2UX8A

Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
288
structure length
255
Chain Sequence
TIKPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGCLKQMVDAYNKVGGNLICAEIITPGTQDGVLTEVNLSVIGRYILQPEVMRILENQGLTDAMQRMIGDQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAFAVKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
publication title The Complex of Sphingomonas Elodea Atcc 31461 Glucose-1-Phosphate Uridylyltransferase with Glucose-1-Phosphate Reveals a Novel Quaternary Structure, Unique Among Nucleoside Diphosphate-Sugar Pyrophosphorylase Members.
pubmed doi rcsb
source organism Sphingomonas elodea
total genus 71
structure length 255
sequence length 288
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2ux8A00
2AM4A 5C3BA 1FZWA 2DPWA 3E25A 3HL3A 5DDTA 5C1LA 1JVGA 5CQMX 3V0LA 1ZJ2A 4UEGA 1GA8A 2BO8A 4KC4A 4JD0A 1MP4A 1ZI3A 2YQCA 1ZJ0A 5C38A 1LZ0A 1KWSA 1WT1A 3SXBA 1GWWA 2ZU7A 4KXOA 1OMXA 3I0DA 3OH0A 1H5RB 3IOHA 1JVDA 1O23B 4KT7A 3U2VA 2QGIA 2OEGA 2V0LA 3U2TA 3Q4SA 4HO5A 2JCOA 1YP3A 2VS4A 3F1YA 1O7QA 1YROB 2RJ0A 3OH1A 1R81A 3IOIA 3SXDA 1R7VA 4EEGA 2JCLA 3I0LA 2X5ZA 1SS9A 5IDSA 4Y64A 3V8YA 1G3LA 3BCVA 4K6RA 3F1CA 4ECMA 4CJ8A 5CQNX 1H7LA 4NANA 3I0EA 1INJA 1W57A 4FRPA 1R80A 2W0VA 5CQPA 5DDVA 4HO3A 4ASJA 5FU0A 1HM0A 1H5RA 4G3SA 1VH1A 3TQDA 1FXJA 1LVWA 1WVCA 4YS8A 5FTVA 5C1GA 1R7XA 5C8RA 1E5KA 1G95A 1G2VA 3R2WA 3R3IA 2NXVA 3QVBA 4B2XA 5CMJA 3CKJA 3Q7UA 4B4BA 4D0ZA 5AJPA 1H4CA 2FFUA 4HO2A 2Y7AA 2V0JA 1HJJA 3I0IX 3N9WA 1VPAA 5C47A 5BXCA 4P00A 3SX7A 4EVWA 1NKHB 2VS5A 3SXCA 4BMAA 1VICA 4IRQA 2ZU8A 3OAMA 1NMMB 1MC3A 4AYJA 4Y7TA 1EZIA 1WT2A 1VGZA 3I0JA 4FRAA 1LL3A 3U0XA 1WT0A 1ZJ3A 1MP5A 4EE4A 1ZCYA 1ZHJA 3IOJA 3SXGA 1G1LA 5CMIA 1TW1A 1H5SB 3I0KA 3V0NA 2Y4KA 2AH9A 3TZTA 3OH4A 4NAIA 3FOQA 1VZXA 1QGQA 2WEEA 4XWIA 3USQA 2VSHA 1W55A 1W77A 1VM8A 1OQMB 4KC1A 1FR8A 4ARWA 4AAWA 4Y62A 4J18A 2BO7A 1GX0A 4NAKA 2BO4A 3D8VA 1H7HA 1HM8A 2ICXA 3OC9A 4M2AA 2V0IA 3SXEA 1H5TB 1NHEB 4CVHA 4Y7VA 4FRLA 4E1KA 1XHBA 4HG6A 5C4CA 3DJ4A 4ASYA 1LL0A 3CKNA 2APCA 3JUJA 4NALA 1H5SA 4B42A 4D0TA 4KPZA 2FYDB 5HS2A 1G8OA 1FO8A 3ZLKA 5IFYA 5JQQA 2FYBA 1INIA 1S4NA 5EJZA 1H3MA 2AGDA 2Y6PA 2AESA 2RJ9A 4LW3A 5C49A 2XMEA 1G0RA 2RIZA 1FRWA 4LW6A 4KRVA 3OH3A 1ZDGA 1GX4A 2YQSA 2YCMA 1FXOA 4P02A 1O7OA 4D48A 4M28A 5CQOA 2JCKA 1FGXA 2Z87A 2YC3A 1H5TA 3I0HA 2Y4LA 1H7TA 2O1GA 1V82A 3CKOA 4JISA 3K8DA 1IIMA 2I5KA 4GBPA 1GQCA 2E8BA 1TW5A 1TVYA 1V84A 5C1HA 1Z90A 1K4VA 4G87A 4B4GA 4IRPA 2QKXA 3U0YA 2X65A 2PX7A 3SXAA 4M4KA 2P6WA 1JV1A 2RJ8A 3V90A 3CU0A 2ZU9A 3ST8A 4EE5A 3JTJA 1H5SC 4KPXA 3RMWA 2RJ6A 2OEFA 1FO9A 3OGZA 2RJ1A 2YESA 1VGUA 1GWVA 2RIYA 4KNXA 5J49A 4EEAA 3ZGGA 4ZDQA 2XWMA 2YQHA 4FROA 1FOAA 3U2XA 2VFZA 2WVLA 4HO6A 5FUHA 2WGZA 3FWWA 3RMVA 4HCQA 1G97A 1XZ6A 1FGGA 3BRKX 3V91A 3CGXA 4CJBA 2Q4JA 1FG5N 1JYLA 4EEMA 1ZCUA 1R82A 2CU2A 5CQLX 1R7YA 3RSBA 1ZI4A 3SX8A 2RJ7A 1LZ7A 1PZYB 3SPTA 2RJ5A 3T7NA 2VXMA 2OI5A 2YC5A 3I0GA 4FRQA 1JV3A 1VH3A 2A8UA 2XWLA 4HO8A 1H4DA 1ZI1A 1VZTA 2D7RA 4BQHA 4Y7GA 3T7MA 1ZI5A 2FY7A 2MZBA 2FYAA 4HO9A 4Y7UA 1LZJA 1V83A 1S4PA 4HO4A 4FRMA 1ZJ1A 3PKQA 2E3DA 5I1FA 3I0FA 3NGWA 3T7OA 2VXLA 5AJNA 3ZLLA 4AYLA 5C48A 5C4FA 5IDTA 2FFVA 2WE9A 2ICYA 1QGSA 4EEOA 2D0JA 3ZGFA 5FV9A 4G3QA 2Z86A 4B5BA 5C4EA 1HJLA 4FCEA 1ON6A 3PKPA 2O1FA 2W0WA 1FWYA 4FREA 4Y7FA 4DECA 1IINA 2PA4A 5EJ1A 3CKQA 3EE5A 2WAWA 2V0HA 1PZTA 2A8WA 1H7QA 1NQIB 2JCJA 4DE7A 2WVMA 4C2SA 4KC2A 4FRHA 3K8EA 1LL2A 1MP3A 1EYRA 4FCUA 1G9RA 3JUKA 5CMFX 2OI7A 3OKRA 3I0CA 1WSZA 2GGQA 3Q80A 1OMZA 1ON8A 3V0QA 3KIAA 