX A;  1GQC A;  3DJ4 A;  5CQN X;  3USR A;  1ZCU A;  2Y4J A;  4FRB A;  2VSI A;  4HCQ A;  1VZX A;  1ZHJ A;  2AM3 A;  2APC A;  3I0J A;  5FU8 A;  5C4E A;  5JQQ A;  2VFZ A;  5CQO A;  1ZDG A;  4B5B A;  4Y9X A;  1YP4 A;  3SX3 A;  1H7Q A;  2Y4K A;  3I0G A;  4BQH A;  1WT1 A;  5C47 A;  3TZT A;  2ICX A;  1ZJO A;  2ZU7 A;  3CKO A;  4Y64 A;  4DEC A;  2V0K A;  3U2W A;  4DDZ A;  2I5K A;  2Y4L A;  1W57 A;  5C1H A;  3SX8 A;  2WEE A;  5C4B A;  4B2X A;  1GWV A;  1VGT A;  4KNR A;  4B4B A;  3U2U A;  1LL2 A;  1MP4 A;  2JCO A;  4HO3 A;  3SXD A;  1G3L A;  2XWN A;  3ZGG A;  1GQ9 A;  2OI7 A;  2RIX A;  5CQP A;  3ZGF A;  3JUK A;  1IIM A;  2RJ5 A;  3OH1 A;  1XZ6 A;  1GA8 A;  2RJ9 A;  1H5S C;  1VZU A;  2VS3 A;  3OH2 A;  1I52 A;  3CU0 A;  3V0P A;  1G0R A;  1VGZ A;  1ZI1 A;  3I0D A;  5C4C A;  4NAK A;  2BO7 A;  1S4O A;  1INI A;  2Y6P A;  1JV1 A;  2XWM A;  2ICY A;  4Y7U A;  3CKV A;  2O1G A;  2AM4 A;  2Y4M A;  1NQI B;  2NXV A;  5C38 A;  4E1K A;  1O7Q A;  3F1C A;  3SXC A;  4R7P A;  4HOC A;  1H7E A;  4ECM A;  1O7O A;  1FXO A;  1G93 A;  1LL3 A;  4CJ8 A;  2YC5 A;  4KPX A;  5I1F A;  1ZJ0 A;  3Q80 A;  2A8U A;  4Y62 A;  2W0V A;  1HM9 A;  5EJZ A;  3V0M A;  1GX0 A;  4J18 A;  5J49 A;  3QVB A;  2D7R A;  2YQC A;  4Y7G A;  4KXO A;  3T7M A;  4IRP A;  1VH1 A;  3O3P A;  3V0Q A;  4LW6 A;  4AYL A;  1EYR A;  4XWI A;  4HO0 A;  1WT2 A;  4FRO A;  4CJB A;  2V0L A;  3D5N A;  3V91 A;  1FO9 A;  1FG5 N;  1LZ7 A;  1ZJP A;  3OGZ A;  5FUH A;  1H7T A;  4DE7 A;  5C48 A;  3OAM A;  1ON8 A;  1VGW A;  2AM5 A;  2V0J A;  3Q4S A;  2PX7 A;  3PKP A;  1R7U A;  4Y6N A;  3U0X A;  2FFU A;  1G1L A;  4EE5 A;  4MND A;  1TZF A;  3CGX A;  2D0J A;  2VSH A;  2DPW A;  1G2V A;  4EE3 A;  4B42 A;  2QH5 A;  2RIT A;  2VXL A;  5BXC A;  1XHB A;  5FTV A;  1SS9 A;  3E26 A;  1FZW A;  4FCE A;  1PZY B;  3U0Y A;  4EEG A;  1INJ A;  3FOQ A;  3V90 A;  1R82 A;  2UX8 A;  2WVK A;  2VXM A;  5C4D A;  1VM8 A;  1LL0 A;  3V0L A;  1H7H A;  5CMF X;  2GGQ A;  4M2A A;  5CMH A;  3BRK X;  1E5K A;  2XWL A;  4ASJ A;  1FR9 A;  4IRQ A;  