3TQDA

Structure of the 3-deoxy-d-manno-octulosonate cytidylyltransferase (kdsb) from coxiella burnetii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
243
Chain Sequence
EFRVIIPARFDLPGKALVDIAGKPMIQHVYESAIKSGAEEVVIATDDKRIRQVAEDFGAVVCMTSSDHQSGTERIAEAAVALGFEDDEIIVCLQGDEPLIPPDAIRKLAEDLDEHDKVASLCTPITEVDELFNPHSTKVVLNRRNYALYFSHAPIPWGRDTFSDKENLQLNGSHYRHVGIYAYRVGFLEEYLSWDACPAEKMEALEQLRILWHGGRIHMVVAKSKCPPGVDTEEDLERVRAYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-deoxy-manno-octulosonate cytidylyltransferase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 73
structure length 243
sequence length 248
ec nomenclature ec 2.7.7.38: 3-deoxy-manno-octulosonate cytidylyltransferase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02348 CTP_transf_3 Cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3tqdA00
2GGQA 3QVBA 4KPXA 3ZGFA 3KIAA 4HOCA 5CQPA 2P73A 3FOQA 3IOHA 4B42A 1FXJA 4HO9A 1ZJPA 2VS3A 2PGVA 1HM8A 1PZYB 4EEMA 4LW6A 1G8OA 2ICYA 1R7TA 1EZIA 3SX5A 1QGQA 2VSIA 4FCEA 1PZTA 4C2SA 4Y7GA 3ZLKA 3R2WA 3U0YA 2PX7A 4CJBA 1ON8A 4AYLA 1ZHJA 4B4BA 2RJ1A 4FRPA 1HV9A 1LL2A 2V0HA 1YP2A 2FYBA 4HO3A 4HO2A 1G9RA 5I1FA 4G3QA 5EJ1A 3IOIA 4EVWA 3SX7A 4NANA 3CKQA 1FGXA 3V0NA 2D7IA 1S4OA 3ZGGA 2AH9A 4G3PA 3T7NA 4B2WA 5FU0A 1W77A 3CU0A 3DUVA 3TZTA 5CMJA 3U2XA 5IDSA 3I0JA 1FG5N 3IOJA 4EEOA 1H5RB 3U0XA 2YC3A 4KT7A 5C3BA 5IDTA 2E3DA 5CQNX 5JQQA 4K6RA 1R7YA 1EYRA 4Y7VA 2FFUA 1ZDGA 1QWJA 2DPWA 4HO4A 4AYJA 5L6SA 1ZJOA 2UX8A 3I0LA 4D11C 4HO8A 1IINA 3EE5A 3SXDA 1VGTA 1NQIB 1JVGA 1ZJ1A 2JCJA 4R7PA 3JTJA 1LZIA 4B4MA 2PGYA 4Y7FA 2VS4A 4FRBA 2Z86A 1NWGB 1R80A 1QG8A 2AGDA 2PA4A 3U2TA 4FRMA 4FRDA 4KRVA 1NKHB 2AM5A 1G93A 4Y6UA 2ICXA 1GWWA 3TQDA 2VS5A 1FGGA 4DDZA 3DK5A 5BXCA 4XWIA 5C4DA 2WVLA 1ZCUA 3OGZA 1G2VA 5DDTA 1V82A 3CKVA 5J49A 4JISA 1FO8A 4FRAA 4D48A 3Q80A 3V0MA 1MP5A 1WT2A 5IFYA 1TVYA 4BQHA 1H5SA 5EIYA 1LL3A 4DECA 4Y62A 2JCKA 4FREA 3SXAA 2RIZA 1XHBA 2FY7A 3E25A 3Q4SA 3SXCA 1V84A 2RIYA 2O1GA 3I0HA 3V0QA 1LZ7A 2WEEA 3OAMA 1W57A 1WT3A 2WVKA 4KPZA 3V8YA 4M2BA 3GUEA 5EJZA 2FYCB 1VICA 2GGOA 3I0IX 3T7OA 1H5SB 5CMIA 2OEFA 2VSHA 1VH3A 5C3AA 5C47A 2VXLA 1WT1A 1H7EA 2FYDB 4NAIA 3RMWA 1V83A 2P72A 3OH3A 1H5RA 2MZBA 2RJ5A 2YCMA 4ECMA 3RSBA 4L41C 2QKXA 3F1YA 1WT0A 1LL0A 3HL3A 4B5BA 2VD4A 3I0DA 4KNXA 5CQMX 1JYLA 2ZU9A 1GWVA 3SXBA 2RJ0A 4EEGA 4EE5A 2QH5A 1R82A 3V8ZA 2XMHA 1NMMB 2W0WA 3R3IA 2BO6A 5C8RA 1GA8A 3PKQA 2X5SA 1VZUA 3V0OA 4FRHA 1OQMB 4ZDQA 1ZI4A 2V0KA 1H7LA 2FYAA 1VH1A 2YQHA 3V0LA 2Z87A 2RITA 4YS8A 5AJOA 2XWMA 5DDVA 2Y4MA 3O3PA 1R81A 3LW6A 2Y4JA 5C48A 2RJ4A 2WE9A 3FWWA 5C1HA 5CMFX 1G3LA 2BO8A 1ON6A 1O7OA 1G95A 3SX3A 3SXGA 4FROA 1HM9A 1ZCTA 2APCA 5C4EA 2NXVA 3D8VA 1VM8A 1FO9A 1ZI5A 1H4EA 1TW1A 1FRWA 5FTSA 1KWSA 2X5ZA 1Z90A 4BMAA 2V0IA 2JCLA 5C3DA 4NAKA 2D0JA 5FUHA 4AAWA 3SX8A 2AECA 4EEAA 3POLA 4FRQA 1JV1A 1R7XA 1LZ0A 4KC4A 1GQCA 1H7HA 1FR9A 3I0CA 1OMXA 3V0PA 3OKRA 3Q7UA 2OI5A 5HS2A 4B2XA 1VZTA 2AESA 2YESA 4IRPA 2FFVA 1G0RA 1JV3A 2P6WA 2WVMA 1S4NA 4M4KA 1H7QA 1I52A 2Q4JA 1GX0A 1GQ9A 2D7RA 2OI7A 3PNNA 1FR8A 1TZFA 2CU2A 4J18A 2A8UA 4NALA 1H5SD 4ASJA 4FQWA 1VPAA 2AE7A 4KC2A 1ZJ2A 1G23A 3N9WA 3OH0A 3U2UA 2X60A 3USRA 4HCQA 5AJNA 1MP4A 4B4GA 1TW5A 1MP3A 1K4VA 1LZJA 2YQCA 4JD0A 3DJ4A 1VGUA 3U2VA 3CKJA 4Y63A 1ZJ0A 1R7VA 1FWYA 2I5EA 1H7TA 2I5KA 4KC1A 5FV9A 1INIA 1ZCYA 3F1CA 4Y7TA 1G97A 3JUJA 4P02A 5FU8A 2WAWA 3PKPA 4MYBA 1W55A 2Y4KA 1NF5B 1LVWA 1ZI1A 3D5NA 1H5SC 1O7QA 1VZXA 