2PGYA 1LZIA 1S4OA 4B3UA 1JYKA 4Y63A 3O3PA 4AC3A 5FU8A 2VD4A 4KNRA 1VGTA 5L6SA 4D11A 4G3PA 2I7BA 5C4BA 1ZCVA 1ZJOA 1ZDFA 1YP2A 3PNNA 2AM3A 5CMGX 2X60A 4FRDA 1H7FA 2RJ4A 4Y9XA 1WT3A 5C3AA 2O1HA 5CMHA 1H7EA 3CKVA 2QH5A 3V0OA 3D5NA 1QG8A 3V8ZA 2PGVA 2P72A 2VS3A 1HV9A 3SX5A 3SX3A 2AECA 4B2WA 5AJOA 3U2UA 2BO6A 2OI6A 1R7UA 2XWNA 2FYCB 3OH2A 1VZUA 4DDZA 3V0PA 1I52A 4CJCA 4Y6NA 3USRA 3DUVA 4B4MA 1NF5B 4MNDA 2AE7A 2D7IA 2V0KA 3E26A 2I5EA 4HO0A 1ZIZA 5C36A 1ZCTA 1QWJA 5C4DA 2Y4MA 2AM5A 1R7TA 3ZF8A 4HOCA 4Y6UA 4R7PA 3D98A 2P73A 2VSIA 1O0RA 1HM9A 1G23A 5C3DA 1H5SD 3DK5A 2X5SA 3GUEA 4FRBA 2RITA 3U2WA 5FTSA 2XMHA 4D11C 3POLA 4KQLA 3V0MA 4L41C 1FR9A 5FYEA 2Y4JA 1H7GA 4EE3A 4M2BA 1G93A 1TZFA 2YQJA 5L6VA 1NWGB 2UX8A 5EIYA 2RIXA 3LW6A 4MYBA 4FQWA 2WVKA 1GQ9A 1H4EA 2GGOA 1YP4A 1ZJPA 1VGWA
chains in the Genus database with same CATH superfamily
2AM4A 5C3BA 1FZWA 2DPWA 3E25A 3HL3A 5DDTA 5C1LA 1JVGA 5CQMX 3V0LA 1ZJ2A 4UEGA 1GA8A 2BO8A 4KC4A 4JD0A 1MP4A 2J0BA 1ZI3A 2YQCA 1ZJ0A 5C38A 1LZ0A 1KWSA 1WT1A 3SXBA 1GWWA 2ZU7A 4KXOA 1OMXA 3I0DA 3OH0A 1H5RB 3IOHA 1JVDA 1O23B 4KT7A 3U2VA 2QGIA 2OEGA 2V0LA 3U2TA 3Q4SA 4HO5A 2JCOA 1YP3A 2VS4A 3F1YA 1O7QA 1YROB 2RJ0A 3OH1A 1R81A 3IOIA 3SXDA 1R7VA 4EEGA 2JCLA 3I0LA 2X5ZA 1SS9A 5IDSA 4Y64A 3V8YA 1G3LA 3BCVA 4K6RA 3F1CA 4ECMA 4CJ8A 5CQNX 1H7LA 4NANA 3I0EA 1INJA 1W57A 4FRPA 1R80A 2W0VA 5CQPA 5DDVA 4HO3A 4ASJA 5FU0A 1HM0A 1H5RA 4G3SA 1VH1A 3TQDA 1FXJA 1LVWA 5D92A 1WVCA 4YS8A 5FTVA 5C1GA 1R7XA 5C8RA 1E5KA 1G95A 1G2VA 3R2WA 3R3IA 2NXVA 3QVBA 4B2XA 5CMJA 3CKJA 3Q7UA 4B4BA 4D0ZA 5AJPA 4FIXA 1H4CA 2FFUA 4HO2A 2Y7AA 2V0JA 1HJJA 3I0IX 3N9WA 1VPAA 5C47A 5BXCA 4P00A 3SX7A 4EVWA 1NKHB 2VS5A 3SXCA 4BMAA 1VICA 4IRQA 2ZU8A 3OAMA 1NMMB 1MC3A 4AYJA 4Y7TA 1EZIA 1WT2A 1VGZA 3I0JA 4FRAA 1LL3A 3U0XA 1WT0A 1ZJ3A 1MP5A 4EE4A 1ZCYA 1ZHJA 3IOJA 3SXGA 1G1LA 5CMIA 1TW1A 1H5SB 3I0KA 3V0NA 2Y4KA 2AH9A 3TZTA 3OH4A 4NAIA 3FOQA 1VZXA 1QGQA 2WEEA 4XWIA 3USQA 2VSHA 1W55A 1W77A 1VM8A 1OQMB 4KC1A 1FR8A 4ARWA 4AAWA 4Y62A 4J18A 2BO7A 1GX0A 4NAKA 2BO4A 3D8VA 1H7HA 1HM8A 2ICXA 3OC9A 4M2AA 2V0IA 3SXEA 1H5TB 1NHEB 4CVHA 4Y7VA 4FRLA 4E1KA 1XHBA 4HG6A 5C4CA 3DJ4A 4ASYA 1LL0A 3CKNA 2APCA 3JUJA 4NALA 1H5SA 4B42A 4D0TA 4KPZA 2FYDB 5HS2A 1G8OA 1FO8A 3ZLKA 5IFYA 5JQQA 2FYBA 1INIA 1S4NA 5EJZA 1H3MA 2AGDA 2Y6PA 2AESA 2RJ9A 4LW3A 5C49A 2XMEA 1G0RA 2RIZA 1FRWA 4LW6A 4KRVA 3OH3A 1ZDGA 1GX4A 2YQSA 2YCMA 1FXOA 4P02A 1O7OA 4D48A 4M28A 5CQOA 2J0AA 2JCKA 1FGXA 2Z87A 2YC3A 1H5TA 3I0HA 2Y4LA 1H7TA 2O1GA 1V82A 3CKOA 4JISA 3K8DA 1IIMA 2I5KA 4GBPA 1GQCA 2E8BA 1TW5A 1TVYA 1V84A 5C1HA 1Z90A 1K4VA 4G87A 4B4GA 4IRPA 2QKXA 3U0YA 2X65A 2PX7A 3SXAA 4M4KA 2P6WA 1JV1A 2RJ8A 3V90A 3CU0A 2ZU9A 3ST8A 4EE5A 3JTJA 1H5SC 4KPXA 3RMWA 2RJ6A 2OEFA 1FO9A 3OGZA 2RJ1A 2YESA 1VGUA 1GWVA 2RIYA 4KNXA 5J49A 4EEAA 3ZGGA 4ZDQA 2XWMA 2YQHA 4FROA 1FOAA 3U2XA 2VFZA 2WVLA 4HO6A 5FUHA 2WGZA 3FWWA 3RMVA 4HCQA 1G97A 1XZ6A 1FGGA 3BRKX 3V91A 3CGXA 4CJBA 2Q4JA 1FG5N 1JYLA 4EEMA 1ZCUA 4MIXA 1R82A 2CU2A 5CQLX 1R7YA 3RSBA 1ZI4A 3SX8A 2RJ7A 1LZ7A 1PZYB 3SPTA 2RJ5A 3T7NA 2VXMA 2OI5A 2YC5A 3I0GA 4FRQA 1JV3A 1VH3A 2A8UA 2XWLA 4HO8A 1H4DA 1ZI1A 1VZTA 2D7RA 5D91A 4BQHA 4Y7GA 3T7MA 1ZI5A 2FY7A 2MZBA 2FYAA 4HO9A 4Y7UA 1LZJA 1V83A 1S4PA 4HO4A 4FRMA 1ZJ1A 3PKQA 2E3DA 5I1FA 3I0FA 3NGWA 3T7OA 2VXLA 4Q7CA 5AJNA 3ZLLA 4AYLA 5C48A 5C4FA 5IDTA 2FFVA 2WE9A 2ICYA 4O6MA 1QGSA 4EEOA 2D0JA 3ZGFA 5FV9A 4G3QA 2Z86A 4B5BA 5C4EA 1HJLA 4FCEA 1ON6A 3PKPA 2O1FA 2W0WA 1FWYA 4FREA 4Y7FA 4DECA 1IINA 2PA4A 5EJ1A 3CKQA 3EE5A 2WAWA 2V0HA 1PZTA 2A8WA 1H7QA 1NQIB 