1QGQ A;  5C3D A;  3I0H A;  4D48 A;  3T7N A;  2WGZ A;  2Q4J A;  5FYE A;  2OEF A;  4M2B A;  5C3A A;  5IDT A;  4FCU A;  1H7F A;  3POL A;  1HV9 A;  2FYB A;  2OI5 A;  4D11 A;  2YQH A;  2OI6 A;  1H5T A;  1R7Y A;  3FWW A;  3ZLL A;  1G95 A;  3BCV A;  2RJ4 A;  3RMW A;  1G8O A;  1FWY A;  5C1G A;  1OMX A;  3ST8 A;  4KQL A;  1PZT A;  1QGS A;  3E25 A;  2E3D A;  4KPZ A;  1K4V A;  2YCM A;  3K8E A;  3SX7 A;  1H5S B;  4HO6 A;  4MYB A;  5AJN A;  5FU0 A;  2JCL A;  4C2S A;  5FV9 A;  1ZCY A;  1ZIZ A;  3D98 A;  3R3I A;  3SXE A;  2X65 A;  4NAN A;  1NHE B;  1VGU A;  1ZI3 A;  1ZDF A;  1MC3 A;  1WT0 A;  1ZJ1 A;  4D0T A;  4Y63 A;  3I0E A;  1ZCT A;  2WAW A;  3N9W A;  2FYD B;  2D7I A;  4B4G A;  4FRE A;  1JV3 A;  2X60 A;  2AEC A;  2X5Z A;  2RIZ A;  5C4F A;  4JD0 A;  1H5T B;  2YQJ A;  4HO4 A;  1VPA A;  4KNX A;  3T7O A;  3USQ A;  5CQL X;  1ZCV A;  1GWW A;  4BMA A;  1G9R A;  1TW5 A;  4HO9 A;  4D0Z A;  1MP3 A;  4K6R A;  4M4K A;  1V82 A;  4CVH A;  2ZU8 A;  1MP5 A;  2Z86 A;  2AGD A;  1Z90 A;  5C3B A;  1NF5 B;  1LVW A;  1ZJ3 A;  5L6V A;  2Y7A A;  2FYA A;  5EIY A;  1IIN A;  5HS2 A;  1OMZ A;  5DDT A;  2FYC B;  2PA4 A;  2Z87 A;  4EVW A;  3I0C A;  2RJ8 A;  1G97 A;  3CKQ A;  3IOH A;  3OH0 A;  2P73 A;  3U2T A;  5CMI A;  4Y7F A;  4JIS A;  3SXB A;  3PKQ A;  1LZ0 A;  1FOA A;  3D8V A;  2JCJ A;  2QKX A;  5L6S A;  3SX5 A;  5C8R A;  5AJP A;  5CMG X;  2YES A;  4HO8 A;  3ZF8 A;  4HO2 A;  4FQW A;  2OEG A;  2W0W A;  3OH3 A;  3I0F A;  4KC4 A;  1R7X A;  1S4P A;  1QWJ A;  4KC1 A;  2VD4 A;  1FRW A;  1R7T A;  1JYK A;  2O1H A;  3V8Z A;  1H5S A;  1VIC A;  4EEA A;  3V0N A;  5FTS A;  1JVD A;  1LZJ A;  2PGV A;  4Y7T A;  2AE7 A;  1JVG A;  1YP2 A;  4L41 C;  4Y6U A;  4P00 A;  4HO5 A;  3F1Y A;  4NAL A;  2MZB A;  1H5S D;  5AJO A;  1H5R A;  2XME A;  1NWG B;  1YRO B;  3JTJ A;  2I7B A;  5CQM X;  2PGY A;  2FY7 A;  4B4M A;  4FRD A;  5EJ1 A;  2WVL A;  1NKH B;  3GUE A;  5CMJ A;  1LZI A;  3I0L A;  2GGO A;  3U2V A;  1V84 A;  4FRH A;  4G3S A;  3K8D A;  4NAI A;  3TQD A;  5C49 A;  2E8B A;  1W55 