5L6VA 2OI6A 4Y64A 5C36A 2W0VA 4Y7UA 4D11A 2VFZA 2Y4LA 3I0GA 4CJCA 1HM0A 3K8DA 3USQA 1H4DA 2V0LA 3OC9A 1WSZA 2Y6PA 4D0TA 2YQSA 2YC5A 1VGWA 3SPTA 1INJA 5C4BA 4G3SA 3ZLLA 2ZU8A 1O0RA 4CJ8A 2XWLA 1NHEB 3OH1A 4D0ZA 1XZ6A 1FXOA 1H5TA 3RMVA 2RJ7A 4Y6NA 2XMEA 2VXMA 3I0FA 4FCUA 1S4PA 3T7MA 3BCVA 4M2AA 2X65A 3CKNA 1FOAA 2RJ9A 2AM3A 4LW3A 1H3MA 5FTVA 4KNRA 1QGSA 2OEGA 4B3UA 4HO6A 2XWNA 3JUKA 2JCOA 2BO7A 4G87A 5CMGX 1H5TB 1OMZA 3D98A 5FYEA 4GBPA 1HJLA 1G1LA 3NGWA 1ZJ3A 2O1HA 2AM4A 1JYKA 1GX4A 4UEGA 3U2WA 4ARWA 3ST8A 2RIXA 1HJJA 4P00A 1WVCA 4HO5A 5CQLX 2O1FA 4HO0A 4EE4A 3V91A 2E8BA 5CQOA 1O23B 3SXEA 1VGZA 3ZF8A 3OH2A 2V0JA 1H4CA 5C4CA 4KQLA 2BO4A 1IIMA 5C1LA 1E5KA 4M28A 4IRQA 1H7FA 1ZIZA 5C1GA 1H7GA 1YP3A 4ASYA 3K8EA 2RJ8A 5C38A 4CVHA 2RJ6A 2YQJA 2I7BA 3OH4A 3BRKX 4MNDA 2Y7AA 2QGIA 5AJPA 1R7UA 3I0EA 4KXOA 3CKOA 4FRLA 3I0KA 2ZU7A 1ZCVA 1JVDA 1MC3A 3E26A 1YP4A 1FZWA 5CMHA 3V90A 4EE3A 4AC3A 4E1KA 4Y9XA 1SS9A 1ZI3A 4DE7A 2WGZA 4HG6A 3CGXA 5C4FA 2A8WA 1ZDFA 5C49A 1YROB
chains in the Genus database with same CATH superfamily
2GGQA 5D91A 3QVBA 4KPXA 3ZGFA 3KIAA 4HOCA 5CQPA 2P73A 3FOQA 3IOHA 4B42A 1FXJA 4HO9A 1ZJPA 2VS3A 2PGVA 1HM8A 1PZYB 4EEMA 4LW6A 1G8OA 2ICYA 1R7TA 1EZIA 3SX5A 1QGQA 2VSIA 4FCEA 1PZTA 4C2SA 4Y7GA 3ZLKA 3R2WA 3U0YA 2PX7A 4CJBA 1ON8A 4AYLA 1ZHJA 4B4BA 2RJ1A 4FRPA 1HV9A 1LL2A 2V0HA 1YP2A 2FYBA 4HO3A 2VK9A 4HO2A 1G9RA 5I1FA 4G3QA 5EJ1A 3IOIA 4EVWA 3SX7A 4NANA 3CKQA 1FGXA 3V0NA 2D7IA 1S4OA 3ZGGA 2AH9A 4G3PA 3T7NA 4B2WA 5FU0A 1W77A 3CU0A 3DUVA 3TZTA 5CMJA 3U2XA 5IDSA 3I0JA 1FG5N 3IOJA 4EEOA 1H5RB 3U0XA 2YC3A 4KT7A 5C3BA 5IDTA 2E3DA 5CQNX 5JQQA 4K6RA 1R7YA 1EYRA 4Y7VA 2FFUA 1ZDGA 1QWJA 2DPWA 4HO4A 4AYJA 5L6SA 1ZJOA 2UX8A 3I0LA 4D11C 4HO8A 1IINA 3EE5A 3SXDA 1VGTA 1NQIB 1JVGA 1ZJ1A 2JCJA 4R7PA 3JTJA 1LZIA 4O6MA 4B4MA 2PGYA 4Y7FA 2VS4A 4FRBA 2Z86A 1NWGB 1R80A 1QG8A 2AGDA 2PA4A 3U2TA 4FRMA 4FRDA 4KRVA 1NKHB 2AM5A 1G93A 4Y6UA 2ICXA 1GWWA 3TQDA 2VS5A 1FGGA 4DDZA 3DK5A 5BXCA 4XWIA 5C4DA 2WVLA 1ZCUA 3OGZA 1G2VA 5DDTA 1V82A 3CKVA 5J49A 4JISA 1FO8A 4FIYA 4FRAA 4D48A 3Q80A 2J0AA 3V0MA 1MP5A 1WT2A 5IFYA 1TVYA 4BQHA 1H5SA 5EIYA 1LL3A 2J0BA 4DECA 4Y62A 2JCKA 4FREA 3SXAA 2RIZA 1XHBA 2FY7A 3E25A 3Q4SA 3SXCA 1V84A 2RIYA 2O1GA 3I0HA 3V0QA 1LZ7A 2WEEA 3OAMA 1W57A 1WT3A 2WVKA 4KPZA 3V8YA 4M2BA 3GUEA 5EJZA 2FYCB 1VICA 2GGOA 3I0IX 3T7OA 1H5SB 5CMIA 2OEFA 2VSHA 1VH3A 5C3AA 5C47A 2VXLA 1WT1A 1H7EA 2FYDB 4NAIA 3RMWA 1V83A 2P72A 3OH3A 1H5RA 2MZBA 2RJ5A 2YCMA 4ECMA 3RSBA 4L41C 2QKXA 3F1YA 1WT0A 1LL0A 3HL3A 4B5BA 2VD4A 3I0DA 4KNXA 5CQMX 1JYLA 2ZU9A 1GWVA 3SXBA 2RJ0A 4EEGA 4EE5A 2QH5A 1R82A 3V8ZA 2XMHA 1NMMB 2W0WA 3R3IA 2BO6A 5C8RA 1GA8A 3PKQA 2X5SA 1VZUA 3V0OA 4FRHA 1OQMB 4ZDQA 1ZI4A 2V0KA 1H7LA 2FYAA 1VH1A 2YQHA 3V0LA 2Z87A 2RITA 2C0NA 4YS8A 5AJOA 2XWMA 5DDVA 2Y4MA 3O3PA 1R81A 3LW6A 2Y4JA 5C48A 2RJ4A 2WE9A 3FWWA 5C1HA 5CMFX 1G3LA 2BO8A 1ON6A 1O7OA 1G95A 3SX3A 3SXGA 4FROA 1HM9A 1ZCTA 2APCA 5C4EA 2NXVA 3D8VA 1VM8A 1FO9A 1ZI5A 1H4EA 1TW1A 1FRWA 5FTSA 1KWSA 2X5ZA 5D92A 1Z90A 4BMAA 2V0IA 2JCLA 5C3DA 4NAKA 2D0JA 5FUHA 4AAWA 3SX8A 2AECA 4EEAA 3POLA 4FRQA 1JV1A 1R7XA 1LZ0A 4KC4A 1GQCA 4Q7CA 1H7HA 1FR9A 3I0CA 1OMXA 3V0PA 3OKRA 3Q7UA 2OI5A 5HS2A 4B2XA 1VZTA 2AESA 2YESA 4IRPA 2FFVA 1G0RA 1JV3A 2P6WA 2WVMA 1S4NA 4M4KA 1H7QA 1I52A 2Q4JA 1GX0A 1GQ9A 2D7RA 2OI7A 3PNNA 1FR8A 1TZFA 2CU2A 4J18A 2A8UA 4NALA 1H5SD 4ASJA 4FQWA 1VPAA 2AE7A 4KC2A 4O6NA 1ZJ2A 1G23A 3N9WA 3OH0A 3U2UA 2X60A 3USRA 4HCQA 