2JCJA 4DE7A 2WVMA 4C2SA 4KC2A 4FRHA 3K8EA 1LL2A 1MP3A 1EYRA 4FCUA 1G9RA 3JUKA 5CMFX 2OI7A 3OKRA 3I0CA 1WSZA 2GGQA 3Q80A 1OMZA 1ON8A 3V0QA 3KIAA 2PGYA 1LZIA 1S4OA 4B3UA 1JYKA 4Y63A 3O3PA 4AC3A 5FU8A 2VD4A 4KNRA 1VGTA 5L6SA 4D11A 4G3PA 2I7BA 5C4BA 1ZCVA 1ZJOA 1ZDFA 1YP2A 3PNNA 2AM3A 5CMGX 2X60A 4FRDA 1H7FA 2RJ4A 4Y9XA 1WT3A 5C3AA 2O1HA 5CMHA 1H7EA 3CKVA 2QH5A 3V0OA 3D5NA 1QG8A 3V8ZA 2PGVA 2P72A 4O6NA 2VS3A 1HV9A 3SX5A 3SX3A 2AECA 4B2WA 5AJOA 3U2UA 2BO6A 2OI6A 1R7UA 2XWNA 2FYCB 3OH2A 1VZUA 4DDZA 3V0PA 1I52A 4CJCA 4Y6NA 3USRA 3DUVA 4B4MA 1NF5B 4FIYA 4MNDA 2AE7A 2D7IA 2V0KA 3E26A 2I5EA 4HO0A 1ZIZA 5C36A 1ZCTA 1QWJA 5C4DA 2Y4MA 2AM5A 1R7TA 3ZF8A 4HOCA 4Y6UA 4R7PA 3D98A 2P73A 2VSIA 1O0RA 1HM9A 1G23A 5C3DA 1H5SD 3DK5A 2X5SA 3GUEA 4FRBA 2RITA 3U2WA 5FTSA 2XMHA 4D11C 3POLA 4KQLA 3V0MA 4L41C 1FR9A 2C0NA 5FYEA 2Y4JA 1H7GA 4EE3A 4M2BA 1G93A 1TZFA 2YQJA 5L6VA 1NWGB 2UX8A 5EIYA 2RIXA 2VK9A 3LW6A 4MYBA 4FQWA 2WVKA 1GQ9A 1H4EA 2GGOA 1YP4A 1ZJPA 1VGWA
chains in the Genus database with same CATH topology
2AM4A 5C3BA 1FZWA 2DPWA 3E25A 3HL3A 5DDTA 5C1LA 1JVGA 5CQMX 3V0LA 1ZJ2A 4UEGA 1GA8A 2BO8A 4KC4A 4JD0A 1MP4A 2J0BA 1ZI3A 2YQCA 1ZJ0A 5C38A 1LZ0A 1KWSA 1WT1A 3SXBA 1GWWA 2ZU7A 4KXOA 1OMXA 3I0DA 3OH0A 1H5RB 3IOHA 1JVDA 1O23B 4KT7A 3U2VA 2QGIA 2OEGA 2V0LA 3U2TA 3Q4SA 4HO5A 2JCOA 1YP3A 2VS4A 3F1YA 1O7QA 1YROB 2RJ0A 3OH1A 1R81A 3IOIA 3SXDA 1R7VA 4EEGA 2JCLA 3I0LA 2X5ZA 1SS9A 5IDSA 4Y64A 3V8YA 1G3LA 3BCVA 4K6RA 3F1CA 4ECMA 4CJ8A 5CQNX 1H7LA 4NANA 3I0EA 1INJA 1W57A 4FRPA 1R80A 2W0VA 5CQPA 5DDVA 4HO3A 4ASJA 5FU0A 1HM0A 1H5RA 4G3SA 1VH1A 3TQDA 1FXJA 1LVWA 5D92A 1WVCA 4YS8A 5FTVA 5C1GA 1R7XA 5C8RA 1E5KA 1G95A 1G2VA 3R2WA 3R3IA 2NXVA 3QVBA 4B2XA 5CMJA 3CKJA 3Q7UA 4B4BA 4D0ZA 5AJPA 4FIXA 1H4CA 2FFUA 4HO2A 2Y7AA 2V0JA 1HJJA 3I0IX 3N9WA 1VPAA 5C47A 5BXCA 4P00A 3SX7A 4EVWA 1NKHB 2VS5A 3SXCA 4BMAA 1VICA 4IRQA 2ZU8A 3OAMA 1NMMB 1MC3A 4AYJA 4Y7TA 1EZIA 1WT2A 1VGZA 3I0JA 4FRAA 1LL3A 3U0XA 1WT0A 1ZJ3A 1MP5A 4EE4A 1ZCYA 1ZHJA 3IOJA 3SXGA 1G1LA 5CMIA 1TW1A 1H5SB 3I0KA 3V0NA 2Y4KA 2AH9A 3TZTA 3OH4A 4NAIA 3FOQA 1VZXA 1QGQA 2WEEA 4XWIA 3USQA 2VSHA 1W55A 1W77A 1VM8A 1OQMB 4KC1A 1FR8A 4ARWA 4AAWA 4Y62A 4J18A 2BO7A 1GX0A 4NAKA 2BO4A 3D8VA 1H7HA 1HM8A 2ICXA 3OC9A 4M2AA 2V0IA 3SXEA 1H5TB 1NHEB 4CVHA 4Y7VA 4FRLA 4E1KA 1XHBA 4HG6A 5C4CA 3DJ4A 4ASYA 1LL0A 3CKNA 2APCA 3JUJA 4NALA 1H5SA 4B42A 4D0TA 4KPZA 2FYDB 5HS2A 1G8OA 1FO8A 3ZLKA 5IFYA 5JQQA 2FYBA 1INIA 1S4NA 5EJZA 1H3MA 2AGDA 2Y6PA 2AESA 2RJ9A 4LW3A 5C49A 2XMEA 1G0RA 2RIZA 1FRWA 4LW6A 4KRVA 3OH3A 1ZDGA 1GX4A 2YQSA 2YCMA 1FXOA 4P02A 1O7OA 4D48A 4M28A 5CQOA 2J0AA 2JCKA 1FGXA 2Z87A 2YC3A 1H5TA 3I0HA 2Y4LA 1H7TA 2O1GA 1V82A 3CKOA 4JISA 3K8DA 1IIMA 2I5KA 4GBPA 1GQCA 2E8BA 1TW5A 1TVYA 1V84A 5C1HA 1Z90A 1K4VA 4G87A 4B4GA 4IRPA 2QKXA 3U0YA 2X65A 2PX7A 3SXAA 4M4KA 2P6WA 1JV1A 2RJ8A 3V90A 3CU0A 2ZU9A 3ST8A 4EE5A 3JTJA 1H5SC 4KPXA 3RMWA 2RJ6A 2OEFA 1FO9A 3OGZA 2RJ1A 2YESA 1VGUA 1GWVA 2RIYA 4KNXA 5J49A 4EEAA 3ZGGA 4ZDQA 2XWMA 2YQHA 4FROA 1FOAA 3U2XA 2VFZA 2WVLA 4HO6A 5FUHA 2WGZA 3FWWA 3RMVA 4HCQA 1G97A 1XZ6A 1FGGA 3BRKX 3V91A 3CGXA 4CJBA 2Q4JA 1FG5N 1JYLA 4EEMA 1ZCUA 4MIXA 1R82A 2CU2A 5CQLX 1R7YA 3RSBA 1ZI4A 3SX8A 2RJ7A 1LZ7A 1PZYB 3SPTA 2RJ5A 3T7NA 2VXMA 2OI5A 2YC5A 3I0GA 4FRQA 1JV3A 1VH3A 2A8UA 2XWLA 4HO8A 1H4DA 1ZI1A 1VZTA 2D7RA 5D91A 4BQHA 4Y7GA 3T7MA 1ZI5A 2FY7A 2MZBA 2FYAA 4HO9A 4Y7UA 1LZJA 1V83A 1S4PA 4HO4A 4FRMA 1ZJ1A 3PKQA 2E3DA 5I1FA 3I0FA 3NGWA 3T7OA 2VXLA 4Q7CA 5AJNA 3ZLLA 4AYLA 5C48A 5C4FA 5IDTA 2FFVA 2WE9A 2ICYA 4O6MA 1QGSA 4EEOA 2D0JA 