A;  3IOI A;  1WT3 A;  1ON6 A;  3NGW A;  3PNN A;  4FRA A;  1HJJ A;  4FRQ A;  4FRL A;  1YP3 A;  2O1F A;  4KRV A;  5C1L A;  1ZI4 A;  1VZT A;  2JCK A;  2RJ6 A;  4ARW A;  3SXG A;  4ZDQ A;  1FXJ A;  1ZJ2 A;  2I5E A;  4AYJ A;  3DUV A;  1NMM B;  4AC3 A;  4B3U A;  4ASY A;  4KT7 A;  2WVM A;  5IDS A;  1WVC A;  1H3M A;  3U2X A;  2VS5 A;  3DK5 A;  1FO8 A;  2VS4 A;  3LW6 A;  3CKN A;  4EE4 A;  2QGI A;  2RJ1 A;  4KC2 A;  5DDV A;  4EEO A;  4FRM A;  2BO4 A;  1H5R B;  1H7G A;  4FRP A;  2P6W A;  4YS8 A;  4EEM A;  2RJ0 A;  1R7V A;  4G3P A;  4AAW A;  1VH3 A;  3HL3 A;  1GX4 A;  3SXA A;  3IOJ A;  3CKJ A;  1FGG A;  4CJC A;  3RSB A;  4P02 A;  2RIY A;  3SPT A;  3V8Y A;  2FFV A;  1ZI5 A;  1H4C A;  2P72 A;  3KIA A;  3JUJ A;  1H4E A;  1G23 A;  2CU2 A;  4B2W A;  2XMH A;  4G3Q A;  4Y7V A;  3I0K A;  2AES A;  2X5S A;  4D11 C;  3ZLK A;  2A8W A;  4GBP A;  1R80 A;  2YC3 A;  1FR8 A;  1HJL A;  1EZI A;  1HM8 A;  1S4N A;  3I0I X;  1O0R A;  4HG6 A;  1TW1 A;  1H7L A;  3EE5 A;  5IFY A;  3R2W A;  1V83 A;  4LW3 A;  1QG8 A;  1O23 B;  4UEG A; 
#chains in the Genus database with same CATH topology
 2AH9 A;  3Q7U A;  5D91 A;  4FIY A;  4G87 A;  1KWS A;  2V0I A;  2YQS A;  1JYL A;  2BO6 A;  1W77 A;  1TVY A;  2BO8 A;  3OC9 A;  1WSZ A;  2ZU9 A;  1R81 A;  1H4D A;  1HM0 A;  2RJ7 A;  3OKR A;  3RMV A;  4M28 A;  1OQM B;  2V0H A;  5C36 A;  3OH4 A;  3V0O A;  2WE9 A;  1FGX A;  2J0B A;  1GQC A;  3DJ4 A;  5CQN X;  3USR A;  1ZCU A;  2Y4J A;  4FRB A;  2VSI A;  4HCQ A;  1VZX A;  1ZHJ A;  2AM3 A;  2APC A;  3I0J A;  5FU8 A;  5C4E A;  5JQQ A;  2VFZ A;  5CQO A;  1ZDG A;  4B5B A;  4Y9X A;  1YP4 A;  3SX3 A;  1H7Q A;  2Y4K A;  3I0G A;  4BQH A;  1WT1 A;  5C47 A;  3TZT A;  2ICX A;  1ZJO A;  2ZU7 A;  3CKO A;  4Y64 A;  4DEC A;  2V0K A;  3U2W A;  4DDZ A;  2I5K A;  2Y4L A;  4FIX A;  1W57 A;  5C1H A;  3SX8 A;  2WEE A;  5C4B A;  4B2X A;  1GWV A;  1VGT A;  4KNR A;  4B4B A;  3U2U A;  1LL2 A;  1MP4 A;  2JCO A;  4HO3 A;  3SXD A;  1G3L A;  2XWN A;  3ZGG A;  1GQ9 A;  2OI7 A;  2RIX A;  5CQP A;  3ZGF A;  