1LZJA

Glycosyltransferase b + udp + h antigen acceptor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycosyltransferase B
publication title The structural basis for specificity in human ABO(H) blood group biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2002-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1lzjA00
2BO8A 3V8YA 2BO7A 1LZ0A 2VXMA 1H4EA 2Y7AA 3HL3A 1FR8A 1WT0A 4FROA 1ZJ3A 4KT7A 4HG6A 3CKJA 3K8DA 3F1CA 2RJ4A 1NMMB 2WVLA 5CQLX 1R7YA 3TZTA 4Y7GA 1FZWA 3RSBA 1WT2A 4HO9A 4XWIA 3I0CA 5I1FA 4M4KA 1H4CA 1VGZA 5EIYA 1FXJA 4Y63A 3I0EA 4KC1A 4EE5A 2W0WA 2Y4JA 3V0QA 1ZHJA 3PNNA 5C1HA 1VH1A 1VZXA 1LL3A 4HOCA 5DDVA 3I0HA 1R80A 4NAIA 3SX8A 2OI6A 2CU2A 2YC3A 4CJCA 3OH3A 1TZFA 4HO8A 5AJOA 2RIZA 4B4GA 2Q4JA 3I0JA 4M2BA 2RJ5A 4HO3A 3OAMA 1VGUA 3V0LA 1S4NA 4JISA 3V91A 2OEGA 1GWVA 2AM3A 4EE4A 1K4VA 4FRBA 2PGYA 2O1FA 2RIXA 4D0TA 4CJ8A 2PGVA 3D8VA 1R7XA 2FYDB 4FRLA 4NANA 4ZDQA 1FO8A 2VFZA 5FV9A 4EEOA 1JVDA 1R7VA 3PKPA 1NKHB 4GBPA 1FGGA 1G0RA 3SX7A 3I0KA 1TW1A 1JVGA 3GUEA 4G3SA 4D11A 2WEEA 2V0LA 5CMIA 2V0KA 4B3UA 2XWLA 4ASJA 1ZIZA 3TQDA 2QGIA 1TW5A 4KQLA 4FRDA 1WT3A 5CMHA 3T7NA 2I7BA 5C1GA 3ZF8A 1EYRA 3JUKA 3OGZA 3SPTA 3EE5A 2QKXA 3I0GA 1O0RA 2APCA 5CQPA 3ZLLA 3CKQA 4BMAA 4ARWA 1H7GA 1PZYB 5C3BA 1PZTA 5FUHA 3I0DA 1EZIA 3CKOA 3JTJA 2FFUA 3SXGA 1JV3A 1S4OA 4P02A 1H5TB 5C4DA 1G8OA 1ON8A 1ZI4A 2E8BA 2ICYA 3SXCA 1G2VA 1YP2A 3SXEA 1LVWA 2AM5A 2YQSA 1FXOA 1FG5N 1VPAA 4MYBA 2AESA 1ZJPA 5FU8A 3BRKX 3U2TA 2WVMA 2VS5A 2W0VA 4C2SA 4EVWA 3OH2A 3ZGFA 5HS2A 2RJ1A 2A8WA 1ZCVA 2V0HA 2RJ8A 3R2WA 2XMHA 1HJLA 4AAWA 3OH0A 4J18A 1V83A 1OMXA 2JCJA 5C4CA 1ZJOA 3T7OA 5C4FA 1VGWA 1NHEB 1OQMB 1XZ6A 3BCVA 2XWMA 2AGDA 4ECMA 3O3PA 1O7OA 4FRAA 1YP4A 4D0ZA 4AC3A 4EE3A 1MP4A 5IFYA 1H5RB 1VZTA 3U2VA 2FYCB 5CQNX 1QGQA 1G3LA 4G3QA 1GWWA 2RJ7A 4Y7TA 3V0NA 4DE7A 1VZUA 3OC9A 1R82A 4B4BA 2YESA 2X5ZA 2YCMA 5C36A 1LZJA 3I0IX 2Z86A 1HM9A 2PA4A 4Y64A 5AJPA 3ST8A 1YP3A 1SS9A 4KC2A 2AM4A 2D7IA 2WVKA 2Y6PA 3V0PA 1NWGB 1KWSA 2RJ9A 2Y4MA 2P6WA 5FTVA 2FYAA 3RMWA 1JYLA 2E3DA 3SXAA 3NGWA 1O23B 1G9RA 2OI5A 4FRPA 2X5SA 2VS3A 4HO5A 5CMGX 3QVBA 2YQHA 1WVCA 2PX7A 1XHBA 1G97A 3DJ4A 4LW3A 2GGQA 3Q4SA 3DUVA 5L6SA 1G23A 1O7QA 1H7LA 5CMJA 1V82A 1FR9A 2WAWA 1MC3A 2DPWA 1ZCUA 2ICXA 2VSHA 2ZU9A 3I0LA 1ZI5A 4Y6UA 1TVYA 3U2XA 1VH3A 3E25A 2YQJA 5FU0A 4BQHA 2GGOA 2RITA 1FRWA 3OKRA 2VS4A 4FRQA 5C1LA 1S4PA 3CGXA 4FCEA 3K8EA 4FRHA 4KPZA 1LL2A 1H7HA 3IOHA 2X60A 3I0FA 4G87A 1VM8A 2D0JA 3IOIA 5AJNA 4D11C 4Y7UA 2RJ6A 1ZJ0A 3FWWA 4Y6NA 3V90A 5C4BA 1MP5A 5CQMX 4YS8A 3V0MA 5J49A 1QWJA 1V84A 4FREA 1FGXA 3SXBA 4P00A 3OH1A 5IDSA 4G3PA 3IOJA 4B2XA 2OEFA 2AECA 1INIA 1ZCYA 5C4EA 4NALA 2JCLA 5CQOA 4JD0A 2BO6A 2RJ0A 3N9WA 1NQIB 4KC4A 1H5SD 4HO4A 4KXOA 5EJZA 3Q80A 4D48A 4EEGA 3SX3A 4DECA 3JUJA 3CKVA 1ZDGA 1H3MA 4M28A 4HO2A 3PKQA 1H5SA 5JQQA 4HO6A 5FTSA 1YROB 5CMFX 4CVHA 3U2UA 2OI7A 2P73A 5C3AA 4KPXA 5C49A 3LW6A 4L41C 3ZLKA 5DDTA 2XWNA 1I52A 2O1HA 1GQ9A 2FYBA 4B42A 4KNRA 4E1KA 1WT1A 2Z87A 3USRA 3FOQA 1H7FA 2WE9A 1QG8A 5C3DA 2FFVA 1G93A 1H7EA 3RMVA 3ZGGA 4DDZA 2Y4KA 1IIMA 5C8RA 2I5KA 4EEAA 2QH5A 2XMEA 4HCQA 1IINA 1HJJA 1R7TA 1Z90A 1LL0A 4ASYA 1WSZA 4B5BA 1H5TA 1VICA 2X65A 2YQCA 1GQCA 1W77A 4CJBA 3E26A 1FOAA 1QGSA 1ZJ2A 2BO4A 2MZBA 2V0IA 1INJA 1ZDFA 3V8ZA 4Y9XA 2ZU7A 1HV9A 3T7MA 5IDTA 1VGTA 3U0YA 2A8UA 4UEGA 4KRVA 1R7UA 2Y4LA 2P72A 4FCUA 4K6RA 1OMZA 1JV1A 1HM0A 4IRQA 1LZIA 1H7QA 1GX4A 1GX0A 1W55A 2YC5A 4Y7VA 5C48A 4HO0A 4NAKA 2JCKA 2WGZA 1JYKA 1MP3A 5EJ1A 2O1GA 3SX5A 4Y7FA 2D7RA 4Y62A 1H5SB 1ZI3A 3D98A 4MNDA 3OH4A 3R3IA 1H5RA 4AYLA 5BXCA 4B2WA 3F1YA 3DK5A 1G95A 1ON6A 1ZCTA 2VD4A 1H7TA 4R7PA 2VXLA 5L6VA 2JCOA 4M2AA 1H4DA 1W57A 1FWYA 3U0XA 1ZJ1A 2VSIA 2FY7A 2AH9A 1E5KA 2ZU8A 2I5EA 4FRMA 2NXVA 2V0JA 4LW6A 3U2WA 1FO9A 1G1LA 3SXDA 1R81A 1GA8A 3POLA 1ZI1A 2AE7A 3CU0A 4AYJA 3CKNA 4IRPA 1NF5B 5FYEA 2UX8A 5C47A 4KNXA 1HM8A 3D5NA 1LZ7A 3Q7UA 2RIYA 3USQA 3V0OA 4FQWA 3KIAA 4B4MA 4EEMA 5C38A 1H5SC