3ZGFA 5FV9A 4G3QA 2Z86A 4B5BA 5C4EA 1HJLA 4FCEA 1ON6A 3PKPA 2O1FA 2W0WA 1FWYA 4FREA 4Y7FA 4DECA 1IINA 2PA4A 5EJ1A 3CKQA 3EE5A 2WAWA 2V0HA 1PZTA 2A8WA 1H7QA 1NQIB 2JCJA 4DE7A 2WVMA 4C2SA 4KC2A 4FRHA 3K8EA 1LL2A 1MP3A 1EYRA 4FCUA 1G9RA 3JUKA 5CMFX 2OI7A 3OKRA 3I0CA 1WSZA 2GGQA 3Q80A 1OMZA 1ON8A 3V0QA 3KIAA 2PGYA 1LZIA 1S4OA 4B3UA 1JYKA 4Y63A 3O3PA 4AC3A 5FU8A 2VD4A 4KNRA 1VGTA 5L6SA 4D11A 4G3PA 2I7BA 5C4BA 1ZCVA 1ZJOA 1ZDFA 1YP2A 3PNNA 2AM3A 5CMGX 2X60A 4FRDA 1H7FA 2RJ4A 4Y9XA 1WT3A 5C3AA 2O1HA 5CMHA 1H7EA 3CKVA 2QH5A 3V0OA 3D5NA 1QG8A 3V8ZA 2PGVA 2P72A 4O6NA 2VS3A 1HV9A 3SX5A 3SX3A 2AECA 4B2WA 5AJOA 3U2UA 2BO6A 2OI6A 1R7UA 2XWNA 2FYCB 3OH2A 1VZUA 4DDZA 3V0PA 1I52A 4CJCA 4Y6NA 3USRA 3DUVA 4B4MA 1NF5B 4FIYA 4MNDA 2AE7A 2D7IA 2V0KA 3E26A 2I5EA 4HO0A 1ZIZA 5C36A 1ZCTA 1QWJA 5C4DA 2Y4MA 2AM5A 1R7TA 3ZF8A 4HOCA 4Y6UA 4R7PA 3D98A 2P73A 2VSIA 1O0RA 1HM9A 1G23A 5C3DA 1H5SD 3DK5A 2X5SA 3GUEA 4FRBA 2RITA 3U2WA 5FTSA 2XMHA 4D11C 3POLA 4KQLA 3V0MA 4L41C 1FR9A 2C0NA 5FYEA 2Y4JA 1H7GA 4EE3A 4M2BA 1G93A 1TZFA 2YQJA 5L6VA 1NWGB 2UX8A 5EIYA 2RIXA 2VK9A 3LW6A 4MYBA 4FQWA 2WVKA 1GQ9A 1H4EA 2GGOA 1YP4A 1ZJPA 1VGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AM4 A;  5C3B A;  1FZW A;  2DPW A;  3E25 A;  3HL3 A;  5DDT A;  5C1L A;  1JVG A;  5CQM X;  3V0L A;  1ZJ2 A;  4UEG A;  1GA8 A;  2BO8 A;  4KC4 A;  4JD0 A;  1MP4 A;  1ZI3 A;  2YQC A;  1ZJ0 A;  5C38 A;  1LZ0 A;  1KWS A;  1WT1 A;  3SXB A;  1GWW A;  2ZU7 A;  4KXO A;  1OMX A;  3I0D A;  3OH0 A;  1H5R B;  3IOH A;  1JVD A;  1O23 B;  4KT7 A;  3U2V A;  2QGI A;  2OEG A;  2V0L A;  3U2T A;  3Q4S A;  4HO5 A;  2JCO A;  1YP3 A;  2VS4 A;  3F1Y A;  1O7Q A;  1YRO B;  2RJ0 A;  3OH1 A;  1R81 A;  3IOI A;  3SXD A;  1R7V A;  4EEG A;  2JCL A;  3I0L A;  2X5Z A;  1SS9 A;  5IDS A;  4Y64 A;  3V8Y A;  1G3L A;  3BCV A;  4K6R A;  3F1C A;  4ECM A;  4CJ8 A;  5CQN X;  1H7L A;  4NAN A;  3I0E A;  1INJ A;  1W57 A;  4FRP A;  1R80 A;  2W0V A;  5CQP A;  5DDV A;  4HO3 A;  4ASJ A;  5FU0 A;  1HM0 A;  1H5R A;  4G3S A;  1VH1 A;  3TQD A;  1FXJ A;  1LVW A;  1WVC A;  4YS8 A;  5FTV A;  5C1G A;  1R7X A;  5C8R A;  1E5K A;  1G95 A;  1G2V A;  3R2W A;  3R3I A;  2NXV A;  3QVB A;  4B2X A;  5CMJ A;  3CKJ A;  3Q7U A;  4B4B A;  4D0Z A;  5AJP A;  1H4C A;  2FFU A;  4HO2 A;  2Y7A A;  2V0J A;  1HJJ A;  3I0I X;  3N9W A;  1VPA A;  5C47 A;  5BXC A;  4P00 A;  3SX7 A;  4EVW A;  1NKH B;  2VS5 A;  3SXC A;  4BMA A;  1VIC A;  4IRQ A;  2ZU8 A;  3OAM A;  1NMM B;  1MC3 A;  4AYJ A;  4Y7T A;  1EZI A;  1WT2 A;  1VGZ A;  3I0J A;  4FRA A;  1LL3 A;  3U0X A;  1WT0 A;  1ZJ3 A;  1MP5 A;  4EE4 A;  1ZCY A;  1ZHJ A;  3IOJ A;  3SXG A;  1G1L A;  5CMI A;  1TW1 A;  1H5S B;  3I0K A;  3V0N A;  2Y4K A;  2AH9 A;  3TZT A;  3OH4 A;  4NAI A;  3FOQ A;  1VZX A;  1QGQ A;  2WEE A;  4XWI A;  3USQ A;  2VSH A;  1W55 A;  1W77 A;  1VM8 A;  1OQM B;  4KC1 A;  1FR8 A;  4ARW A;  4AAW A;  4Y62 A;  4J18 A;  2BO7 A;  1GX0 A;  4NAK A;  2BO4 A;  3D8V A;  1H7H A;  1HM8 A;  2ICX A;  3OC9 A;  4M2A A;  2V0I A;  3SXE A;  1H5T B;  1NHE B;  4CVH A;  4Y7V A;  4FRL A;  4E1K A;  1XHB A;  4HG6 A;  5C4C A;  3DJ4 A;  4ASY A;  1LL0 A;  3CKN A;  2APC A;  3JUJ A;  4NAL A;  1H5S A;  4B42 A;  4D0T A;  4KPZ A;  2FYD B;  5HS2 A;  1G8O A;  1FO8 A;  3ZLK A;  5IFY A;  5JQQ A;  2FYB A;  1INI A;  1S4N A;  5EJZ A;  1H3M A;  2AGD A;  2Y6P A;  2AES A;  2RJ9 A;  4LW3 A;  5C49 A;  2XME A;  1G0R A;  2RIZ A;  1FRW A;  4LW6 A;  4KRV A;  3OH3 A;  1ZDG A;  1GX4 A;  2YQS A;  2YCM A;  1FXO A;  4P02 A;  1O7O A;  4D48 A;  4M28 A;  5CQO A;  2JCK A;  1FGX A;  