3JUK A;  1IIM A;  2RJ5 A;  3OH1 A;  1XZ6 A;  1GA8 A;  2RJ9 A;  1H5S C;  1VZU A;  2VS3 A;  3OH2 A;  1I52 A;  3CU0 A;  3V0P A;  1G0R A;  1VGZ A;  1ZI1 A;  3I0D A;  5C4C A;  4NAK A;  2BO7 A;  1S4O A;  1INI A;  2Y6P A;  1JV1 A;  2XWM A;  2ICY A;  4Y7U A;  3CKV A;  2O1G A;  2AM4 A;  2Y4M A;  1NQI B;  2NXV A;  5C38 A;  4E1K A;  1O7Q A;  3F1C A;  3SXC A;  4R7P A;  4HOC A;  1H7E A;  4ECM A;  1O7O A;  1FXO A;  1G93 A;  1LL3 A;  4CJ8 A;  2YC5 A;  4KPX A;  5I1F A;  1ZJ0 A;  3Q80 A;  2A8U A;  4Y62 A;  2W0V A;  4Q7C A;  1HM9 A;  5EJZ A;  3V0M A;  1GX0 A;  4J18 A;  5J49 A;  3QVB A;  2D7R A;  2YQC A;  4Y7G A;  4KXO A;  3T7M A;  4IRP A;  1VH1 A;  3O3P A;  3V0Q A;  4LW6 A;  4AYL A;  1EYR A;  4XWI A;  4HO0 A;  1WT2 A;  4FRO A;  4CJB A;  2V0L A;  3D5N A;  3V91 A;  1FO9 A;  1FG5 N;  1LZ7 A;  1ZJP A;  3OGZ A;  5FUH A;  1H7T A;  4DE7 A;  5C48 A;  3OAM A;  1ON8 A;  1VGW A;  2AM5 A;  2V0J A;  3Q4S A;  2PX7 A;  3PKP A;  1R7U A;  4Y6N A;  3U0X A;  2FFU A;  1G1L A;  4EE5 A;  4MND A;  1TZF A;  3CGX A;  2D0J A;  2VSH A;  2DPW A;  1G2V A;  4EE3 A;  4B42 A;  2QH5 A;  2RIT A;  2VXL A;  5BXC A;  1XHB A;  5FTV A;  1SS9 A;  3E26 A;  1FZW A;  4FCE A;  1PZY B;  3U0Y A;  4EEG A;  1INJ A;  3FOQ A;  3V90 A;  1R82 A;  2UX8 A;  2WVK A;  2VXM A;  5C4D A;  1VM8 A;  1LL0 A;  3V0L A;  1H7H A;  5CMF X;  2GGQ A;  4M2A A;  5CMH A;  3BRK X;  1E5K A;  2XWL A;  4ASJ A;  1FR9 A;  4IRQ A;  1QGQ A;  5C3D A;  3I0H A;  4D48 A;  3T7N A;  2WGZ A;  2Q4J A;  5FYE A;  2OEF A;  4M2B A;  5C3A A;  5IDT A;  4FCU A;  1H7F A;  3POL A;  1HV9 A;  2FYB A;  2OI5 A;  4D11 A;  2YQH A;  2OI6 A;  1H5T A;  1R7Y A;  3FWW A;  3ZLL A;  1G95 A;  3BCV A;  2RJ4 A;  3RMW A;  1G8O A;  1FWY A;  5C1G A;  1OMX A;  3ST8 A;  4KQL A;  1PZT A;  1QGS A;  3E25 A;  2E3D A;  4KPZ A;  1K4V A;  2YCM A;  3K8E A;  3SX7 A;  1H5S B;  4HO6 A;  4MYB A;  5AJN A;  5FU0 A;  2JCL A;  4C2S A;  5FV9 A;  1ZCY A;  1ZIZ A;  3D98 A;  3R3I A;  3SXE A;  2X65 A;  4NAN A;  1NHE B;  1VGU A;  1ZI3 A;  1ZDF A;  1MC3 A;  1WT0 A;  1ZJ1 A;  