5AJNA 1MP4A 4B4GA 1TW5A 1MP3A 1K4VA 1LZJA 2YQCA 4JD0A 3DJ4A 1VGUA 3U2VA 3CKJA 4Y63A 1ZJ0A 1R7VA 1FWYA 2I5EA 1H7TA 2I5KA 4KC1A 5FV9A 1INIA 1ZCYA 3F1CA 4Y7TA 1G97A 3JUJA 4P02A 5FU8A 2WAWA 3PKPA 4MYBA 1W55A 2Y4KA 1NF5B 1LVWA 1ZI1A 3D5NA 1H5SC 1O7QA 1VZXA 5L6VA 2OI6A 4Y64A 5C36A 2W0VA 4Y7UA 4D11A 2VFZA 2Y4LA 3I0GA 4CJCA 1HM0A 3K8DA 3USQA 1H4DA 2V0LA 3OC9A 1WSZA 2Y6PA 4D0TA 2YQSA 4MIXA 2YC5A 1VGWA 3SPTA 1INJA 5C4BA 4G3SA 3ZLLA 4FIXA 2ZU8A 1O0RA 4CJ8A 2XWLA 1NHEB 3OH1A 4D0ZA 1XZ6A 1FXOA 1H5TA 3RMVA 2RJ7A 4Y6NA 2XMEA 2VXMA 3I0FA 4FCUA 1S4PA 3T7MA 3BCVA 4M2AA 2X65A 3CKNA 1FOAA 2RJ9A 2AM3A 4LW3A 1H3MA 5FTVA 4KNRA 1QGSA 2OEGA 4B3UA 4HO6A 2XWNA 3JUKA 2JCOA 2BO7A 4G87A 5CMGX 1H5TB 1OMZA 3D98A 5FYEA 4GBPA 1HJLA 1G1LA 3NGWA 1ZJ3A 2O1HA 2AM4A 1JYKA 1GX4A 4UEGA 3U2WA 4ARWA 3ST8A 2RIXA 1HJJA 4P00A 1WVCA 4HO5A 5CQLX 2O1FA 4HO0A 4EE4A 3V91A 2E8BA 5CQOA 1O23B 3SXEA 1VGZA 3ZF8A 3OH2A 2V0JA 1H4CA 5C4CA 4KQLA 2BO4A 1IIMA 5C1LA 1E5KA 4M28A 4IRQA 1H7FA 1ZIZA 5C1GA 1H7GA 1YP3A 4ASYA 3K8EA 2RJ8A 5C38A 4CVHA 2RJ6A 2YQJA 2I7BA 3OH4A 3BRKX 4MNDA 2Y7AA 2QGIA 5AJPA 1R7UA 3I0EA 4KXOA 3CKOA 4FRLA 3I0KA 2ZU7A 1ZCVA 1JVDA 1MC3A 3E26A 1YP4A 1FZWA 5CMHA 3V90A 4EE3A 4AC3A 4E1KA 4Y9XA 1SS9A 1ZI3A 4DE7A 2WGZA 4HG6A 3CGXA 5C4FA 2A8WA 1ZDFA 5C49A 1YROB
chains in the Genus database with same CATH topology
2GGQA 5D91A 3QVBA 4KPXA 3ZGFA 3KIAA 4HOCA 5CQPA 2P73A 3FOQA 3IOHA 4B42A 1FXJA 4HO9A 1ZJPA 2VS3A 2PGVA 1HM8A 1PZYB 4EEMA 4LW6A 1G8OA 2ICYA 1R7TA 1EZIA 3SX5A 1QGQA 2VSIA 4FCEA 1PZTA 4C2SA 4Y7GA 3ZLKA 3R2WA 3U0YA 2PX7A 4CJBA 1ON8A 4AYLA 1ZHJA 4B4BA 2RJ1A 4FRPA 1HV9A 1LL2A 2V0HA 1YP2A 2FYBA 4HO3A 2VK9A 4HO2A 1G9RA 5I1FA 4G3QA 5EJ1A 3IOIA 4EVWA 3SX7A 4NANA 3CKQA 1FGXA 3V0NA 2D7IA 1S4OA 3ZGGA 2AH9A 4G3PA 3T7NA 4B2WA 5FU0A 1W77A 3CU0A 3DUVA 3TZTA 5CMJA 3U2XA 5IDSA 3I0JA 1FG5N 3IOJA 4EEOA 1H5RB 3U0XA 2YC3A 4KT7A 5C3BA 5IDTA 2E3DA 5CQNX 5JQQA 4K6RA 1R7YA 1EYRA 4Y7VA 2FFUA 1ZDGA 1QWJA 2DPWA 4HO4A 4AYJA 5L6SA 1ZJOA 2UX8A 3I0LA 4D11C 4HO8A 1IINA 3EE5A 3SXDA 1VGTA 1NQIB 1JVGA 1ZJ1A 2JCJA 4R7PA 3JTJA 1LZIA 4O6MA 4B4MA 2PGYA 4Y7FA 2VS4A 4FRBA 2Z86A 1NWGB 1R80A 1QG8A 2AGDA 2PA4A 3U2TA 4FRMA 4FRDA 4KRVA 1NKHB 2AM5A 1G93A 4Y6UA 2ICXA 1GWWA 3TQDA 2VS5A 1FGGA 4DDZA 3DK5A 5BXCA 4XWIA 5C4DA 2WVLA 1ZCUA 3OGZA 1G2VA 5DDTA 1V82A 3CKVA 5J49A 4JISA 1FO8A 4FIYA 4FRAA 4D48A 3Q80A 2J0AA 3V0MA 1MP5A 1WT2A 5IFYA 1TVYA 4BQHA 1H5SA 5EIYA 1LL3A 2J0BA 4DECA 4Y62A 2JCKA 4FREA 3SXAA 2RIZA 1XHBA 2FY7A 3E25A 3Q4SA 3SXCA 1V84A 2RIYA 2O1GA 3I0HA 3V0QA 1LZ7A 2WEEA 3OAMA 1W57A 1WT3A 2WVKA 4KPZA 3V8YA 4M2BA 3GUEA 5EJZA 2FYCB 1VICA 2GGOA 3I0IX 3T7OA 1H5SB 5CMIA 2OEFA 2VSHA 1VH3A 5C3AA 5C47A 2VXLA 1WT1A 1H7EA 2FYDB 4NAIA 3RMWA 1V83A 2P72A 3OH3A 1H5RA 2MZBA 2RJ5A 2YCMA 4ECMA 3RSBA 4L41C 2QKXA 3F1YA 1WT0A 1LL0A 3HL3A 4B5BA 2VD4A 3I0DA 4KNXA 5CQMX 1JYLA 2ZU9A 1GWVA 3SXBA 2RJ0A 4EEGA 4EE5A 2QH5A 1R82A 3V8ZA 2XMHA 1NMMB 2W0WA 3R3IA 2BO6A 5C8RA 1GA8A 3PKQA 2X5SA 1VZUA 3V0OA 4FRHA 1OQMB 4ZDQA 1ZI4A 2V0KA 1H7LA 2FYAA 1VH1A 2YQHA 3V0LA 2Z87A 2RITA 2C0NA 4YS8A 5AJOA 2XWMA 5DDVA 2Y4MA 3O3PA 1R81A 3LW6A 2Y4JA 5C48A 2RJ4A 2WE9A 3FWWA 5C1HA 5CMFX 1G3LA 2BO8A 1ON6A 1O7OA 1G95A 3SX3A 3SXGA 4FROA 1HM9A 1ZCTA 2APCA 5C4EA 2NXVA 3D8VA 1VM8A 1FO9A 1ZI5A 1H4EA 1TW1A 1FRWA 5FTSA 1KWSA 2X5ZA 5D92A 1Z90A 4BMAA 2V0IA 2JCLA 5C3DA 4NAKA 2D0JA 5FUHA 4AAWA 3SX8A 2AECA 4EEAA 3POLA 4FRQA 1JV1A 1R7XA 1LZ0A 4KC4A 1GQCA 4Q7CA 1H7HA 1FR9A 3I0CA 1OMXA 3V0PA 3OKRA 