chains in the Genus database with same CATH superfamily
2BO8A 3V8YA 2BO7A 1LZ0A 2VXMA 1H4EA 2Y7AA 3HL3A 1FR8A 1WT0A 4FROA 1ZJ3A 4KT7A 4HG6A 3CKJA 3K8DA 3F1CA 2RJ4A 1NMMB 2WVLA 5CQLX 1R7YA 3TZTA 4Y7GA 1FZWA 3RSBA 1WT2A 4HO9A 4XWIA 3I0CA 5I1FA 4M4KA 1H4CA 1VGZA 5EIYA 1FXJA 4Y63A 3I0EA 4KC1A 4EE5A 2W0WA 2Y4JA 3V0QA 1ZHJA 3PNNA 5C1HA 1VH1A 1VZXA 1LL3A 4HOCA 5DDVA 3I0HA 1R80A 4NAIA 3SX8A 2OI6A 2CU2A 2YC3A 4CJCA 3OH3A 1TZFA 4HO8A 5D91A 5AJOA 2RIZA 4B4GA 2Q4JA 3I0JA 4M2BA 2RJ5A 4HO3A 3OAMA 1VGUA 3V0LA 1S4NA 4JISA 3V91A 2OEGA 1GWVA 2AM3A 4EE4A 1K4VA 4FRBA 2PGYA 2O1FA 2RIXA 4D0TA 4MIXA 4CJ8A 2PGVA 3D8VA 1R7XA 2FYDB 4FRLA 4NANA 4ZDQA 1FO8A 4Q7CA 2VFZA 5FV9A 4EEOA 1JVDA 1R7VA 3PKPA 1NKHB 4GBPA 4O6MA 1FGGA 1G0RA 3SX7A 3I0KA 1TW1A 1JVGA 3GUEA 4G3SA 4D11A 2WEEA 2V0LA 5CMIA 2V0KA 4B3UA 2XWLA 4ASJA 1ZIZA 3TQDA 2QGIA 1TW5A 4KQLA 4FRDA 1WT3A 5CMHA 3T7NA 2I7BA 5C1GA 3ZF8A 1EYRA 3JUKA 3OGZA 3SPTA 3EE5A 2QKXA 3I0GA 1O0RA 2APCA 5CQPA 3ZLLA 3CKQA 4BMAA 4ARWA 1H7GA 1PZYB 5C3BA 1PZTA 5FUHA 3I0DA 1EZIA 3CKOA 3JTJA 2FFUA 4FIXA 3SXGA 1JV3A 1S4OA 4P02A 1H5TB 5C4DA 1G8OA 1ON8A 1ZI4A 2E8BA 2ICYA 3SXCA 1G2VA 1YP2A 3SXEA 1LVWA 2AM5A 2YQSA 1FXOA 1FG5N 1VPAA 4MYBA 2AESA 1ZJPA 5FU8A 3BRKX 3U2TA 2WVMA 2VS5A 2W0VA 4C2SA 4EVWA 3OH2A 3ZGFA 5HS2A 2RJ1A 2A8WA 1ZCVA 2V0HA 2RJ8A 3R2WA 2XMHA 1HJLA 4AAWA 3OH0A 4J18A 1V83A 1OMXA 2JCJA 5C4CA 1ZJOA 3T7OA 5C4FA 1VGWA 1NHEB 1OQMB 1XZ6A 3BCVA 2XWMA 2AGDA 4ECMA 3O3PA 1O7OA 4FRAA 1YP4A 4D0ZA 4AC3A 4EE3A 1MP4A 5IFYA 1H5RB 1VZTA 3U2VA 2FYCB 5CQNX 1QGQA 1G3LA 4G3QA 1GWWA 2RJ7A 4Y7TA 3V0NA 4DE7A 1VZUA 3OC9A 1R82A 4B4BA 2YESA 2X5ZA 2YCMA 2J0BA 5C36A 1LZJA 3I0IX 2Z86A 1HM9A 2PA4A 4Y64A 5AJPA 3ST8A 1YP3A 1SS9A 4KC2A 2AM4A 2D7IA 2WVKA 2Y6PA 3V0PA 1NWGB 1KWSA 2RJ9A 2Y4MA 2P6WA 5FTVA 2FYAA 3RMWA 1JYLA 2E3DA 2J0AA 3SXAA 3NGWA 1O23B 2C0NA 1G9RA 2OI5A 4FRPA 2X5SA 2VS3A 4HO5A 5CMGX 3QVBA 2YQHA 1WVCA 2PX7A 1XHBA 1G97A 3DJ4A 4LW3A 2GGQA 3Q4SA 3DUVA 5L6SA 1G23A 1O7QA 1H7LA 5CMJA 1V82A 1FR9A 2WAWA 1MC3A 2DPWA 1ZCUA 2ICXA 2VSHA 2ZU9A 3I0LA 1ZI5A 4Y6UA 1TVYA 3U2XA 1VH3A 3E25A 2YQJA 5FU0A 4BQHA 2GGOA 5D92A 2RITA 1FRWA 3OKRA 2VS4A 4FRQA 5C1LA 1S4PA 3CGXA 4FCEA 3K8EA 4FRHA 4KPZA 1LL2A 1H7HA 3IOHA 2X60A 3I0FA 4G87A 1VM8A 2D0JA 3IOIA 5AJNA 4D11C 4Y7UA 2RJ6A 1ZJ0A 3FWWA 4Y6NA 3V90A 5C4BA 1MP5A 5CQMX 4YS8A 3V0MA 5J49A 1QWJA 1V84A 4FREA 1FGXA 3SXBA 4P00A 2VK9A 3OH1A 5IDSA 4G3PA 3IOJA 4B2XA 2OEFA 2AECA 1INIA 1ZCYA 5C4EA 4NALA 2JCLA 5CQOA 4JD0A 2BO6A 2RJ0A 4FIYA 3N9WA 1NQIB 4KC4A 1H5SD 4HO4A 4KXOA 5EJZA 3Q80A 4D48A 4EEGA 3SX3A 4DECA 3JUJA 3CKVA 1ZDGA 1H3MA 4M28A 4HO2A 3PKQA 1H5SA 5JQQA 4HO6A 5FTSA 1YROB 5CMFX 4CVHA 3U2UA 2OI7A 2P73A 5C3AA 4KPXA 5C49A 3LW6A 4L41C 3ZLKA 5DDTA 2XWNA 1I52A 2O1HA 1GQ9A 2FYBA 4B42A 4KNRA 4E1KA 1WT1A 2Z87A 3USRA 3FOQA 1H7FA 2WE9A 1QG8A 5C3DA 2FFVA 1G93A 1H7EA 3RMVA 3ZGGA 4DDZA 2Y4KA 1IIMA 5C8RA 2I5KA 4EEAA 2QH5A 2XMEA 4HCQA 1IINA 1HJJA 1R7TA 1Z90A 1LL0A 4ASYA 1WSZA 4B5BA 1H5TA 1VICA 2X65A 2YQCA 1GQCA 1W77A 4CJBA 4O6NA 3E26A 1FOAA 1QGSA 1ZJ2A 2BO4A 2MZBA 2V0IA 1INJA 1ZDFA 3V8ZA 4Y9XA 