4D0T A;  4Y63 A;  3I0E A;  1ZCT A;  2WAW A;  3N9W A;  2FYD B;  2D7I A;  4B4G A;  4FRE A;  1JV3 A;  2X60 A;  2AEC A;  2X5Z A;  2RIZ A;  5C4F A;  4JD0 A;  1H5T B;  2YQJ A;  4HO4 A;  1VPA A;  4KNX A;  3T7O A;  3USQ A;  5CQL X;  1ZCV A;  1GWW A;  4BMA A;  1G9R A;  1TW5 A;  4HO9 A;  4D0Z A;  1MP3 A;  4K6R A;  4M4K A;  1V82 A;  4CVH A;  2ZU8 A;  1MP5 A;  2Z86 A;  2AGD A;  1Z90 A;  5D92 A;  5C3B A;  1NF5 B;  1LVW A;  1ZJ3 A;  5L6V A;  2Y7A A;  2FYA A;  5EIY A;  1IIN A;  5HS2 A;  1OMZ A;  4O6M A;  5DDT A;  2FYC B;  2PA4 A;  2Z87 A;  4EVW A;  3I0C A;  2RJ8 A;  1G97 A;  3CKQ A;  3IOH A;  3OH0 A;  2P73 A;  3U2T A;  5CMI A;  4Y7F A;  4JIS A;  3SXB A;  3PKQ A;  1LZ0 A;  1FOA A;  3D8V A;  2JCJ A;  2QKX A;  5L6S A;  3SX5 A;  5C8R A;  5AJP A;  5CMG X;  2YES A;  4HO8 A;  3ZF8 A;  4HO2 A;  4FQW A;  2OEG A;  4O6N A;  2W0W A;  3OH3 A;  3I0F A;  4KC4 A;  1R7X A;  1S4P A;  1QWJ A;  4KC1 A;  2VD4 A;  1FRW A;  2J0A A;  1R7T A;  1JYK A;  2O1H A;  3V8Z A;  1H5S A;  1VIC A;  4EEA A;  3V0N A;  5FTS A;  1JVD A;  1LZJ A;  2PGV A;  4Y7T A;  2AE7 A;  2VK9 A;  1JVG A;  1YP2 A;  4L41 C;  4Y6U A;  4P00 A;  4HO5 A;  3F1Y A;  4NAL A;  2MZB A;  1H5S D;  5AJO A;  1H5R A;  2XME A;  1NWG B;  1YRO B;  3JTJ A;  4MIX A;  2I7B A;  5CQM X;  2PGY A;  2FY7 A;  4B4M A;  4FRD A;  5EJ1 A;  2WVL A;  1NKH B;  3GUE A;  5CMJ A;  1LZI A;  3I0L A;  2GGO A;  3U2V A;  1V84 A;  4FRH A;  4G3S A;  3K8D A;  4NAI A;  3TQD A;  5C49 A;  2E8B A;  1W55 A;  3IOI A;  1WT3 A;  1ON6 A;  3NGW A;  3PNN A;  4FRA A;  1HJJ A;  4FRQ A;  4FRL A;  1YP3 A;  2O1F A;  4KRV A;  5C1L A;  1ZI4 A;  1VZT A;  2JCK A;  2RJ6 A;  4ARW A;  3SXG A;  4ZDQ A;  1FXJ A;  1ZJ2 A;  2I5E A;  4AYJ A;  3DUV A;  1NMM B;  4AC3 A;  4B3U A;  4ASY A;  4KT7 A;  2WVM A;  5IDS A;  1WVC A;  1H3M A;  3U2X A;  2VS5 A;  3DK5 A;  1FO8 A;  2VS4 A;  3LW6 A;  3CKN A;  4EE4 A;  2QGI A;  2RJ1 A;  4KC2 A;  5DDV A;  4EEO A;  4FRM A;  2BO4 A;  1H5R B;  1H7G A;  4FRP A;  2P6W A;  4YS8 A;  4EEM A;  2RJ0 A;  1R7V A;  4G3P A;  4AAW A;  1VH3 