2Z87 A;  2YC3 A;  1H5T A;  3I0H A;  2Y4L A;  1H7T A;  2O1G A;  1V82 A;  3CKO A;  4JIS A;  3K8D A;  1IIM A;  2I5K A;  4GBP A;  1GQC A;  2E8B A;  1TW5 A;  1TVY A;  1V84 A;  5C1H A;  1Z90 A;  1K4V A;  4G87 A;  4B4G A;  4IRP A;  2QKX A;  3U0Y A;  2X65 A;  2PX7 A;  3SXA A;  4M4K A;  2P6W A;  1JV1 A;  2RJ8 A;  3V90 A;  3CU0 A;  2ZU9 A;  3ST8 A;  4EE5 A;  3JTJ A;  1H5S C;  4KPX A;  3RMW A;  2RJ6 A;  2OEF A;  1FO9 A;  3OGZ A;  2RJ1 A;  2YES A;  1VGU A;  1GWV A;  2RIY A;  4KNX A;  5J49 A;  4EEA A;  3ZGG A;  4ZDQ A;  2XWM A;  2YQH A;  4FRO A;  1FOA A;  3U2X A;  2VFZ A;  2WVL A;  4HO6 A;  5FUH A;  2WGZ A;  3FWW A;  3RMV A;  4HCQ A;  1G97 A;  1XZ6 A;  1FGG A;  3BRK X;  3V91 A;  3CGX A;  4CJB A;  2Q4J A;  1FG5 N;  1JYL A;  4EEM A;  1ZCU A;  1R82 A;  2CU2 A;  5CQL X;  1R7Y A;  3RSB A;  1ZI4 A;  3SX8 A;  2RJ7 A;  1LZ7 A;  1PZY B;  3SPT A;  2RJ5 A;  3T7N A;  2VXM A;  2OI5 A;  2YC5 A;  3I0G A;  4FRQ A;  1JV3 A;  1VH3 A;  2A8U A;  2XWL A;  4HO8 A;  1H4D A;  1ZI1 A;  1VZT A;  2D7R A;  4BQH A;  4Y7G A;  3T7M A;  1ZI5 A;  2FY7 A;  2MZB A;  2FYA A;  4HO9 A;  4Y7U A;  1LZJ A;  1V83 A;  1S4P A;  4HO4 A;  4FRM A;  1ZJ1 A;  3PKQ A;  2E3D A;  5I1F A;  3I0F A;  3NGW A;  3T7O A;  2VXL A;  5AJN A;  3ZLL A;  4AYL A;  5C48 A;  5C4F A;  5IDT A;  2FFV A;  2WE9 A;  2ICY A;  1QGS A;  4EEO A;  2D0J A;  3ZGF A;  5FV9 A;  4G3Q A;  2Z86 A;  4B5B A;  5C4E A;  1HJL A;  4FCE A;  1ON6 A;  3PKP A;  2O1F A;  2W0W A;  1FWY A;  4FRE A;  4Y7F A;  4DEC A;  1IIN A;  2PA4 A;  5EJ1 A;  3CKQ A;  3EE5 A;  2WAW A;  2V0H A;  1PZT A;  2A8W A;  1H7Q A;  1NQI B;  2JCJ A;  4DE7 A;  2WVM A;  4C2S A;  4KC2 A;  4FRH A;  3K8E A;  1LL2 A;  1MP3 A;  1EYR A;  4FCU A;  1G9R A;  3JUK A;  5CMF X;  2OI7 A;  3OKR A;  3I0C A;  1WSZ A;  2GGQ A;  3Q80 A;  1OMZ A;  1ON8 A;  3V0Q A;  3KIA A;  2PGY A;  1LZI A;  1S4O A;  4B3U A;  1JYK A;  4Y63 A;  3O3P A;  4AC3 A;  5FU8 A;  2VD4 A;  4KNR A;  1VGT A;  5L6S A;  4D11 A;  4G3P A;  2I7B A;  5C4B A;  1ZCV A;  1ZJO A;  1ZDF A;  1YP2 A;  3PNN A;  2AM3 A;  5CMG X;  2X60 A;  4FRD A;  1H7F A;  2RJ4 A;  4Y9X A;  1WT3 A;  5C3A A;  2O1H A;  5CMH A;  1H7E A;  3CKV A;  2QH5 A;  3V0O A;  3D5N A;  1QG8 A;  3V8Z A;  2PGV A;  2P72 A;  2VS3 A;  1HV9 A;  3SX5 A;  3SX3 A;  2AEC A;  4B2W A;  5AJO A;  3U2U A;  2BO6 A;  2OI6 A;  1R7U A;  2XWN A;  2FYC B;  3OH2 A;  1VZU A;  4DDZ A;  3V0P A;  1I52 A;  4CJC A;  4Y6N A;  3USR A;  3DUV A;  4B4M A;  1NF5 B;  4MND A;  2AE7 A;  2D7I A;  2V0K A;  3E26 A;  2I5E A;  4HO0 A;  1ZIZ A;  5C36 A;  1ZCT A;  1QWJ A;  5C4D A;  2Y4M A;  2AM5 A;  1R7T A;  3ZF8 A;  4HOC A;  4Y6U A;  4R7P A;  3D98 A;  2P73 A;  2VSI A;  1O0R A;  1HM9 A;  1G23 A;  5C3D A;  1H5S D;  3DK5 A;  2X5S A;  3GUE A;  4FRB A;  2RIT A;  3U2W A;  5FTS A;  2XMH A;  4D11 C;  3POL A;  4KQL A;  3V0M A;  4L41 C;  1FR9 A;  5FYE A;  2Y4J A;  1H7G A;  4EE3 A;  4M2B A;  1G93 A;  1TZF A;  2YQJ A;  5L6V A;  1NWG B;  2UX8 A;  5EIY A;  2RIX A;  3LW6 A;  4MYB A;  4FQW A;  2WVK A;  1GQ9 A;  1H4E A;  2GGO A;  1YP4 A;  1ZJP A;  1VGW A; 
#chains in the Genus database with same CATH topology