2ZU7A 1HV9A 3T7MA 5IDTA 1VGTA 3U0YA 2A8UA 4UEGA 4KRVA 1R7UA 2Y4LA 2P72A 4FCUA 4K6RA 1OMZA 1JV1A 1HM0A 4IRQA 1LZIA 1H7QA 1GX4A 1GX0A 1W55A 2YC5A 4Y7VA 5C48A 4HO0A 4NAKA 2JCKA 2WGZA 1JYKA 1MP3A 5EJ1A 2O1GA 3SX5A 4Y7FA 2D7RA 4Y62A 1H5SB 1ZI3A 3D98A 4MNDA 3OH4A 3R3IA 1H5RA 4AYLA 5BXCA 4B2WA 3F1YA 3DK5A 1G95A 1ON6A 1ZCTA 2VD4A 1H7TA 4R7PA 2VXLA 5L6VA 2JCOA 4M2AA 1H4DA 1W57A 1FWYA 3U0XA 1ZJ1A 2VSIA 2FY7A 2AH9A 1E5KA 2ZU8A 2I5EA 4FRMA 2NXVA 2V0JA 4LW6A 3U2WA 1FO9A 1G1LA 3SXDA 1R81A 1GA8A 3POLA 1ZI1A 2AE7A 3CU0A 4AYJA 3CKNA 4IRPA 1NF5B 5FYEA 2UX8A 5C47A 4KNXA 1HM8A 3D5NA 1LZ7A 3Q7UA 2RIYA 3USQA 3V0OA 4FQWA 3KIAA 4B4MA 4EEMA 5C38A 1H5SC
chains in the Genus database with same CATH topology
2BO8A 3V8YA 2BO7A 1LZ0A 2VXMA 1H4EA 2Y7AA 3HL3A 1FR8A 1WT0A 4FROA 1ZJ3A 4KT7A 4HG6A 3CKJA 3K8DA 3F1CA 2RJ4A 1NMMB 2WVLA 5CQLX 1R7YA 3TZTA 4Y7GA 1FZWA 3RSBA 1WT2A 4HO9A 4XWIA 3I0CA 5I1FA 4M4KA 1H4CA 1VGZA 5EIYA 1FXJA 4Y63A 3I0EA 4KC1A 4EE5A 2W0WA 2Y4JA 3V0QA 1ZHJA 3PNNA 5C1HA 1VH1A 1VZXA 1LL3A 4HOCA 5DDVA 3I0HA 1R80A 4NAIA 3SX8A 2OI6A 2CU2A 2YC3A 4CJCA 3OH3A 1TZFA 4HO8A 5D91A 5AJOA 2RIZA 4B4GA 2Q4JA 3I0JA 4M2BA 2RJ5A 4HO3A 3OAMA 1VGUA 3V0LA 1S4NA 4JISA 3V91A 2OEGA 1GWVA 2AM3A 4EE4A 1K4VA 4FRBA 2PGYA 2O1FA 2RIXA 4D0TA 4MIXA 4CJ8A 2PGVA 3D8VA 1R7XA 2FYDB 4FRLA 4NANA 4ZDQA 1FO8A 4Q7CA 2VFZA 5FV9A 4EEOA 1JVDA 1R7VA 3PKPA 1NKHB 4GBPA 4O6MA 1FGGA 1G0RA 3SX7A 3I0KA 1TW1A 1JVGA 3GUEA 4G3SA 4D11A 2WEEA 2V0LA 5CMIA 2V0KA 4B3UA 2XWLA 4ASJA 1ZIZA 3TQDA 2QGIA 1TW5A 4KQLA 4FRDA 1WT3A 5CMHA 3T7NA 2I7BA 5C1GA 3ZF8A 1EYRA 3JUKA 3OGZA 3SPTA 3EE5A 2QKXA 3I0GA 1O0RA 2APCA 5CQPA 3ZLLA 3CKQA 4BMAA 4ARWA 1H7GA 1PZYB 5C3BA 1PZTA 5FUHA 3I0DA 1EZIA 3CKOA 3JTJA 2FFUA 4FIXA 3SXGA 1JV3A 1S4OA 4P02A 1H5TB 5C4DA 1G8OA 1ON8A 1ZI4A 2E8BA 2ICYA 3SXCA 1G2VA 1YP2A 3SXEA 1LVWA 2AM5A 2YQSA 1FXOA 1FG5N 1VPAA 4MYBA 2AESA 1ZJPA 5FU8A 3BRKX 3U2TA 2WVMA 2VS5A 2W0VA 4C2SA 4EVWA 3OH2A 3ZGFA 5HS2A 2RJ1A 2A8WA 1ZCVA 2V0HA 2RJ8A 3R2WA 2XMHA 1HJLA 4AAWA 3OH0A 4J18A 1V83A 1OMXA 2JCJA 5C4CA 1ZJOA 3T7OA 5C4FA 1VGWA 1NHEB 1OQMB 1XZ6A 3BCVA 2XWMA 2AGDA 4ECMA 3O3PA 1O7OA 4FRAA 1YP4A 4D0ZA 4AC3A 4EE3A 1MP4A 5IFYA 1H5RB 1VZTA 3U2VA 2FYCB 5CQNX 1QGQA 1G3LA 4G3QA 1GWWA 2RJ7A 4Y7TA 3V0NA 4DE7A 1VZUA 3OC9A 1R82A 4B4BA 2YESA 2X5ZA 2YCMA 2J0BA 5C36A 1LZJA 3I0IX 2Z86A 1HM9A 2PA4A 4Y64A 5AJPA 3ST8A 1YP3A 1SS9A 4KC2A 2AM4A 2D7IA 2WVKA 2Y6PA 3V0PA 1NWGB 1KWSA 2RJ9A 2Y4MA 2P6WA 5FTVA 2FYAA 3RMWA 1JYLA 2E3DA 2J0AA 3SXAA 3NGWA 1O23B 2C0NA 1G9RA 2OI5A 4FRPA 2X5SA 2VS3A 4HO5A 5CMGX 3QVBA 2YQHA 1WVCA 2PX7A 1XHBA 1G97A 3DJ4A 4LW3A 2GGQA 3Q4SA 3DUVA 5L6SA 1G23A 1O7QA 1H7LA 5CMJA 1V82A 1FR9A 2WAWA 1MC3A 2DPWA 1ZCUA 2ICXA 2VSHA 2ZU9A 3I0LA 1ZI5A 4Y6UA 1TVYA 3U2XA 1VH3A 3E25A 2YQJA 5FU0A 4BQHA 2GGOA 5D92A 2RITA 1FRWA 3OKRA 2VS4A 4FRQA 5C1LA 1S4PA 3CGXA 4FCEA 3K8EA 4FRHA 4KPZA 1LL2A 1H7HA 3IOHA 2X60A 3I0FA 4G87A 1VM8A 2D0JA 3IOIA 5AJNA 4D11C 4Y7UA 2RJ6A 1ZJ0A 3FWWA 4Y6NA 3V90A 5C4BA 1MP5A 5CQMX 4YS8A 3V0MA 5J49A 1QWJA 1V84A 4FREA 1FGXA 3SXBA 4P00A 2VK9A 3OH1A 5IDSA 4G3PA 3IOJA 4B2XA 2OEFA 2AECA 1INIA 1ZCYA 5C4EA 4NALA 2JCLA 5CQOA 4JD0A 2BO6A 2RJ0A 4FIYA 3N9WA 1NQIB 4KC4A 1H5SD 4HO4A 4KXOA 5EJZA 3Q80A 4D48A 4EEGA 3SX3A 4DECA 3JUJA 3CKVA 1ZDGA 1H3MA 4M28A 4HO2A 3PKQA 1H5SA 5JQQA 4HO6A 5FTSA 1YROB 5CMFX 4CVHA 3U2UA 2OI7A 2P73A 5C3AA 4KPXA 5C49A 3LW6A 4L41C 3ZLKA 5DDTA 2XWNA 1I52A 2O1HA 1GQ9A 2FYBA 4B42A 4KNRA 4E1KA 1WT1A 2Z87A 3USRA 3FOQA 1H7FA 2WE9A 1QG8A 5C3DA 2FFVA 1G93A 1H7EA 3RMVA 3ZGGA 