A;  3HL3 A;  1GX4 A;  3SXA A;  3IOJ A;  3CKJ A;  1FGG A;  4CJC A;  3RSB A;  4P02 A;  2RIY A;  3SPT A;  3V8Y A;  2FFV A;  1ZI5 A;  1H4C A;  2P72 A;  3KIA A;  3JUJ A;  1H4E A;  1G23 A;  2CU2 A;  4B2W A;  2XMH A;  4G3Q A;  4Y7V A;  3I0K A;  2AES A;  2X5S A;  4D11 C;  3ZLK A;  2A8W A;  4GBP A;  1R80 A;  2YC3 A;  1FR8 A;  1HJL A;  1EZI A;  1HM8 A;  1S4N A;  3I0I X;  1O0R A;  4HG6 A;  1TW1 A;  1H7L A;  3EE5 A;  2C0N A;  5IFY A;  3R2W A;  1V83 A;  4LW3 A;  1QG8 A;  1O23 B;  4UEG A; 
#chains in the Genus database with same CATH homology
 2AH9 A;  3Q7U A;  5D91 A;  4FIY A;  4G87 A;  1KWS A;  2V0I A;  2YQS A;  1JYL A;  2BO6 A;  1W77 A;  1TVY A;  2BO8 A;  3OC9 A;  1WSZ A;  2ZU9 A;  1R81 A;  1H4D A;  1HM0 A;  2RJ7 A;  3OKR A;  3RMV A;  4M28 A;  1OQM B;  2V0H A;  5C36 A;  3OH4 A;  3V0O A;  2WE9 A;  1FGX A;  2J0B A;  1GQC A;  3DJ4 A;  5CQN X;  3USR A;  1ZCU A;  2Y4J A;  4FRB A;  2VSI A;  4HCQ A;  1VZX A;  1ZHJ A;  2AM3 A;  2APC A;  3I0J A;  5FU8 A;  5C4E A;  5JQQ A;  2VFZ A;  5CQO A;  1ZDG A;  4B5B A;  4Y9X A;  1YP4 A;  3SX3 A;  1H7Q A;  2Y4K A;  3I0G A;  4BQH A;  1WT1 A;  5C47 A;  3TZT A;  2ICX A;  1ZJO A;  2ZU7 A;  3CKO A;  4Y64 A;  4DEC A;  2V0K A;  3U2W A;  4DDZ A;  2I5K A;  2Y4L A;  4FIX A;  1W57 A;  5C1H A;  3SX8 A;  2WEE A;  5C4B A;  4B2X A;  1GWV A;  1VGT A;  4KNR A;  4B4B A;  3U2U A;  1LL2 A;  1MP4 A;  2JCO A;  4HO3 A;  3SXD A;  1G3L A;  2XWN A;  3ZGG A;  1GQ9 A;  2OI7 A;  2RIX A;  5CQP A;  3ZGF A;  3JUK A;  1IIM A;  2RJ5 A;  3OH1 A;  1XZ6 A;  1GA8 A;  2RJ9 A;  1H5S C;  1VZU A;  2VS3 A;  3OH2 A;  1I52 A;  3CU0 A;  3V0P A;  1G0R A;  1VGZ A;  1ZI1 A;  3I0D A;  5C4C A;  4NAK A;  2BO7 A;  1S4O A;  1INI A;  2Y6P A;  1JV1 A;  2XWM A;  2ICY A;  4Y7U A;  3CKV A;  2O1G A;  2AM4 A;  2Y4M A;  1NQI B;  2NXV A;  5C38 A;  4E1K A;  1O7Q A;  3F1C A;  3SXC A;  4R7P A;  4HOC A;  1H7E A;  4ECM A;  1O7O A;  1FXO A;  1G93 A;  1LL3 A;  4CJ8 A;  2YC5 A;  4KPX A;  5I1F A;  1ZJ0 A;  3Q80 A;  2A8U A;  4Y62 A;  2W0V A;  4Q7C A;  1HM9 A;  5EJZ A;  