 2AM4 A;  5C3B A;  1FZW A;  2DPW A;  3E25 A;  3HL3 A;  5DDT A;  5C1L A;  1JVG A;  5CQM X;  3V0L A;  1ZJ2 A;  4UEG A;  1GA8 A;  2BO8 A;  4KC4 A;  4JD0 A;  1MP4 A;  2J0B A;  1ZI3 A;  2YQC A;  1ZJ0 A;  5C38 A;  1LZ0 A;  1KWS A;  1WT1 A;  3SXB A;  1GWW A;  2ZU7 A;  4KXO A;  1OMX A;  3I0D A;  3OH0 A;  1H5R B;  3IOH A;  1JVD A;  1O23 B;  4KT7 A;  3U2V A;  2QGI A;  2OEG A;  2V0L A;  3U2T A;  3Q4S A;  4HO5 A;  2JCO A;  1YP3 A;  2VS4 A;  3F1Y A;  1O7Q A;  1YRO B;  2RJ0 A;  3OH1 A;  1R81 A;  3IOI A;  3SXD A;  1R7V A;  4EEG A;  2JCL A;  3I0L A;  2X5Z A;  1SS9 A;  5IDS A;  4Y64 A;  3V8Y A;  1G3L A;  3BCV A;  4K6R A;  3F1C A;  4ECM A;  4CJ8 A;  5CQN X;  1H7L A;  4NAN A;  3I0E A;  1INJ A;  1W57 A;  4FRP A;  1R80 A;  2W0V A;  5CQP A;  5DDV A;  4HO3 A;  4ASJ A;  5FU0 A;  1HM0 A;  1H5R A;  4G3S A;  1VH1 A;  3TQD A;  1FXJ A;  1LVW A;  5D92 A;  1WVC A;  4YS8 A;  5FTV A;  5C1G A;  1R7X A;  5C8R A;  1E5K A;  1G95 A;  1G2V A;  3R2W A;  3R3I A;  2NXV A;  3QVB A;  4B2X A;  5CMJ A;  3CKJ A;  3Q7U A;  4B4B A;  4D0Z A;  5AJP A;  4FIX A;  1H4C A;  2FFU A;  4HO2 A;  2Y7A A;  2V0J A;  1HJJ A;  3I0I X;  3N9W A;  1VPA A;  5C47 A;  5BXC A;  4P00 A;  3SX7 A;  4EVW A;  1NKH B;  2VS5 A;  3SXC A;  4BMA A;  1VIC A;  4IRQ A;  2ZU8 A;  3OAM A;  1NMM B;  1MC3 A;  4AYJ A;  4Y7T A;  1EZI A;  1WT2 A;  1VGZ A;  3I0J A;  4FRA A;  1LL3 A;  3U0X A;  1WT0 A;  1ZJ3 A;  1MP5 A;  4EE4 A;  1ZCY A;  1ZHJ A;  3IOJ A;  3SXG A;  1G1L A;  5CMI A;  1TW1 A;  1H5S B;  3I0K A;  3V0N A;  2Y4K A;  2AH9 A;  3TZT A;  3OH4 A;  4NAI A;  3FOQ A;  1VZX A;  1QGQ A;  2WEE A;  4XWI A;  3USQ A;  2VSH A;  1W55 A;  1W77 A;  1VM8 A;  1OQM B;  4KC1 A;  1FR8 A;  4ARW A;  4AAW A;  4Y62 A;  4J18 A;  2BO7 A;  1GX0 A;  4NAK A;  2BO4 A;  3D8V A;  1H7H A;  1HM8 A;  2ICX A;  3OC9 A;  4M2A A;  2V0I A;  3SXE A;  1H5T B;  1NHE B;  4CVH A;  4Y7V A;  4FRL A;  4E1K A;  1XHB A;  4HG6 A;  5C4C A;  3DJ4 A;  4ASY A;  1LL0 A;  3CKN A;  2APC A;  3JUJ A;  4NAL A;  1H5S A;  4B42 A;  4D0T A;  4KPZ A;  2FYD B;  5HS2 A;  1G8O A;  1FO8 A;  3ZLK A;  5IFY A;  5JQQ A;  2FYB A;  1INI A;  1S4N A;  5EJZ A;  1H3M A;  2AGD A;  2Y6P A;  2AES A;  2RJ9 A;  4LW3 A;  5C49 A;  2XME A;  1G0R A;  2RIZ A;  1FRW A;  4LW6 A;  4KRV A;  3OH3 A;  1ZDG A;  1GX4 A;  2YQS A;  2YCM A;  1FXO A;  4P02 A;  1O7O A;  4D48 A;  4M28 A;  5CQO A;  2J0A A;  2JCK A;  1FGX A;  2Z87 A;  2YC3 A;  1H5T A;  3I0H A;  2Y4L A;  1H7T A;  2O1G A;  1V82 A;  3CKO A;  4JIS A;  3K8D A;  1IIM A;  2I5K A;  4GBP A;  1GQC A;  2E8B A;  1TW5 A;  1TVY A;  1V84 A;  5C1H A;  1Z90 A;  1K4V A;  4G87 A;  4B4G A;  4IRP A;  2QKX A;  3U0Y A;  2X65 A;  2PX7 A;  3SXA A;  4M4K A;  2P6W A;  1JV1 A;  2RJ8 A;  3V90 A;  3CU0 A;  2ZU9 A;  3ST8 A;  4EE5 A;  3JTJ A;  1H5S C;  4KPX A;  3RMW A;  2RJ6 A;  2OEF A;  1FO9 A;  3OGZ A;  2RJ1 A;  2YES A;  1VGU A;  1GWV A;  2RIY A;  4KNX A;  5J49 A;  4EEA A;  3ZGG A;  4ZDQ A;  2XWM A;  2YQH A;  4FRO A;  1FOA A;  3U2X A;  2VFZ A;  2WVL A;  4HO6 A;  5FUH A;  2WGZ A;  3FWW A;  3RMV A;  4HCQ A;  1G97 A;  1XZ6 A;  1FGG A;  3BRK X;  3V91 A;  3CGX A;  4CJB A;  2Q4J A;  1FG5 N;  1JYL A;  4EEM A;  1ZCU A;  4MIX A;  1R82 A;  2CU2 A;  5CQL X;  1R7Y A;  3RSB A;  1ZI4 A;  3SX8 A;  2RJ7 A;  1LZ7 A;  1PZY B;  3SPT A;  2RJ5 A;  3T7N A;  2VXM A;  2OI5 A;  2YC5 A;  3I0G A;  4FRQ A;  1JV3 A;  1VH3 A;  2A8U A;  2XWL A;  4HO8 A;  1H4D A;  1ZI1 A;  1VZT A;  2D7R A;  5D91 A;  4BQH A;  4Y7G A;  3T7M A;  1ZI5 A;  2FY7 A;  2MZB A;  2FYA A;  4HO9 A;  4Y7U A;  1LZJ A;  1V83 A;  1S4P A;  4HO4 A;  4FRM A;  1ZJ1 A;  3PKQ A;  2E3D A;  5I1F A;  3I0F A;  3NGW A;  3T7O A;  2VXL A;  4Q7C A;  5AJN A;  3ZLL A;  4AYL A;  5C48 A;  5C4F A;  5IDT A;  2FFV A;  2WE9 A;  2ICY A;  4O6M A;  1QGS A;  4EEO A;  2D0J A;  3ZGF A;  5FV9 A;  4G3Q A;  2Z86 A;  4B5B A;  5C4E A;  1HJL A;  4FCE A;  1ON6 A;  3PKP A;  2O1F A;  2W0W A;  1FWY A;  4FRE A;  4Y7F A;  4DEC A;  1IIN A;  2PA4 A;  5EJ1 A;  3CKQ A;  3EE5 A;  2WAW A;  2V0H A;  1PZT A;  2A8W A;  1H7Q A;  