3Q7UA 2OI5A 5HS2A 4B2XA 1VZTA 2AESA 2YESA 4IRPA 2FFVA 1G0RA 1JV3A 2P6WA 2WVMA 1S4NA 4M4KA 1H7QA 1I52A 2Q4JA 1GX0A 1GQ9A 2D7RA 2OI7A 3PNNA 1FR8A 1TZFA 2CU2A 4J18A 2A8UA 4NALA 1H5SD 4ASJA 4FQWA 1VPAA 2AE7A 4KC2A 4O6NA 1ZJ2A 1G23A 3N9WA 3OH0A 3U2UA 2X60A 3USRA 4HCQA 5AJNA 1MP4A 4B4GA 1TW5A 1MP3A 1K4VA 1LZJA 2YQCA 4JD0A 3DJ4A 1VGUA 3U2VA 3CKJA 4Y63A 1ZJ0A 1R7VA 1FWYA 2I5EA 1H7TA 2I5KA 4KC1A 5FV9A 1INIA 1ZCYA 3F1CA 4Y7TA 1G97A 3JUJA 4P02A 5FU8A 2WAWA 3PKPA 4MYBA 1W55A 2Y4KA 1NF5B 1LVWA 1ZI1A 3D5NA 1H5SC 1O7QA 1VZXA 5L6VA 2OI6A 4Y64A 5C36A 2W0VA 4Y7UA 4D11A 2VFZA 2Y4LA 3I0GA 4CJCA 1HM0A 3K8DA 3USQA 1H4DA 2V0LA 3OC9A 1WSZA 2Y6PA 4D0TA 2YQSA 4MIXA 2YC5A 1VGWA 3SPTA 1INJA 5C4BA 4G3SA 3ZLLA 4FIXA 2ZU8A 1O0RA 4CJ8A 2XWLA 1NHEB 3OH1A 4D0ZA 1XZ6A 1FXOA 1H5TA 3RMVA 2RJ7A 4Y6NA 2XMEA 2VXMA 3I0FA 4FCUA 1S4PA 3T7MA 3BCVA 4M2AA 2X65A 3CKNA 1FOAA 2RJ9A 2AM3A 4LW3A 1H3MA 5FTVA 4KNRA 1QGSA 2OEGA 4B3UA 4HO6A 2XWNA 3JUKA 2JCOA 2BO7A 4G87A 5CMGX 1H5TB 1OMZA 3D98A 5FYEA 4GBPA 1HJLA 1G1LA 3NGWA 1ZJ3A 2O1HA 2AM4A 1JYKA 1GX4A 4UEGA 3U2WA 4ARWA 3ST8A 2RIXA 1HJJA 4P00A 1WVCA 4HO5A 5CQLX 2O1FA 4HO0A 4EE4A 3V91A 2E8BA 5CQOA 1O23B 3SXEA 1VGZA 3ZF8A 3OH2A 2V0JA 1H4CA 5C4CA 4KQLA 2BO4A 1IIMA 5C1LA 1E5KA 4M28A 4IRQA 1H7FA 1ZIZA 5C1GA 1H7GA 1YP3A 4ASYA 3K8EA 2RJ8A 5C38A 4CVHA 2RJ6A 2YQJA 2I7BA 3OH4A 3BRKX 4MNDA 2Y7AA 2QGIA 5AJPA 1R7UA 3I0EA 4KXOA 3CKOA 4FRLA 3I0KA 2ZU7A 1ZCVA 1JVDA 1MC3A 3E26A 1YP4A 1FZWA 5CMHA 3V90A 4EE3A 4AC3A 4E1KA 4Y9XA 1SS9A 1ZI3A 4DE7A 2WGZA 4HG6A 3CGXA 5C4FA 2A8WA 1ZDFA 5C49A 1YROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGQ A;  3QVB A;  4KPX A;  3ZGF A;  3KIA A;  4HOC A;  5CQP A;  2P73 A;  3FOQ A;  3IOH A;  4B42 A;  1FXJ A;  4HO9 A;  1ZJP A;  2VS3 A;  2PGV A;  1HM8 A;  1PZY B;  4EEM A;  4LW6 A;  1G8O A;  2ICY A;  1R7T A;  1EZI A;  3SX5 A;  1QGQ A;  2VSI A;  4FCE A;  1PZT A;  4C2S A;  4Y7G A;  3ZLK A;  3R2W A;  3U0Y A;  2PX7 A;  4CJB A;  1ON8 A;  4AYL A;  1ZHJ A;  4B4B A;  2RJ1 A;  4FRP A;  1HV9 A;  1LL2 A;  2V0H A;  1YP2 A;  2FYB A;  4HO3 A;  4HO2 A;  1G9R A;  5I1F A;  4G3Q A;  5EJ1 A;  3IOI A;  4EVW A;  3SX7 A;  4NAN A;  3CKQ A;  1FGX A;  3V0N A;  2D7I A;  1S4O A;  3ZGG A;  2AH9 A;  4G3P A;  3T7N A;  4B2W A;  5FU0 A;  1W77 A;  3CU0 A;  3DUV A;  3TZT A;  5CMJ A;  3U2X A;  5IDS A;  3I0J A;  1FG5 N;  3IOJ A;  4EEO A;  1H5R B;  3U0X A;  2YC3 A;  4KT7 A;  5C3B A;  5IDT A;  2E3D A;  5CQN X;  5JQQ A;  4K6R A;  1R7Y A;  1EYR A;  4Y7V A;  2FFU A;  1ZDG A;  1QWJ A;  2DPW A;  4HO4 A;  4AYJ A;  5L6S A;  1ZJO A;  2UX8 A;  3I0L A;  4D11 C;  4HO8 A;  1IIN A;  3EE5 A;  3SXD A;  1VGT A;  1NQI B;  1JVG A;  1ZJ1 A;  2JCJ A;  4R7P A;  3JTJ A;  1LZI A;  4B4M A;  2PGY A;  4Y7F A;  2VS4 A;  4FRB A;  2Z86 A;  1NWG B;  1R80 A;  1QG8 A;  2AGD A;  2PA4 A;  3U2T A;  4FRM A;  4FRD A;  4KRV A;  1NKH B;  2AM5 A;  1G93 A;  4Y6U A;  2ICX A;  1GWW A;  3TQD A;  2VS5 A;  1FGG A;  4DDZ A;  3DK5 A;  5BXC A;  4XWI A;  5C4D A;  2WVL A;  1ZCU A;  3OGZ A;  1G2V A;  5DDT A;  1V82 A;  3CKV A;  5J49 A;  4JIS A;  1FO8 A;  4FRA A;  4D48 A;  3Q80 A;  3V0M A;  1MP5 A;  1WT2 A;  5IFY A;  1TVY A;  4BQH A;  1H5S A;  5EIY A;  1LL3 A;  4DEC A;  4Y62 A;  2JCK A;  4FRE A;  3SXA A;  2RIZ A;  1XHB A;  2FY7 A;  3E25 A;  3Q4S A;  3SXC A;  1V84 A;  2RIY A;  2O1G A;  3I0H A;  3V0Q A;  1LZ7 A;  2WEE A;  3OAM A;  1W57 A;  1WT3 A;  2WVK A;  4KPZ A;  3V8Y A;  4M2B A;  3GUE A;  5EJZ A;  2FYC B;  1VIC A;  