3V0M A;  1GX0 A;  4J18 A;  5J49 A;  3QVB A;  2D7R A;  2YQC A;  4Y7G A;  4KXO A;  3T7M A;  4IRP A;  1VH1 A;  3O3P A;  3V0Q A;  4LW6 A;  4AYL A;  1EYR A;  4XWI A;  4HO0 A;  1WT2 A;  4FRO A;  4CJB A;  2V0L A;  3D5N A;  3V91 A;  1FO9 A;  1FG5 N;  1LZ7 A;  1ZJP A;  3OGZ A;  5FUH A;  1H7T A;  4DE7 A;  5C48 A;  3OAM A;  1ON8 A;  1VGW A;  2AM5 A;  2V0J A;  3Q4S A;  2PX7 A;  3PKP A;  1R7U A;  4Y6N A;  3U0X A;  2FFU A;  1G1L A;  4EE5 A;  4MND A;  1TZF A;  3CGX A;  2D0J A;  2VSH A;  2DPW A;  1G2V A;  4EE3 A;  4B42 A;  2QH5 A;  2RIT A;  2VXL A;  5BXC A;  1XHB A;  5FTV A;  1SS9 A;  3E26 A;  1FZW A;  4FCE A;  1PZY B;  3U0Y A;  4EEG A;  1INJ A;  3FOQ A;  3V90 A;  1R82 A;  2UX8 A;  2WVK A;  2VXM A;  5C4D A;  1VM8 A;  1LL0 A;  3V0L A;  1H7H A;  5CMF X;  2GGQ A;  4M2A A;  5CMH A;  3BRK X;  1E5K A;  2XWL A;  4ASJ A;  1FR9 A;  4IRQ A;  1QGQ A;  5C3D A;  3I0H A;  4D48 A;  3T7N A;  2WGZ A;  2Q4J A;  5FYE A;  2OEF A;  4M2B A;  5C3A A;  5IDT A;  4FCU A;  1H7F A;  3POL A;  1HV9 A;  2FYB A;  2OI5 A;  4D11 A;  2YQH A;  2OI6 A;  1H5T A;  1R7Y A;  3FWW A;  3ZLL A;  1G95 A;  3BCV A;  2RJ4 A;  3RMW A;  1G8O A;  1FWY A;  5C1G A;  1OMX A;  3ST8 A;  4KQL A;  1PZT A;  1QGS A;  3E25 A;  2E3D A;  4KPZ A;  1K4V A;  2YCM A;  3K8E A;  3SX7 A;  1H5S B;  4HO6 A;  4MYB A;  5AJN A;  5FU0 A;  2JCL A;  4C2S A;  5FV9 A;  1ZCY A;  1ZIZ A;  3D98 A;  3R3I A;  3SXE A;  2X65 A;  4NAN A;  1NHE B;  1VGU A;  1ZI3 A;  1ZDF A;  1MC3 A;  1WT0 A;  1ZJ1 A;  4D0T A;  4Y63 A;  3I0E A;  1ZCT A;  2WAW A;  3N9W A;  2FYD B;  2D7I A;  4B4G A;  4FRE A;  1JV3 A;  2X60 A;  2AEC A;  2X5Z A;  2RIZ A;  5C4F A;  4JD0 A;  1H5T B;  2YQJ A;  4HO4 A;  1VPA A;  4KNX A;  3T7O A;  3USQ A;  5CQL X;  1ZCV A;  1GWW A;  4BMA A;  1G9R A;  1TW5 A;  4HO9 A;  4D0Z A;  1MP3 A;  4K6R A;  4M4K A;  1V82 A;  4CVH A;  2ZU8 A;  1MP5 A;  2Z86 A;  2AGD A;  1Z90 A;  5D92 A;  5C3B A;  1NF5 B;  1LVW A;  1ZJ3 A;  5L6V A;  2Y7A A;  2FYA A;  5EIY A;  1IIN A;  5HS2 A;  1OMZ A;  4O6M A;  5DDT A;  2FYC B;  2PA4 A;  2Z87 A;  