4DDZA 2Y4KA 1IIMA 5C8RA 2I5KA 4EEAA 2QH5A 2XMEA 4HCQA 1IINA 1HJJA 1R7TA 1Z90A 1LL0A 4ASYA 1WSZA 4B5BA 1H5TA 1VICA 2X65A 2YQCA 1GQCA 1W77A 4CJBA 4O6NA 3E26A 1FOAA 1QGSA 1ZJ2A 2BO4A 2MZBA 2V0IA 1INJA 1ZDFA 3V8ZA 4Y9XA 2ZU7A 1HV9A 3T7MA 5IDTA 1VGTA 3U0YA 2A8UA 4UEGA 4KRVA 1R7UA 2Y4LA 2P72A 4FCUA 4K6RA 1OMZA 1JV1A 1HM0A 4IRQA 1LZIA 1H7QA 1GX4A 1GX0A 1W55A 2YC5A 4Y7VA 5C48A 4HO0A 4NAKA 2JCKA 2WGZA 1JYKA 1MP3A 5EJ1A 2O1GA 3SX5A 4Y7FA 2D7RA 4Y62A 1H5SB 1ZI3A 3D98A 4MNDA 3OH4A 3R3IA 1H5RA 4AYLA 5BXCA 4B2WA 3F1YA 3DK5A 1G95A 1ON6A 1ZCTA 2VD4A 1H7TA 4R7PA 2VXLA 5L6VA 2JCOA 4M2AA 1H4DA 1W57A 1FWYA 3U0XA 1ZJ1A 2VSIA 2FY7A 2AH9A 1E5KA 2ZU8A 2I5EA 4FRMA 2NXVA 2V0JA 4LW6A 3U2WA 1FO9A 1G1LA 3SXDA 1R81A 1GA8A 3POLA 1ZI1A 2AE7A 3CU0A 4AYJA 3CKNA 4IRPA 1NF5B 5FYEA 2UX8A 5C47A 4KNXA 1HM8A 3D5NA 1LZ7A 3Q7UA 2RIYA 3USQA 3V0OA 4FQWA 3KIAA 4B4MA 4EEMA 5C38A 1H5SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO8 A;  3V8Y A;  2BO7 A;  1LZ0 A;  2VXM A;  1H4E A;  2Y7A A;  3HL3 A;  1FR8 A;  1WT0 A;  4FRO A;  1ZJ3 A;  4KT7 A;  4HG6 A;  3CKJ A;  3K8D A;  3F1C A;  2RJ4 A;  1NMM B;  2WVL A;  5CQL X;  1R7Y A;  3TZT A;  4Y7G A;  1FZW A;  3RSB A;  1WT2 A;  4HO9 A;  4XWI A;  3I0C A;  5I1F A;  4M4K A;  1H4C A;  1VGZ A;  5EIY A;  1FXJ A;  4Y63 A;  3I0E A;  4KC1 A;  4EE5 A;  2W0W A;  2Y4J A;  3V0Q A;  1ZHJ A;  3PNN A;  5C1H A;  1VH1 A;  1VZX A;  1LL3 A;  4HOC A;  5DDV A;  3I0H A;  1R80 A;  4NAI A;  3SX8 A;  2OI6 A;  2CU2 A;  2YC3 A;  4CJC A;  3OH3 A;  1TZF A;  4HO8 A;  5AJO A;  2RIZ A;  4B4G A;  2Q4J A;  3I0J A;  4M2B A;  2RJ5 A;  4HO3 A;  3OAM A;  1VGU A;  3V0L A;  1S4N A;  4JIS A;  3V91 A;  2OEG A;  1GWV A;  2AM3 A;  4EE4 A;  1K4V A;  4FRB A;  2PGY A;  2O1F A;  2RIX A;  4D0T A;  4CJ8 A;  2PGV A;  3D8V A;  1R7X A;  2FYD B;  4FRL A;  4NAN A;  4ZDQ A;  1FO8 A;  2VFZ A;  5FV9 A;  4EEO A;  1JVD A;  1R7V A;  3PKP A;  1NKH B;  4GBP A;  1FGG A;  1G0R A;  3SX7 A;  3I0K A;  1TW1 A;  1JVG A;  3GUE A;  4G3S A;  4D11 A;  2WEE A;  2V0L A;  5CMI A;  2V0K A;  4B3U A;  2XWL A;  4ASJ A;  1ZIZ A;  3TQD A;  2QGI A;  1TW5 A;  4KQL A;  4FRD A;  1WT3 A;  5CMH A;  3T7N A;  2I7B A;  5C1G A;  3ZF8 A;  1EYR A;  3JUK A;  3OGZ A;  3SPT A;  3EE5 A;  2QKX A;  3I0G A;  1O0R A;  2APC A;  5CQP A;  3ZLL A;  3CKQ A;  4BMA A;  4ARW A;  1H7G A;  1PZY B;  5C3B A;  1PZT A;  5FUH A;  3I0D A;  1EZI A;  3CKO A;  3JTJ A;  2FFU A;  3SXG A;  1JV3 A;  1S4O A;  4P02 A;  1H5T B;  5C4D A;  1G8O A;  1ON8 A;  1ZI4 A;  2E8B A;  2ICY A;  3SXC A;  1G2V A;  1YP2 A;  3SXE A;  1LVW A;  2AM5 A;  2YQS A;  1FXO A;  1FG5 N;  1VPA A;  4MYB A;  2AES A;  1ZJP A;  5FU8 A;  3BRK X;  3U2T A;  2WVM A;  2VS5 A;  2W0V A;  4C2S A;  4EVW A;  3OH2 A;  3ZGF A;  5HS2 A;  2RJ1 A;  2A8W A;  1ZCV A;  2V0H A;  2RJ8 A;  3R2W A;  2XMH A;  1HJL A;  4AAW A;  3OH0 A;  4J18 A;  1V83 A;  1OMX A;  2JCJ A;  5C4C A;  1ZJO A;  3T7O A;  5C4F A;  1VGW A;  1NHE B;  1OQM B;  1XZ6 A;  3BCV A;  2XWM A;  2AGD A;  4ECM A;  3O3P A;  1O7O A;  4FRA A;  1YP4 A;  4D0Z A;  4AC3 A;  4EE3 A;  1MP4 A;  5IFY A;  1H5R B;  1VZT A;  3U2V A;  2FYC B;  5CQN X;  1QGQ A;  1G3L A;  4G3Q A;  1GWW A;  2RJ7 A;  4Y7T A;  3V0N A;  4DE7 A;  1VZU A;  3OC9 A;  1R82 A;  4B4B A;  2YES A;  2X5Z A;  2YCM A;  5C36 A;  1LZJ A;  3I0I X;  2Z86 A;  1HM9 A;  2PA4 A;  4Y64 A;  5AJP A;  3ST8 A;  1YP3 A;  1SS9 A;  4KC2 A;  2AM4 A;  2D7I A;  2WVK A;  2Y6P A;  3V0P A;  1NWG B;  1KWS A;  2RJ9 A;  2Y4M A;  2P6W A;  5FTV A;  2FYA A;  3RMW A;  1JYL A;  2E3D A;  