1NQI B;  2JCJ A;  4DE7 A;  2WVM A;  4C2S A;  4KC2 A;  4FRH A;  3K8E A;  1LL2 A;  1MP3 A;  1EYR A;  4FCU A;  1G9R A;  3JUK A;  5CMF X;  2OI7 A;  3OKR A;  3I0C A;  1WSZ A;  2GGQ A;  3Q80 A;  1OMZ A;  1ON8 A;  3V0Q A;  3KIA A;  2PGY A;  1LZI A;  1S4O A;  4B3U A;  1JYK A;  4Y63 A;  3O3P A;  4AC3 A;  5FU8 A;  2VD4 A;  4KNR A;  1VGT A;  5L6S A;  4D11 A;  4G3P A;  2I7B A;  5C4B A;  1ZCV A;  1ZJO A;  1ZDF A;  1YP2 A;  3PNN A;  2AM3 A;  5CMG X;  2X60 A;  4FRD A;  1H7F A;  2RJ4 A;  4Y9X A;  1WT3 A;  5C3A A;  2O1H A;  5CMH A;  1H7E A;  3CKV A;  2QH5 A;  3V0O A;  3D5N A;  1QG8 A;  3V8Z A;  2PGV A;  2P72 A;  4O6N A;  2VS3 A;  1HV9 A;  3SX5 A;  3SX3 A;  2AEC A;  4B2W A;  5AJO A;  3U2U A;  2BO6 A;  2OI6 A;  1R7U A;  2XWN A;  2FYC B;  3OH2 A;  1VZU A;  4DDZ A;  3V0P A;  1I52 A;  4CJC A;  4Y6N A;  3USR A;  3DUV A;  4B4M A;  1NF5 B;  4FIY A;  4MND A;  2AE7 A;  2D7I A;  2V0K A;  3E26 A;  2I5E A;  4HO0 A;  1ZIZ A;  5C36 A;  1ZCT A;  1QWJ A;  5C4D A;  2Y4M A;  2AM5 A;  1R7T A;  3ZF8 A;  4HOC A;  4Y6U A;  4R7P A;  3D98 A;  2P73 A;  2VSI A;  1O0R A;  1HM9 A;  1G23 A;  5C3D A;  1H5S D;  3DK5 A;  2X5S A;  3GUE A;  4FRB A;  2RIT A;  3U2W A;  5FTS A;  2XMH A;  4D11 C;  3POL A;  4KQL A;  3V0M A;  4L41 C;  1FR9 A;  2C0N A;  5FYE A;  2Y4J A;  1H7G A;  4EE3 A;  4M2B A;  1G93 A;  1TZF A;  2YQJ A;  5L6V A;  1NWG B;  2UX8 A;  5EIY A;  2RIX A;  2VK9 A;  3LW6 A;  4MYB A;  4FQW A;  2WVK A;  1GQ9 A;  1H4E A;  2GGO A;  1YP4 A;  1ZJP A;  1VGW A; 
#chains in the Genus database with same CATH homology
 2AM4 A;  5C3B A;  1FZW A;  2DPW A;  3E25 A;  3HL3 A;  5DDT A;  5C1L A;  1JVG A;  5CQM X;  3V0L A;  1ZJ2 A;  4UEG A;  1GA8 A;  2BO8 A;  4KC4 A;  4JD0 A;  1MP4 A;  2J0B A;  1ZI3 A;  2YQC A;  1ZJ0 A;  5C38 A;  1LZ0 A;  1KWS A;  1WT1 A;  3SXB A;  1GWW A;  2ZU7 A;  4KXO A;  1OMX A;  3I0D A;  3OH0 A;  1H5R B;  3IOH A;  1JVD A;  1O23 B;  4KT7 A;  3U2V A;  2QGI A;  2OEG A;  2V0L A;  3U2T A;  3Q4S A;  4HO5 A;  2JCO A;  1YP3 A;  2VS4 A;  3F1Y A;  1O7Q A;  1YRO B;  2RJ0 A;  3OH1 A;  1R81 A;  3IOI A;  3SXD A;  1R7V A;  4EEG A;  2JCL A;  3I0L A;  2X5Z A;  1SS9 A;  5IDS A;  4Y64 A;  3V8Y A;  1G3L A;  3BCV A;  4K6R A;  3F1C A;  4ECM A;  4CJ8 A;  5CQN X;  1H7L A;  4NAN A;  3I0E A;  1INJ A;  1W57 A;  4FRP A;  1R80 A;  2W0V A;  5CQP A;  5DDV A;  4HO3 A;  4ASJ A;  5FU0 A;  1HM0 A;  1H5R A;  4G3S A;  1VH1 A;  3TQD A;  1FXJ A;  1LVW A;  5D92 A;  1WVC A;  4YS8 A;  5FTV A;  5C1G A;  1R7X A;  5C8R A;  1E5K A;  1G95 A;  1G2V A;  3R2W A;  3R3I A;  2NXV A;  3QVB A;  4B2X A;  5CMJ A;  3CKJ A;  3Q7U A;  4B4B A;  4D0Z A;  5AJP A;  4FIX A;  1H4C A;  2FFU A;  4HO2 A;  2Y7A A;  2V0J A;  1HJJ A;  3I0I X;  3N9W A;  1VPA A;  5C47 A;  5BXC A;  4P00 A;  3SX7 A;  4EVW A;  1NKH B;  2VS5 A;  3SXC A;  4BMA A;  1VIC A;  4IRQ A;  2ZU8 A;  3OAM A;  1NMM B;  1MC3 A;  4AYJ A;  4Y7T A;  1EZI A;  1WT2 A;  1VGZ A;  3I0J A;  4FRA A;  1LL3 A;  3U0X A;  1WT0 A;  1ZJ3 A;  1MP5 A;  4EE4 A;  1ZCY A;  1ZHJ A;  3IOJ A;  3SXG A;  1G1L A;  5CMI A;  1TW1 A;  1H5S B;  3I0K A;  3V0N A;  2Y4K A;  2AH9 A;  3TZT A;  3OH4 A;  4NAI A;  3FOQ A;  1VZX A;  1QGQ A;  2WEE A;  4XWI A;  3USQ A;  2VSH A;  1W55 A;  1W77 A;  1VM8 A;  1OQM B;  4KC1 A;  1FR8 A;  4ARW A;  4AAW A;  4Y62 A;  4J18 A;  2BO7 A;  1GX0 A;  4NAK A;  2BO4 A;  3D8V A;  1H7H A;  1HM8 A;  2ICX A;  3OC9 A;  4M2A A;  2V0I A;  3SXE A;  1H5T B;  1NHE B;  4CVH A;  4Y7V A;  4FRL A;  4E1K A;  1XHB A;  4HG6 A;  5C4C A;  3DJ4 A;  4ASY A;  1LL0 A;  3CKN A;  2APC A;  3JUJ A;  4NAL A;  1H5S A;  4B42 