2GGO A;  3I0I X;  3T7O A;  1H5S B;  5CMI A;  2OEF A;  2VSH A;  1VH3 A;  5C3A A;  5C47 A;  2VXL A;  1WT1 A;  1H7E A;  2FYD B;  4NAI A;  3RMW A;  1V83 A;  2P72 A;  3OH3 A;  1H5R A;  2MZB A;  2RJ5 A;  2YCM A;  4ECM A;  3RSB A;  4L41 C;  2QKX A;  3F1Y A;  1WT0 A;  1LL0 A;  3HL3 A;  4B5B A;  2VD4 A;  3I0D A;  4KNX A;  5CQM X;  1JYL A;  2ZU9 A;  1GWV A;  3SXB A;  2RJ0 A;  4EEG A;  4EE5 A;  2QH5 A;  1R82 A;  3V8Z A;  2XMH A;  1NMM B;  2W0W A;  3R3I A;  2BO6 A;  5C8R A;  1GA8 A;  3PKQ A;  2X5S A;  1VZU A;  3V0O A;  4FRH A;  1OQM B;  4ZDQ A;  1ZI4 A;  2V0K A;  1H7L A;  2FYA A;  1VH1 A;  2YQH A;  3V0L A;  2Z87 A;  2RIT A;  4YS8 A;  5AJO A;  2XWM A;  5DDV A;  2Y4M A;  3O3P A;  1R81 A;  3LW6 A;  2Y4J A;  5C48 A;  2RJ4 A;  2WE9 A;  3FWW A;  5C1H A;  5CMF X;  1G3L A;  2BO8 A;  1ON6 A;  1O7O A;  1G95 A;  3SX3 A;  3SXG A;  4FRO A;  1HM9 A;  1ZCT A;  2APC A;  5C4E A;  2NXV A;  3D8V A;  1VM8 A;  1FO9 A;  1ZI5 A;  1H4E A;  1TW1 A;  1FRW A;  5FTS A;  1KWS A;  2X5Z A;  1Z90 A;  4BMA A;  2V0I A;  2JCL A;  5C3D A;  4NAK A;  2D0J A;  5FUH A;  4AAW A;  3SX8 A;  2AEC A;  4EEA A;  3POL A;  4FRQ A;  1JV1 A;  1R7X A;  1LZ0 A;  4KC4 A;  1GQC A;  1H7H A;  1FR9 A;  3I0C A;  1OMX A;  3V0P A;  3OKR A;  3Q7U A;  2OI5 A;  5HS2 A;  4B2X A;  1VZT A;  2AES A;  2YES A;  4IRP A;  2FFV A;  1G0R A;  1JV3 A;  2P6W A;  2WVM A;  1S4N A;  4M4K A;  1H7Q A;  1I52 A;  2Q4J A;  1GX0 A;  1GQ9 A;  2D7R A;  2OI7 A;  3PNN A;  1FR8 A;  1TZF A;  2CU2 A;  4J18 A;  2A8U A;  4NAL A;  1H5S D;  4ASJ A;  4FQW A;  1VPA A;  2AE7 A;  4KC2 A;  1ZJ2 A;  1G23 A;  3N9W A;  3OH0 A;  3U2U A;  2X60 A;  3USR A;  4HCQ A;  5AJN A;  1MP4 A;  4B4G A;  1TW5 A;  1MP3 A;  1K4V A;  1LZJ A;  2YQC A;  4JD0 A;  3DJ4 A;  1VGU A;  3U2V A;  3CKJ A;  4Y63 A;  1ZJ0 A;  1R7V A;  1FWY A;  2I5E A;  1H7T A;  2I5K A;  4KC1 A;  5FV9 A;  1INI A;  1ZCY A;  3F1C A;  4Y7T A;  1G97 A;  3JUJ A;  4P02 A;  5FU8 A;  2WAW A;  3PKP A;  4MYB A;  1W55 A;  2Y4K A;  1NF5 B;  1LVW A;  1ZI1 A;  3D5N A;  1H5S C;  1O7Q A;  1VZX A;  5L6V A;  2OI6 A;  4Y64 A;  5C36 A;  2W0V A;  4Y7U A;  4D11 A;  2VFZ A;  2Y4L A;  3I0G A;  4CJC A;  1HM0 A;  3K8D A;  3USQ A;  1H4D A;  2V0L A;  3OC9 A;  1WSZ A;  2Y6P A;  4D0T A;  2YQS A;  2YC5 A;  1VGW A;  3SPT A;  1INJ A;  5C4B A;  4G3S A;  3ZLL A;  2ZU8 A;  1O0R A;  4CJ8 A;  2XWL A;  1NHE B;  3OH1 A;  4D0Z A;  1XZ6 A;  1FXO A;  1H5T A;  3RMV A;  2RJ7 A;  4Y6N A;  2XME A;  2VXM A;  3I0F A;  4FCU A;  1S4P A;  3T7M A;  3BCV A;  4M2A A;  2X65 A;  3CKN A;  1FOA A;  2RJ9 A;  2AM3 A;  4LW3 A;  1H3M A;  5FTV A;  4KNR A;  1QGS A;  2OEG A;  4B3U A;  4HO6 A;  2XWN A;  3JUK A;  2JCO A;  2BO7 A;  4G87 A;  5CMG X;  1H5T B;  1OMZ A;  3D98 A;  5FYE A;  4GBP A;  1HJL A;  1G1L A;  3NGW A;  1ZJ3 A;  2O1H A;  2AM4 A;  1JYK A;  1GX4 A;  4UEG A;  3U2W A;  4ARW A;  3ST8 A;  2RIX A;  1HJJ A;  4P00 A;  1WVC A;  4HO5 A;  5CQL X;  2O1F A;  4HO0 A;  4EE4 A;  3V91 A;  2E8B A;  5CQO A;  1O23 B;  3SXE A;  1VGZ A;  3ZF8 A;  3OH2 A;  2V0J A;  1H4C A;  5C4C A;  4KQL A;  2BO4 A;  1IIM A;  5C1L A;  1E5K A;  4M28 A;  4IRQ A;  1H7F A;  1ZIZ A;  5C1G A;  1H7G A;  1YP3 A;  4ASY A;  3K8E A;  2RJ8 A;  5C38 A;  4CVH A;  2RJ6 A;  2YQJ A;  2I7B A;  3OH4 A;  3BRK X;  4MND A;  2Y7A A;  2QGI A;  5AJP A;  1R7U A;  3I0E A;  4KXO A;  3CKO A;  4FRL A;  3I0K A;  2ZU7 A;  1ZCV A;  1JVD A;  1MC3 A;  3E26 A;  1YP4 A;  1FZW A;  5CMH A;  3V90 A;  4EE3 A;  4AC3 A;  4E1K A;  4Y9X A;  1SS9 A;  1ZI3 A;  4DE7 A;  2WGZ A;  4HG6 A;  3CGX A;  5C4F A;  2A8W A;  1ZDF A;  5C49 A;  1YRO B; 