3SXA A;  3NGW A;  1O23 B;  1G9R A;  2OI5 A;  4FRP A;  2X5S A;  2VS3 A;  4HO5 A;  5CMG X;  3QVB A;  2YQH A;  1WVC A;  2PX7 A;  1XHB A;  1G97 A;  3DJ4 A;  4LW3 A;  2GGQ A;  3Q4S A;  3DUV A;  5L6S A;  1G23 A;  1O7Q A;  1H7L A;  5CMJ A;  1V82 A;  1FR9 A;  2WAW A;  1MC3 A;  2DPW A;  1ZCU A;  2ICX A;  2VSH A;  2ZU9 A;  3I0L A;  1ZI5 A;  4Y6U A;  1TVY A;  3U2X A;  1VH3 A;  3E25 A;  2YQJ A;  5FU0 A;  4BQH A;  2GGO A;  2RIT A;  1FRW A;  3OKR A;  2VS4 A;  4FRQ A;  5C1L A;  1S4P A;  3CGX A;  4FCE A;  3K8E A;  4FRH A;  4KPZ A;  1LL2 A;  1H7H A;  3IOH A;  2X60 A;  3I0F A;  4G87 A;  1VM8 A;  2D0J A;  3IOI A;  5AJN A;  4D11 C;  4Y7U A;  2RJ6 A;  1ZJ0 A;  3FWW A;  4Y6N A;  3V90 A;  5C4B A;  1MP5 A;  5CQM X;  4YS8 A;  3V0M A;  5J49 A;  1QWJ A;  1V84 A;  4FRE A;  1FGX A;  3SXB A;  4P00 A;  3OH1 A;  5IDS A;  4G3P A;  3IOJ A;  4B2X A;  2OEF A;  2AEC A;  1INI A;  1ZCY A;  5C4E A;  4NAL A;  2JCL A;  5CQO A;  4JD0 A;  2BO6 A;  2RJ0 A;  3N9W A;  1NQI B;  4KC4 A;  1H5S D;  4HO4 A;  4KXO A;  5EJZ A;  3Q80 A;  4D48 A;  4EEG A;  3SX3 A;  4DEC A;  3JUJ A;  3CKV A;  1ZDG A;  1H3M A;  4M28 A;  4HO2 A;  3PKQ A;  1H5S A;  5JQQ A;  4HO6 A;  5FTS A;  1YRO B;  5CMF X;  4CVH A;  3U2U A;  2OI7 A;  2P73 A;  5C3A A;  4KPX A;  5C49 A;  3LW6 A;  4L41 C;  3ZLK A;  5DDT A;  2XWN A;  1I52 A;  2O1H A;  1GQ9 A;  2FYB A;  4B42 A;  4KNR A;  4E1K A;  1WT1 A;  2Z87 A;  3USR A;  3FOQ A;  1H7F A;  2WE9 A;  1QG8 A;  5C3D A;  2FFV A;  1G93 A;  1H7E A;  3RMV A;  3ZGG A;  4DDZ A;  2Y4K A;  1IIM A;  5C8R A;  2I5K A;  4EEA A;  2QH5 A;  2XME A;  4HCQ A;  1IIN A;  1HJJ A;  1R7T A;  1Z90 A;  1LL0 A;  4ASY A;  1WSZ A;  4B5B A;  1H5T A;  1VIC A;  2X65 A;  2YQC A;  1GQC A;  1W77 A;  4CJB A;  3E26 A;  1FOA A;  1QGS A;  1ZJ2 A;  2BO4 A;  2MZB A;  2V0I A;  1INJ A;  1ZDF A;  3V8Z A;  4Y9X A;  2ZU7 A;  1HV9 A;  3T7M A;  5IDT A;  1VGT A;  3U0Y A;  2A8U A;  4UEG A;  4KRV A;  1R7U A;  2Y4L A;  2P72 A;  4FCU A;  4K6R A;  1OMZ A;  1JV1 A;  1HM0 A;  4IRQ A;  1LZI A;  1H7Q A;  1GX4 A;  1GX0 A;  1W55 A;  2YC5 A;  4Y7V A;  5C48 A;  4HO0 A;  4NAK A;  2JCK A;  2WGZ A;  1JYK A;  1MP3 A;  5EJ1 A;  2O1G A;  3SX5 A;  4Y7F A;  2D7R A;  4Y62 A;  1H5S B;  1ZI3 A;  3D98 A;  4MND A;  3OH4 A;  3R3I A;  1H5R A;  4AYL A;  5BXC A;  4B2W A;  3F1Y A;  3DK5 A;  1G95 A;  1ON6 A;  1ZCT A;  2VD4 A;  1H7T A;  4R7P A;  2VXL A;  5L6V A;  2JCO A;  4M2A A;  1H4D A;  1W57 A;  1FWY A;  3U0X A;  1ZJ1 A;  2VSI A;  2FY7 A;  2AH9 A;  1E5K A;  2ZU8 A;  2I5E A;  4FRM A;  2NXV A;  2V0J A;  4LW6 A;  3U2W A;  1FO9 A;  1G1L A;  3SXD A;  1R81 A;  1GA8 A;  3POL A;  1ZI1 A;  2AE7 A;  3CU0 A;  4AYJ A;  3CKN A;  4IRP A;  1NF5 B;  5FYE A;  2UX8 A;  5C47 A;  4KNX A;  1HM8 A;  3D5N A;  1LZ7 A;  3Q7U A;  2RIY A;  3USQ A;  3V0O A;  4FQW A;  3KIA A;  4B4M A;  4EEM A;  5C38 A;  1H5S C; 
#chains in the Genus database with same CATH topology
 2BO8 A;  3V8Y A;  2BO7 A;  1LZ0 A;  2VXM A;  1H4E A;  2Y7A A;  3HL3 A;  1FR8 A;  1WT0 A;  4FRO A;  1ZJ3 A;  4KT7 A;  4HG6 A;  3CKJ A;  3K8D A;  3F1C A;  2RJ4 A;  1NMM B;  2WVL A;  5CQL X;  1R7Y A;  3TZT A;  4Y7G A;  1FZW A;  3RSB A;  1WT2 A;  4HO9 A;  4XWI A;  3I0C A;  5I1F A;  4M4K A;  1H4C A;  1VGZ A;  5EIY A;  1FXJ A;  4Y63 A;  3I0E A;  4KC1 A;  4EE5 A;  2W0W A;  2Y4J A;  3V0Q A;  1ZHJ A;  3PNN A;  5C1H A;  1VH1 A;  1VZX A;  1LL3 A;  4HOC A;  5DDV A;  3I0H A;  1R80 A;  4NAI A;  3SX8 A;  2OI6 A;  2CU2 A;  2YC3 A;  4CJC A;  3OH3 A;  1TZF A;  4HO8 A;  5D91 A;  5AJO A;  2RIZ A;  