A;  4D0T A;  4KPZ A;  2FYD B;  5HS2 A;  1G8O A;  1FO8 A;  3ZLK A;  5IFY A;  5JQQ A;  2FYB A;  1INI A;  1S4N A;  5EJZ A;  1H3M A;  2AGD A;  2Y6P A;  2AES A;  2RJ9 A;  4LW3 A;  5C49 A;  2XME A;  1G0R A;  2RIZ A;  1FRW A;  4LW6 A;  4KRV A;  3OH3 A;  1ZDG A;  1GX4 A;  2YQS A;  2YCM A;  1FXO A;  4P02 A;  1O7O A;  4D48 A;  4M28 A;  5CQO A;  2J0A A;  2JCK A;  1FGX A;  2Z87 A;  2YC3 A;  1H5T A;  3I0H A;  2Y4L A;  1H7T A;  2O1G A;  1V82 A;  3CKO A;  4JIS A;  3K8D A;  1IIM A;  2I5K A;  4GBP A;  1GQC A;  2E8B A;  1TW5 A;  1TVY A;  1V84 A;  5C1H A;  1Z90 A;  1K4V A;  4G87 A;  4B4G A;  4IRP A;  2QKX A;  3U0Y A;  2X65 A;  2PX7 A;  3SXA A;  4M4K A;  2P6W A;  1JV1 A;  2RJ8 A;  3V90 A;  3CU0 A;  2ZU9 A;  3ST8 A;  4EE5 A;  3JTJ A;  1H5S C;  4KPX A;  3RMW A;  2RJ6 A;  2OEF A;  1FO9 A;  3OGZ A;  2RJ1 A;  2YES A;  1VGU A;  1GWV A;  2RIY A;  4KNX A;  5J49 A;  4EEA A;  3ZGG A;  4ZDQ A;  2XWM A;  2YQH A;  4FRO A;  1FOA A;  3U2X A;  2VFZ A;  2WVL A;  4HO6 A;  5FUH A;  2WGZ A;  3FWW A;  3RMV A;  4HCQ A;  1G97 A;  1XZ6 A;  1FGG A;  3BRK X;  3V91 A;  3CGX A;  4CJB A;  2Q4J A;  1FG5 N;  1JYL A;  4EEM A;  1ZCU A;  4MIX A;  1R82 A;  2CU2 A;  5CQL X;  1R7Y A;  3RSB A;  1ZI4 A;  3SX8 A;  2RJ7 A;  1LZ7 A;  1PZY B;  3SPT A;  2RJ5 A;  3T7N A;  2VXM A;  2OI5 A;  2YC5 A;  3I0G A;  4FRQ A;  1JV3 A;  1VH3 A;  2A8U A;  2XWL A;  4HO8 A;  1H4D A;  1ZI1 A;  1VZT A;  2D7R A;  5D91 A;  4BQH A;  4Y7G A;  3T7M A;  1ZI5 A;  2FY7 A;  2MZB A;  2FYA A;  4HO9 A;  4Y7U A;  1LZJ A;  1V83 A;  1S4P A;  4HO4 A;  4FRM A;  1ZJ1 A;  3PKQ A;  2E3D A;  5I1F A;  3I0F A;  3NGW A;  3T7O A;  2VXL A;  4Q7C A;  5AJN A;  3ZLL A;  4AYL A;  5C48 A;  5C4F A;  5IDT A;  2FFV A;  2WE9 A;  2ICY A;  4O6M A;  1QGS A;  4EEO A;  2D0J A;  3ZGF A;  5FV9 A;  4G3Q A;  2Z86 A;  4B5B A;  5C4E A;  1HJL A;  4FCE A;  1ON6 A;  3PKP A;  2O1F A;  2W0W A;  1FWY A;  4FRE A;  4Y7F A;  4DEC A;  1IIN A;  2PA4 A;  5EJ1 A;  3CKQ A;  3EE5 A;  2WAW A;  2V0H A;  1PZT A;  2A8W A;  1H7Q A;  1NQI B;  2JCJ A;  4DE7 A;  2WVM A;  4C2S A;  4KC2 A;  4FRH A;  3K8E A;  1LL2 A;  1MP3 A;  1EYR A;  4FCU A;  1G9R A;  3JUK A;  5CMF X;  2OI7 A;  3OKR A;  3I0C A;  1WSZ A;  2GGQ A;  3Q80 A;  1OMZ A;  1ON8 A;  3V0Q A;  3KIA A;  2PGY A;  1LZI A;  1S4O A;  4B3U A;  1JYK A;  4Y63 A;  3O3P A;  4AC3 A;  5FU8 A;  2VD4 A;  4KNR A;  1VGT A;  5L6S A;  4D11 A;  4G3P A;  2I7B A;  5C4B A;  1ZCV A;  1ZJO A;  1ZDF A;  1YP2 A;  3PNN A;  2AM3 A;  5CMG X;  2X60 A;  4FRD A;  1H7F A;  2RJ4 A;  4Y9X A;  1WT3 A;  5C3A A;  2O1H A;  5CMH A;  1H7E A;  3CKV A;  2QH5 A;  3V0O A;  3D5N A;  1QG8 A;  3V8Z A;  2PGV A;  2P72 A;  4O6N A;  2VS3 A;  1HV9 A;  3SX5 A;  3SX3 A;  2AEC A;  4B2W A;  5AJO A;  3U2U A;  2BO6 A;  2OI6 A;  1R7U A;  2XWN A;  2FYC B;  3OH2 A;  1VZU A;  4DDZ A;  3V0P A;  1I52 A;  4CJC A;  4Y6N A;  3USR A;  3DUV A;  4B4M A;  1NF5 B;  4FIY A;  4MND A;  2AE7 A;  2D7I A;  2V0K A;  3E26 A;  2I5E A;  4HO0 A;  1ZIZ A;  5C36 A;  1ZCT A;  1QWJ A;  5C4D A;  2Y4M A;  2AM5 A;  1R7T A;  3ZF8 A;  4HOC A;  4Y6U A;  4R7P A;  3D98 A;  2P73 A;  2VSI A;  1O0R A;  1HM9 A;  1G23 A;  5C3D A;  1H5S D;  3DK5 A;  2X5S A;  3GUE A;  4FRB A;  2RIT A;  3U2W A;  5FTS A;  2XMH A;  4D11 C;  3POL A;  4KQL A;  3V0M A;  4L41 C;  1FR9 A;  2C0N A;  5FYE A;  2Y4J A;  1H7G A;  4EE3 A;  4M2B A;  1G93 A;  1TZF A;  2YQJ A;  5L6V A;  1NWG B;  2UX8 A;  5EIY A;  2RIX A;  2VK9 A;  3LW6 A;  4MYB A;  4FQW A;  2WVK A;  1GQ9 A;  1H4E A;  2GGO A;  1YP4 A;  1ZJP A;  1VGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...