#chains in the Genus database with same CATH topology
 2GGQ A;  5D91 A;  3QVB A;  4KPX A;  3ZGF A;  3KIA A;  4HOC A;  5CQP A;  2P73 A;  3FOQ A;  3IOH A;  4B42 A;  1FXJ A;  4HO9 A;  1ZJP A;  2VS3 A;  2PGV A;  1HM8 A;  1PZY B;  4EEM A;  4LW6 A;  1G8O A;  2ICY A;  1R7T A;  1EZI A;  3SX5 A;  1QGQ A;  2VSI A;  4FCE A;  1PZT A;  4C2S A;  4Y7G A;  3ZLK A;  3R2W A;  3U0Y A;  2PX7 A;  4CJB A;  1ON8 A;  4AYL A;  1ZHJ A;  4B4B A;  2RJ1 A;  4FRP A;  1HV9 A;  1LL2 A;  2V0H A;  1YP2 A;  2FYB A;  4HO3 A;  2VK9 A;  4HO2 A;  1G9R A;  5I1F A;  4G3Q A;  5EJ1 A;  3IOI A;  4EVW A;  3SX7 A;  4NAN A;  3CKQ A;  1FGX A;  3V0N A;  2D7I A;  1S4O A;  3ZGG A;  2AH9 A;  4G3P A;  3T7N A;  4B2W A;  5FU0 A;  1W77 A;  3CU0 A;  3DUV A;  3TZT A;  5CMJ A;  3U2X A;  5IDS A;  3I0J A;  1FG5 N;  3IOJ A;  4EEO A;  1H5R B;  3U0X A;  2YC3 A;  4KT7 A;  5C3B A;  5IDT A;  2E3D A;  5CQN X;  5JQQ A;  4K6R A;  1R7Y A;  1EYR A;  4Y7V A;  2FFU A;  1ZDG A;  1QWJ A;  2DPW A;  4HO4 A;  4AYJ A;  5L6S A;  1ZJO A;  2UX8 A;  3I0L A;  4D11 C;  4HO8 A;  1IIN A;  3EE5 A;  3SXD A;  1VGT A;  1NQI B;  1JVG A;  1ZJ1 A;  2JCJ A;  4R7P A;  3JTJ A;  1LZI A;  4O6M A;  4B4M A;  2PGY A;  4Y7F A;  2VS4 A;  4FRB A;  2Z86 A;  1NWG B;  1R80 A;  1QG8 A;  2AGD A;  2PA4 A;  3U2T A;  4FRM A;  4FRD A;  4KRV A;  1NKH B;  2AM5 A;  1G93 A;  4Y6U A;  2ICX A;  1GWW A;  3TQD A;  2VS5 A;  1FGG A;  4DDZ A;  3DK5 A;  5BXC A;  4XWI A;  5C4D A;  2WVL A;  1ZCU A;  3OGZ A;  1G2V A;  5DDT A;  1V82 A;  3CKV A;  5J49 A;  4JIS A;  1FO8 A;  4FIY A;  4FRA A;  4D48 A;  3Q80 A;  2J0A A;  3V0M A;  1MP5 A;  1WT2 A;  5IFY A;  1TVY A;  4BQH A;  1H5S A;  5EIY A;  1LL3 A;  2J0B A;  4DEC A;  4Y62 A;  2JCK A;  4FRE A;  3SXA A;  2RIZ A;  1XHB A;  2FY7 A;  3E25 A;  3Q4S A;  3SXC A;  1V84 A;  2RIY A;  2O1G A;  3I0H A;  3V0Q A;  1LZ7 A;  2WEE A;  3OAM A;  1W57 A;  1WT3 A;  2WVK A;  4KPZ A;  3V8Y A;  4M2B A;  3GUE A;  5EJZ A;  2FYC B;  1VIC A;  2GGO A;  3I0I X;  3T7O A;  1H5S B;  5CMI A;  2OEF A;  2VSH A;  1VH3 A;  5C3A A;  5C47 A;  2VXL A;  1WT1 A;  1H7E A;  2FYD B;  4NAI A;  3RMW A;  1V83 A;  2P72 A;  3OH3 A;  1H5R A;  2MZB A;  2RJ5 A;  2YCM A;  4ECM A;  3RSB A;  4L41 C;  2QKX A;  3F1Y A;  1WT0 A;  1LL0 A;  3HL3 A;  4B5B A;  2VD4 A;  3I0D A;  4KNX A;  5CQM X;  1JYL A;  2ZU9 A;  1GWV A;  3SXB A;  2RJ0 A;  4EEG A;  4EE5 A;  2QH5 A;  1R82 A;  3V8Z A;  2XMH A;  1NMM B;  2W0W A;  3R3I A;  2BO6 A;  5C8R A;  1GA8 A;  3PKQ A;  2X5S A;  1VZU A;  3V0O A;  4FRH A;  1OQM B;  4ZDQ A;  1ZI4 A;  2V0K A;  1H7L A;  2FYA A;  1VH1 A;  2YQH A;  3V0L A;  2Z87 A;  2RIT A;  2C0N A;  4YS8 A;  5AJO A;  2XWM A;  5DDV A;  2Y4M A;  3O3P A;  1R81 A;  3LW6 A;  2Y4J A;  5C48 A;  2RJ4 A;  2WE9 A;  3FWW A;  5C1H A;  5CMF X;  1G3L A;  2BO8 A;  1ON6 A;  1O7O A;  1G95 A;  3SX3 A;  3SXG A;  4FRO A;  1HM9 A;  1ZCT A;  2APC A;  5C4E A;  2NXV A;  3D8V A;  1VM8 A;  1FO9 A;  1ZI5 A;  1H4E A;  1TW1 A;  1FRW A;  5FTS A;  1KWS A;  2X5Z A;  5D92 A;  1Z90 A;  4BMA A;  2V0I A;  2JCL A;  5C3D A;  4NAK A;  2D0J A;  5FUH A;  4AAW A;  3SX8 A;  2AEC A;  4EEA A;  3POL A;  4FRQ A;  1JV1 A;  1R7X A;  1LZ0 A;  4KC4 A;  1GQC A;  4Q7C A;  1H7H A;  1FR9 A;  3I0C A;  1OMX A;  3V0P A;  3OKR A;  3Q7U A;  2OI5 A;  5HS2 A;  4B2X A;  1VZT A;  2AES A;  2YES A;  4IRP A;  2FFV A;  1G0R A;  1JV3 A;  2P6W A;  2WVM A;  