4B4G A;  2Q4J A;  3I0J A;  4M2B A;  2RJ5 A;  4HO3 A;  3OAM A;  1VGU A;  3V0L A;  1S4N A;  4JIS A;  3V91 A;  2OEG A;  1GWV A;  2AM3 A;  4EE4 A;  1K4V A;  4FRB A;  2PGY A;  2O1F A;  2RIX A;  4D0T A;  4MIX A;  4CJ8 A;  2PGV A;  3D8V A;  1R7X A;  2FYD B;  4FRL A;  4NAN A;  4ZDQ A;  1FO8 A;  4Q7C A;  2VFZ A;  5FV9 A;  4EEO A;  1JVD A;  1R7V A;  3PKP A;  1NKH B;  4GBP A;  4O6M A;  1FGG A;  1G0R A;  3SX7 A;  3I0K A;  1TW1 A;  1JVG A;  3GUE A;  4G3S A;  4D11 A;  2WEE A;  2V0L A;  5CMI A;  2V0K A;  4B3U A;  2XWL A;  4ASJ A;  1ZIZ A;  3TQD A;  2QGI A;  1TW5 A;  4KQL A;  4FRD A;  1WT3 A;  5CMH A;  3T7N A;  2I7B A;  5C1G A;  3ZF8 A;  1EYR A;  3JUK A;  3OGZ A;  3SPT A;  3EE5 A;  2QKX A;  3I0G A;  1O0R A;  2APC A;  5CQP A;  3ZLL A;  3CKQ A;  4BMA A;  4ARW A;  1H7G A;  1PZY B;  5C3B A;  1PZT A;  5FUH A;  3I0D A;  1EZI A;  3CKO A;  3JTJ A;  2FFU A;  4FIX A;  3SXG A;  1JV3 A;  1S4O A;  4P02 A;  1H5T B;  5C4D A;  1G8O A;  1ON8 A;  1ZI4 A;  2E8B A;  2ICY A;  3SXC A;  1G2V A;  1YP2 A;  3SXE A;  1LVW A;  2AM5 A;  2YQS A;  1FXO A;  1FG5 N;  1VPA A;  4MYB A;  2AES A;  1ZJP A;  5FU8 A;  3BRK X;  3U2T A;  2WVM A;  2VS5 A;  2W0V A;  4C2S A;  4EVW A;  3OH2 A;  3ZGF A;  5HS2 A;  2RJ1 A;  2A8W A;  1ZCV A;  2V0H A;  2RJ8 A;  3R2W A;  2XMH A;  1HJL A;  4AAW A;  3OH0 A;  4J18 A;  1V83 A;  1OMX A;  2JCJ A;  5C4C A;  1ZJO A;  3T7O A;  5C4F A;  1VGW A;  1NHE B;  1OQM B;  1XZ6 A;  3BCV A;  2XWM A;  2AGD A;  4ECM A;  3O3P A;  1O7O A;  4FRA A;  1YP4 A;  4D0Z A;  4AC3 A;  4EE3 A;  1MP4 A;  5IFY A;  1H5R B;  1VZT A;  3U2V A;  2FYC B;  5CQN X;  1QGQ A;  1G3L A;  4G3Q A;  1GWW A;  2RJ7 A;  4Y7T A;  3V0N A;  4DE7 A;  1VZU A;  3OC9 A;  1R82 A;  4B4B A;  2YES A;  2X5Z A;  2YCM A;  2J0B A;  5C36 A;  1LZJ A;  3I0I X;  2Z86 A;  1HM9 A;  2PA4 A;  4Y64 A;  5AJP A;  3ST8 A;  1YP3 A;  1SS9 A;  4KC2 A;  2AM4 A;  2D7I A;  2WVK A;  2Y6P A;  3V0P A;  1NWG B;  1KWS A;  2RJ9 A;  2Y4M A;  2P6W A;  5FTV A;  2FYA A;  3RMW A;  1JYL A;  2E3D A;  2J0A A;  3SXA A;  3NGW A;  1O23 B;  2C0N A;  1G9R A;  2OI5 A;  4FRP A;  2X5S A;  2VS3 A;  4HO5 A;  5CMG X;  3QVB A;  2YQH A;  1WVC A;  2PX7 A;  1XHB A;  1G97 A;  3DJ4 A;  4LW3 A;  2GGQ A;  3Q4S A;  3DUV A;  5L6S A;  1G23 A;  1O7Q A;  1H7L A;  5CMJ A;  1V82 A;  1FR9 A;  2WAW A;  1MC3 A;  2DPW A;  1ZCU A;  2ICX A;  2VSH A;  2ZU9 A;  3I0L A;  1ZI5 A;  4Y6U A;  1TVY A;  3U2X A;  1VH3 A;  3E25 A;  2YQJ A;  5FU0 A;  4BQH A;  2GGO A;  5D92 A;  2RIT A;  1FRW A;  3OKR A;  2VS4 A;  4FRQ A;  5C1L A;  1S4P A;  3CGX A;  4FCE A;  3K8E A;  4FRH A;  4KPZ A;  1LL2 A;  1H7H A;  3IOH A;  2X60 A;  3I0F A;  4G87 A;  1VM8 A;  2D0J A;  3IOI A;  5AJN A;  4D11 C;  4Y7U A;  2RJ6 A;  1ZJ0 A;  3FWW A;  4Y6N A;  3V90 A;  5C4B A;  1MP5 A;  5CQM X;  4YS8 A;  3V0M A;  5J49 A;  1QWJ A;  1V84 A;  4FRE A;  1FGX A;  3SXB A;  4P00 A;  2VK9 A;  3OH1 A;  5IDS A;  4G3P A;  3IOJ A;  4B2X A;  2OEF A;  2AEC A;  1INI A;  1ZCY A;  5C4E A;  4NAL A;  2JCL A;  5CQO A;  4JD0 A;  2BO6 A;  2RJ0 A;  4FIY A;  3N9W A;  1NQI B;  4KC4 A;  1H5S D;  4HO4 A;  4KXO A;  5EJZ A;  3Q80 A;  4D48 A;  4EEG A;  3SX3 A;  4DEC A;  3JUJ A;  3CKV A;  1ZDG A;  1H3M A;  4M28 A;  4HO2 A;  3PKQ A;  1H5S A;  5JQQ A;  4HO6 A;  5FTS A;  1YRO B;  5CMF X;  4CVH A;  3U2U A;  2OI7 A;  2P73 A;  5C3A A;  4KPX A;  5C49 A;  3LW6 A;  4L41 C;  3ZLK A;  5DDT A;  2XWN A;  1I52 A;  2O1H A;  1GQ9 A;  2FYB A;  4B42 A;  4KNR A;  4E1K A;  1WT1 A;  2Z87 A;  3USR A;  3FOQ A;  1H7F A;  2WE9 A;  1QG8 A;  5C3D