4EVW A;  3I0C A;  2RJ8 A;  1G97 A;  3CKQ A;  3IOH A;  3OH0 A;  2P73 A;  3U2T A;  5CMI A;  4Y7F A;  4JIS A;  3SXB A;  3PKQ A;  1LZ0 A;  1FOA A;  3D8V A;  2JCJ A;  2QKX A;  5L6S A;  3SX5 A;  5C8R A;  5AJP A;  5CMG X;  2YES A;  4HO8 A;  3ZF8 A;  4HO2 A;  4FQW A;  2OEG A;  4O6N A;  2W0W A;  3OH3 A;  3I0F A;  4KC4 A;  1R7X A;  1S4P A;  1QWJ A;  4KC1 A;  2VD4 A;  1FRW A;  2J0A A;  1R7T A;  1JYK A;  2O1H A;  3V8Z A;  1H5S A;  1VIC A;  4EEA A;  3V0N A;  5FTS A;  1JVD A;  1LZJ A;  2PGV A;  4Y7T A;  2AE7 A;  2VK9 A;  1JVG A;  1YP2 A;  4L41 C;  4Y6U A;  4P00 A;  4HO5 A;  3F1Y A;  4NAL A;  2MZB A;  1H5S D;  5AJO A;  1H5R A;  2XME A;  1NWG B;  1YRO B;  3JTJ A;  4MIX A;  2I7B A;  5CQM X;  2PGY A;  2FY7 A;  4B4M A;  4FRD A;  5EJ1 A;  2WVL A;  1NKH B;  3GUE A;  5CMJ A;  1LZI A;  3I0L A;  2GGO A;  3U2V A;  1V84 A;  4FRH A;  4G3S A;  3K8D A;  4NAI A;  3TQD A;  5C49 A;  2E8B A;  1W55 A;  3IOI A;  1WT3 A;  1ON6 A;  3NGW A;  3PNN A;  4FRA A;  1HJJ A;  4FRQ A;  4FRL A;  1YP3 A;  2O1F A;  4KRV A;  5C1L A;  1ZI4 A;  1VZT A;  2JCK A;  2RJ6 A;  4ARW A;  3SXG A;  4ZDQ A;  1FXJ A;  1ZJ2 A;  2I5E A;  4AYJ A;  3DUV A;  1NMM B;  4AC3 A;  4B3U A;  4ASY A;  4KT7 A;  2WVM A;  5IDS A;  1WVC A;  1H3M A;  3U2X A;  2VS5 A;  3DK5 A;  1FO8 A;  2VS4 A;  3LW6 A;  3CKN A;  4EE4 A;  2QGI A;  2RJ1 A;  4KC2 A;  5DDV A;  4EEO A;  4FRM A;  2BO4 A;  1H5R B;  1H7G A;  4FRP A;  2P6W A;  4YS8 A;  4EEM A;  2RJ0 A;  1R7V A;  4G3P A;  4AAW A;  1VH3 A;  3HL3 A;  1GX4 A;  3SXA A;  3IOJ A;  3CKJ A;  1FGG A;  4CJC A;  3RSB A;  4P02 A;  2RIY A;  3SPT A;  3V8Y A;  2FFV A;  1ZI5 A;  1H4C A;  2P72 A;  3KIA A;  3JUJ A;  1H4E A;  1G23 A;  2CU2 A;  4B2W A;  2XMH A;  4G3Q A;  4Y7V A;  3I0K A;  2AES A;  2X5S A;  4D11 C;  3ZLK A;  2A8W A;  4GBP A;  1R80 A;  2YC3 A;  1FR8 A;  1HJL A;  1EZI A;  1HM8 A;  1S4N A;  3I0I X;  1O0R A;  4HG6 A;  1TW1 A;  1H7L A;  3EE5 A;  2C0N A;  5IFY A;  3R2W A;  1V83 A;  4LW3 A;  1QG8 A;  1O23 B;  4UEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...