1S4N A;  4M4K A;  1H7Q A;  1I52 A;  2Q4J A;  1GX0 A;  1GQ9 A;  2D7R A;  2OI7 A;  3PNN A;  1FR8 A;  1TZF A;  2CU2 A;  4J18 A;  2A8U A;  4NAL A;  1H5S D;  4ASJ A;  4FQW A;  1VPA A;  2AE7 A;  4KC2 A;  4O6N A;  1ZJ2 A;  1G23 A;  3N9W A;  3OH0 A;  3U2U A;  2X60 A;  3USR A;  4HCQ A;  5AJN A;  1MP4 A;  4B4G A;  1TW5 A;  1MP3 A;  1K4V A;  1LZJ A;  2YQC A;  4JD0 A;  3DJ4 A;  1VGU A;  3U2V A;  3CKJ A;  4Y63 A;  1ZJ0 A;  1R7V A;  1FWY A;  2I5E A;  1H7T A;  2I5K A;  4KC1 A;  5FV9 A;  1INI A;  1ZCY A;  3F1C A;  4Y7T A;  1G97 A;  3JUJ A;  4P02 A;  5FU8 A;  2WAW A;  3PKP A;  4MYB A;  1W55 A;  2Y4K A;  1NF5 B;  1LVW A;  1ZI1 A;  3D5N A;  1H5S C;  1O7Q A;  1VZX A;  5L6V A;  2OI6 A;  4Y64 A;  5C36 A;  2W0V A;  4Y7U A;  4D11 A;  2VFZ A;  2Y4L A;  3I0G A;  4CJC A;  1HM0 A;  3K8D A;  3USQ A;  1H4D A;  2V0L A;  3OC9 A;  1WSZ A;  2Y6P A;  4D0T A;  2YQS A;  4MIX A;  2YC5 A;  1VGW A;  3SPT A;  1INJ A;  5C4B A;  4G3S A;  3ZLL A;  4FIX A;  2ZU8 A;  1O0R A;  4CJ8 A;  2XWL A;  1NHE B;  3OH1 A;  4D0Z A;  1XZ6 A;  1FXO A;  1H5T A;  3RMV A;  2RJ7 A;  4Y6N A;  2XME A;  2VXM A;  3I0F A;  4FCU A;  1S4P A;  3T7M A;  3BCV A;  4M2A A;  2X65 A;  3CKN A;  1FOA A;  2RJ9 A;  2AM3 A;  4LW3 A;  1H3M A;  5FTV A;  4KNR A;  1QGS A;  2OEG A;  4B3U A;  4HO6 A;  2XWN A;  3JUK A;  2JCO A;  2BO7 A;  4G87 A;  5CMG X;  1H5T B;  1OMZ A;  3D98 A;  5FYE A;  4GBP A;  1HJL A;  1G1L A;  3NGW A;  1ZJ3 A;  2O1H A;  2AM4 A;  1JYK A;  1GX4 A;  4UEG A;  3U2W A;  4ARW A;  3ST8 A;  2RIX A;  1HJJ A;  4P00 A;  1WVC A;  4HO5 A;  5CQL X;  2O1F A;  4HO0 A;  4EE4 A;  3V91 A;  2E8B A;  5CQO A;  1O23 B;  3SXE A;  1VGZ A;  3ZF8 A;  3OH2 A;  2V0J A;  1H4C A;  5C4C A;  4KQL A;  2BO4 A;  1IIM A;  5C1L A;  1E5K A;  4M28 A;  4IRQ A;  1H7F A;  1ZIZ A;  5C1G A;  1H7G A;  1YP3 A;  4ASY A;  3K8E A;  2RJ8 A;  5C38 A;  4CVH A;  2RJ6 A;  2YQJ A;  2I7B A;  3OH4 A;  3BRK X;  4MND A;  2Y7A A;  2QGI A;  5AJP A;  1R7U A;  3I0E A;  4KXO A;  3CKO A;  4FRL A;  3I0K A;  2ZU7 A;  1ZCV A;  1JVD A;  1MC3 A;  3E26 A;  1YP4 A;  1FZW A;  5CMH A;  3V90 A;  4EE3 A;  4AC3 A;  4E1K A;  4Y9X A;  1SS9 A;  1ZI3 A;  4DE7 A;  2WGZ A;  4HG6 A;  3CGX A;  5C4F A;  2A8W A;  1ZDF A;  5C49 A;  1YRO B; 
#chains in the Genus database with same CATH homology
 2GGQ A;  5D91 A;  3QVB A;  4KPX A;  3ZGF A;  3KIA A;  4HOC A;  5CQP A;  2P73 A;  3FOQ A;  3IOH A;  4B42 A;  1FXJ A;  4HO9 A;  1ZJP A;  2VS3 A;  2PGV A;  1HM8 A;  1PZY B;  4EEM A;  4LW6 A;  1G8O A;  2ICY A;  1R7T A;  1EZI A;  3SX5 A;  1QGQ A;  2VSI A;  4FCE A;  1PZT A;  4C2S A;  4Y7G A;  3ZLK A;  3R2W A;  3U0Y A;  2PX7 A;  4CJB A;  1ON8 A;  4AYL A;  1ZHJ A;  4B4B A;  2RJ1 A;  4FRP A;  1HV9 A;  1LL2 A;  2V0H A;  1YP2 A;  2FYB A;  4HO3 A;  2VK9 A;  4HO2 A;  1G9R A;  5I1F A;  4G3Q A;  5EJ1 A;  3IOI A;  4EVW A;  3SX7 A;  4NAN A;  3CKQ A;  1FGX A;  3V0N A;  2D7I A;  1S4O A;  3ZGG A;  2AH9 A;  4G3P A;  3T7N A;  4B2W A;  5FU0 A;  1W77 A;  3CU0 A;  3DUV A;  3TZT A;  5CMJ A;  3U2X A;  5IDS A;  3I0J A;  1FG5 N;  3IOJ A;  4EEO A;  1H5R B;  3U0X A;  2YC3 A;  4KT7 A;  5C3B A;  5IDT A;  2E3D A;  5CQN X;  5JQQ A;  4K6R A;  1R7Y A;  1EYR A;  4Y7V A;  2FFU A;  1ZDG A;  1QWJ A;  2DPW A;  4HO4 A;  4AYJ A;  5L6S A;  1ZJO A;  2UX8 A;  3I0L A;  4D11 C;  4HO8 A;  1IIN A;  3EE5 A;  3SXD A;  1VGT A;  1NQI B;  1JVG A;  1ZJ1 A;  2JCJ A;  4R7P A;  3JTJ A;  1LZI A;  4O6M A;  4B4M A;  2PGY A;  4Y7F A;  2VS4 A;  4FRB A;  2Z86 A;  1NWG