A;  2FFV A;  1G93 A;  1H7E A;  3RMV A;  3ZGG A;  4DDZ A;  2Y4K A;  1IIM A;  5C8R A;  2I5K A;  4EEA A;  2QH5 A;  2XME A;  4HCQ A;  1IIN A;  1HJJ A;  1R7T A;  1Z90 A;  1LL0 A;  4ASY A;  1WSZ A;  4B5B A;  1H5T A;  1VIC A;  2X65 A;  2YQC A;  1GQC A;  1W77 A;  4CJB A;  4O6N A;  3E26 A;  1FOA A;  1QGS A;  1ZJ2 A;  2BO4 A;  2MZB A;  2V0I A;  1INJ A;  1ZDF A;  3V8Z A;  4Y9X A;  2ZU7 A;  1HV9 A;  3T7M A;  5IDT A;  1VGT A;  3U0Y A;  2A8U A;  4UEG A;  4KRV A;  1R7U A;  2Y4L A;  2P72 A;  4FCU A;  4K6R A;  1OMZ A;  1JV1 A;  1HM0 A;  4IRQ A;  1LZI A;  1H7Q A;  1GX4 A;  1GX0 A;  1W55 A;  2YC5 A;  4Y7V A;  5C48 A;  4HO0 A;  4NAK A;  2JCK A;  2WGZ A;  1JYK A;  1MP3 A;  5EJ1 A;  2O1G A;  3SX5 A;  4Y7F A;  2D7R A;  4Y62 A;  1H5S B;  1ZI3 A;  3D98 A;  4MND A;  3OH4 A;  3R3I A;  1H5R A;  4AYL A;  5BXC A;  4B2W A;  3F1Y A;  3DK5 A;  1G95 A;  1ON6 A;  1ZCT A;  2VD4 A;  1H7T A;  4R7P A;  2VXL A;  5L6V A;  2JCO A;  4M2A A;  1H4D A;  1W57 A;  1FWY A;  3U0X A;  1ZJ1 A;  2VSI A;  2FY7 A;  2AH9 A;  1E5K A;  2ZU8 A;  2I5E A;  4FRM A;  2NXV A;  2V0J A;  4LW6 A;  3U2W A;  1FO9 A;  1G1L A;  3SXD A;  1R81 A;  1GA8 A;  3POL A;  1ZI1 A;  2AE7 A;  3CU0 A;  4AYJ A;  3CKN A;  4IRP A;  1NF5 B;  5FYE A;  2UX8 A;  5C47 A;  4KNX A;  1HM8 A;  3D5N A;  1LZ7 A;  3Q7U A;  2RIY A;  3USQ A;  3V0O A;  4FQW A;  3KIA A;  4B4M A;  4EEM A;  5C38 A;  1H5S C; 
#chains in the Genus database with same CATH homology
 2BO8 A;  3V8Y A;  2BO7 A;  1LZ0 A;  2VXM A;  1H4E A;  2Y7A A;  3HL3 A;  1FR8 A;  1WT0 A;  4FRO A;  1ZJ3 A;  4KT7 A;  4HG6 A;  3CKJ A;  3K8D A;  3F1C A;  2RJ4 A;  1NMM B;  2WVL A;  5CQL X;  1R7Y A;  3TZT A;  4Y7G A;  1FZW A;  3RSB A;  1WT2 A;  4HO9 A;  4XWI A;  3I0C A;  5I1F A;  4M4K A;  1H4C A;  1VGZ A;  5EIY A;  1FXJ A;  4Y63 A;  3I0E A;  4KC1 A;  4EE5 A;  2W0W A;  2Y4J A;  3V0Q A;  1ZHJ A;  3PNN A;  5C1H A;  1VH1 A;  1VZX A;  1LL3 A;  4HOC A;  5DDV A;  3I0H A;  1R80 A;  4NAI A;  3SX8 A;  2OI6 A;  2CU2 A;  2YC3 A;  4CJC A;  3OH3 A;  1TZF A;  4HO8 A;  5D91 A;  5AJO A;  2RIZ A;  4B4G A;  2Q4J A;  3I0J A;  4M2B A;  2RJ5 A;  4HO3 A;  3OAM A;  1VGU A;  3V0L A;  1S4N A;  4JIS A;  3V91 A;  2OEG A;  1GWV A;  2AM3 A;  4EE4 A;  1K4V A;  4FRB A;  2PGY A;  2O1F A;  2RIX A;  4D0T A;  4MIX A;  4CJ8 A;  2PGV A;  3D8V A;  1R7X A;  2FYD B;  4FRL A;  4NAN A;  4ZDQ A;  1FO8 A;  4Q7C A;  2VFZ A;  5FV9 A;  4EEO A;  1JVD A;  1R7V A;  3PKP A;  1NKH B;  4GBP A;  4O6M A;  1FGG A;  1G0R A;  3SX7 A;  3I0K A;  1TW1 A;  1JVG A;  3GUE A;  4G3S A;  4D11 A;  2WEE A;  2V0L A;  5CMI A;  2V0K A;  4B3U A;  2XWL A;  4ASJ A;  1ZIZ A;  3TQD A;  2QGI A;  1TW5 A;  4KQL A;  4FRD A;  1WT3 A;  5CMH A;  3T7N A;  2I7B A;  5C1G A;  3ZF8 A;  1EYR A;  3JUK A;  3OGZ A;  3SPT A;  3EE5 A;  2QKX A;  3I0G A;  1O0R A;  2APC A;  5CQP A;  3ZLL A;  3CKQ A;  4BMA A;  4ARW A;  1H7G A;  1PZY B;  5C3B A;  1PZT A;  5FUH A;  3I0D A;  1EZI A;  3CKO A;  3JTJ A;  2FFU A;  4FIX A;  3SXG A;  1JV3 A;  1S4O A;  4P02 A;  1H5T B;  5C4D A;  1G8O A;  1ON8 A;  1ZI4 A;  2E8B A;  2ICY A;  3SXC A;  1G2V A;  1YP2 A;  3SXE A;  1LVW A;  2AM5 A;  2YQS A;  1FXO A;  1FG5 N;  1VPA A;  4MYB A;  2AES A;  1ZJP A;  5FU8 A;  3BRK X;  3U2T A;  2WVM A;  2VS5 A;  2W0V A;  4C2S A;  4EVW A;  3OH2 A;  3ZGF A;  5HS2 A;  2RJ1 A;  2A8W A;  1ZCV A;  2V0H A;  2RJ8 A;  3R2W A;  2XMH A;  1HJL A;  4AAW A;  3OH0 A;  4J18 A;  1V83 A;  1OMX A;  2JCJ A;  5C4C A;  1ZJO A;  3T7O A;  5C4F A;  1VGW A;  1NHE B;  1OQM B;  1XZ6 A;  3BCV A;  2XWM A;  2AGD A;  4ECM A;  3O3P A;  1O7O A;  4FRA A;  1YP4 A;  4D0Z A;  4AC3 A;  4EE3 A;  1MP4 A;  5IFY A;  1H5R B;  1VZT A;  3U2V A;  2FYC B;  5CQN X;  1QGQ A;  1G3L A;  4G3Q A;  1GWW A;  2RJ7 A;  4Y7T A;  3V0N A;  4DE7 A;  1VZU A;  3OC9 A;  1R82 A;  4B4B A;  2YES A;  2X5Z A;  2YCM A;  2J0B A;  5C36 A;  1LZJ A;  3I0I X;  2Z86 A;  1HM9 A;  2PA4 A;  4Y64 A;  5AJP A;  3ST8 A;  1YP3 A;  1SS9 A;  4KC2 A;  2AM4 A;  2D7I A;  2WVK A;  2Y6P A;  3V0P A;  1NWG B;  1KWS A;  2RJ9 A;  2Y4M A;  2P6W A;  5FTV A;  2FYA A;  3RMW A;  1JYL A;  2E3D A;  2J0A A;  3SXA A;  3NGW A;  1O23 B;  2C0N A;  1G9R A;  2OI5 A;  4FRP A;  2X5S A;  2VS3 A;  4HO5 A;  5CMG X;  3QVB A;  2YQH A;  1WVC A;  2PX7 A;  1XHB A;  1G97 A;  3DJ4 A;  4LW3 A;  2GGQ A;  3Q4S A;  3DUV A;  5L6S A;  1G23 A;  1O7Q A;  1H7L A;  5CMJ A;  1V82 A;  1FR9 A;  2WAW A;  1MC3 A;  2DPW A;  1ZCU A;  2ICX A;  2VSH A;  2ZU9 A;  3I0L A;  1ZI5 A;  4Y6U A;  1TVY A;  3U2X A;  1VH3 A;  3E25 A;  2YQJ A;  5FU0 A;  4BQH A;  2GGO A;  5D92 A;  2RIT A;  1FRW A;  3OKR A;  2VS4 A;  4FRQ A;  5C1L A;  1S4P A;  3CGX A;  4FCE A;  3K8E A;  4FRH A;  4KPZ A;  1LL2 A;  1H7H A;  3IOH A;  2X60 A;  3I0F A;  4G87 A;  1VM8 A;  2D0J A;  3IOI A;  5AJN A;  4D11 C;  4Y7U A;  2RJ6 A;  1ZJ0 A;  3FWW A;  4Y6N A;  3V90 A;  5C4B A;  1MP5 A;  5CQM X;  4YS8 A;  3V0M A;  5J49 A;  1QWJ A;  1V84 A;  4FRE A;  1FGX A;  3SXB A;  4P00 A;  2VK9 A;  3OH1 A;  5IDS A;  4G3P A;  3IOJ A;  4B2X A;  2OEF A;  2AEC A;  1INI A;  1ZCY A;  5C4E A;  4NAL A;  2JCL A;  5CQO A;  4JD0 A;  2BO6 A;  2RJ0 A;  4FIY A;  3N9W A;  1NQI B;  4KC4 A;  1H5S D;  4HO4 A;  4KXO A;  5EJZ A;  3Q80 A;  4D48 A;  4EEG A;  3SX3 A;  4DEC A;  3JUJ A;  3CKV A;  1ZDG A;  1H3M A;  4M28 A;  4HO2 A;  3PKQ A;  1H5S A;  5JQQ A;  4HO6 A;  5FTS A;  1YRO B;  5CMF X;  4CVH A;  3U2U A;  2OI7 A;  2P73 A;  5C3A A;  4KPX A;  5C49 A;  3LW6 A;  4L41 C;  3ZLK A;  5DDT A;  2XWN A;  1I52 A;  2O1H A;  1GQ9 A;  2FYB A;  4B42 A;  4KNR A;  4E1K A;  1WT1 A;  2Z87 A;  3USR A;  3FOQ A;  1H7F A;  2WE9 A;  1QG8 A;  5C3D A;  2FFV A;  1G93 A;  1H7E A;  3RMV A;  3ZGG A;  4DDZ A;  2Y4K A;  1IIM A;  5C8R A;  2I5K A;  4EEA A;  2QH5 A;  2XME A;  4HCQ A;  1IIN A;  1HJJ A;  1R7T A;  1Z90 A;  1LL0 A;  4ASY A;  1WSZ A;  4B5B A;  1H5T A;  1VIC A;  2X65 A;  2YQC A;  1GQC A;  1W77 A;  4CJB A;  4O6N A;  3E26 A;  1FOA A;  1QGS A;  1ZJ2 A;  2BO4 A;  2MZB A;  2V0I A;  1INJ A;  1ZDF A;  3V8Z A;  4Y9X A;  2ZU7 A;  1HV9 A;  3T7M A;  5IDT A;  1VGT A;  3U0Y A;  2A8U A;  4UEG A;  4KRV A;  1R7U A;  2Y4L A;  2P72 A;  4FCU A;  4K6R A;  1OMZ A;  1JV1 A;  1HM0 A;  4IRQ A;  1LZI A;  1H7Q A;  1GX4 A;  1GX0 A;  1W55 A;  2YC5 A;  4Y7V A;  5C48 A;  4HO0 A;  4NAK A;  2JCK A;  2WGZ A;  1JYK A;  1MP3 A;  5EJ1 A;  2O1G A;  3SX5 A;  4Y7F A;  2D7R A;  4Y62 A;  1H5S B;  1ZI3 A;  3D98 A;  4MND A;  3OH4 A;  3R3I A;  1H5R A;  4AYL A;  5BXC A;  4B2W A;  3F1Y A;  3DK5 A;  1G95 A;  1ON6 A;  1ZCT A;  2VD4 A;  1H7T A;  4R7P A;  2VXL A;  5L6V A;  2JCO A;  4M2A A;  1H4D A;  1W57 A;  1FWY A;  3U0X A;  1ZJ1 A;  2VSI A;  2FY7 A;  2AH9 A;  1E5K A;  2ZU8 A;  2I5E A;  4FRM A;  2NXV A;  2V0J A;  4LW6 A;  3U2W A;  1FO9 A;  1G1L A;  3SXD A;  1R81 A;  1GA8 A;  3POL A;  1ZI1 A;  2AE7 A;  3CU0 A;  4AYJ A;  3CKN A;  4IRP A;  1NF5 B;  5FYE A;  2UX8 A;  5C47 A;  4KNX A;  1HM8 A;  3D5N A;  1LZ7 A;  3Q7U A;  2RIY A;  3USQ A;  3V0O A;  4FQW A;  3KIA A;  4B4M A;  4EEM A;  5C38 A;  1H5S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...