B;  1R80 A;  1QG8 A;  2AGD A;  2PA4 A;  3U2T A;  4FRM A;  4FRD A;  4KRV A;  1NKH B;  2AM5 A;  1G93 A;  4Y6U A;  2ICX A;  1GWW A;  3TQD A;  2VS5 A;  1FGG A;  4DDZ A;  3DK5 A;  5BXC A;  4XWI A;  5C4D A;  2WVL A;  1ZCU A;  3OGZ A;  1G2V A;  5DDT A;  1V82 A;  3CKV A;  5J49 A;  4JIS A;  1FO8 A;  4FIY A;  4FRA A;  4D48 A;  3Q80 A;  2J0A A;  3V0M A;  1MP5 A;  1WT2 A;  5IFY A;  1TVY A;  4BQH A;  1H5S A;  5EIY A;  1LL3 A;  2J0B A;  4DEC A;  4Y62 A;  2JCK A;  4FRE A;  3SXA A;  2RIZ A;  1XHB A;  2FY7 A;  3E25 A;  3Q4S A;  3SXC A;  1V84 A;  2RIY A;  2O1G A;  3I0H A;  3V0Q A;  1LZ7 A;  2WEE A;  3OAM A;  1W57 A;  1WT3 A;  2WVK A;  4KPZ A;  3V8Y A;  4M2B A;  3GUE A;  5EJZ A;  2FYC B;  1VIC A;  2GGO A;  3I0I X;  3T7O A;  1H5S B;  5CMI A;  2OEF A;  2VSH A;  1VH3 A;  5C3A A;  5C47 A;  2VXL A;  1WT1 A;  1H7E A;  2FYD B;  4NAI A;  3RMW A;  1V83 A;  2P72 A;  3OH3 A;  1H5R A;  2MZB A;  2RJ5 A;  2YCM A;  4ECM A;  3RSB A;  4L41 C;  2QKX A;  3F1Y A;  1WT0 A;  1LL0 A;  3HL3 A;  4B5B A;  2VD4 A;  3I0D A;  4KNX A;  5CQM X;  1JYL A;  2ZU9 A;  1GWV A;  3SXB A;  2RJ0 A;  4EEG A;  4EE5 A;  2QH5 A;  1R82 A;  3V8Z A;  2XMH A;  1NMM B;  2W0W A;  3R3I A;  2BO6 A;  5C8R A;  1GA8 A;  3PKQ A;  2X5S A;  1VZU A;  3V0O A;  4FRH A;  1OQM B;  4ZDQ A;  1ZI4 A;  2V0K A;  1H7L A;  2FYA A;  1VH1 A;  2YQH A;  3V0L A;  2Z87 A;  2RIT A;  2C0N A;  4YS8 A;  5AJO A;  2XWM A;  5DDV A;  2Y4M A;  3O3P A;  1R81 A;  3LW6 A;  2Y4J A;  5C48 A;  2RJ4 A;  2WE9 A;  3FWW A;  5C1H A;  5CMF X;  1G3L A;  2BO8 A;  1ON6 A;  1O7O A;  1G95 A;  3SX3 A;  3SXG A;  4FRO A;  1HM9 A;  1ZCT A;  2APC A;  5C4E A;  2NXV A;  3D8V A;  1VM8 A;  1FO9 A;  1ZI5 A;  1H4E A;  1TW1 A;  1FRW A;  5FTS A;  1KWS A;  2X5Z A;  5D92 A;  1Z90 A;  4BMA A;  2V0I A;  2JCL A;  5C3D A;  4NAK A;  2D0J A;  5FUH A;  4AAW A;  3SX8 A;  2AEC A;  4EEA A;  3POL A;  4FRQ A;  1JV1 A;  1R7X A;  1LZ0 A;  4KC4 A;  1GQC A;  4Q7C A;  1H7H A;  1FR9 A;  3I0C A;  1OMX A;  3V0P A;  3OKR A;  3Q7U A;  2OI5 A;  5HS2 A;  4B2X A;  1VZT A;  2AES A;  2YES A;  4IRP A;  2FFV A;  1G0R A;  1JV3 A;  2P6W A;  2WVM A;  1S4N A;  4M4K A;  1H7Q A;  1I52 A;  2Q4J A;  1GX0 A;  1GQ9 A;  2D7R A;  2OI7 A;  3PNN A;  1FR8 A;  1TZF A;  2CU2 A;  4J18 A;  2A8U A;  4NAL A;  1H5S D;  4ASJ A;  4FQW A;  1VPA A;  2AE7 A;  4KC2 A;  4O6N A;  1ZJ2 A;  1G23 A;  3N9W A;  3OH0 A;  3U2U A;  2X60 A;  3USR A;  4HCQ A;  5AJN A;  1MP4 A;  4B4G A;  1TW5 A;  1MP3 A;  1K4V A;  1LZJ A;  2YQC A;  4JD0 A;  3DJ4 A;  1VGU A;  3U2V A;  3CKJ A;  4Y63 A;  1ZJ0 A;  1R7V A;  1FWY A;  2I5E A;  1H7T A;  2I5K A;  4KC1 A;  5FV9 A;  1INI A;  1ZCY A;  3F1C A;  4Y7T A;  1G97 A;  3JUJ A;  4P02 A;  5FU8 A;  2WAW A;  3PKP A;  4MYB A;  1W55 A;  2Y4K A;  1NF5 B;  1LVW A;  1ZI1 A;  3D5N A;  1H5S C;  1O7Q A;  1VZX A;  5L6V A;  2OI6 A;  4Y64 A;  5C36 A;  2W0V A;  4Y7U A;  4D11 A;  2VFZ A;  2Y4L A;  3I0G A;  4CJC A;  1HM0 A;  3K8D A;  3USQ A;  1H4D A;  2V0L A;  3OC9 A;  1WSZ A;  2Y6P A;  4D0T A;  2YQS A;  4MIX A;  2YC5 A;  1VGW A;  3SPT A;  1INJ A;  5C4B A;  4G3S A;  3ZLL A;  4FIX A;  2ZU8 A;  1O0R A;  4CJ8 A;  2XWL A;  1NHE B;  3OH1 A;  4D0Z A;  1XZ6 A;  1FXO A;  1H5T A;  3RMV A;  2RJ7 A;  4Y6N A;  2XME A;  2VXM A;  3I0F A;  4FCU A;  1S4P A;  3T7M A;  3BCV A;  4M2A A;  2X65 A;  3CKN A;  1FOA A;  2RJ9 A;  2AM3 A;  4LW3 A;  1H3M A;  5FTV A;  4KNR A;  1QGS A;  2OEG A;  4B3U A;  4HO6 A;  2XWN A;  3JUK A;  2JCO A;  2BO7 A;  4G87 A;  5CMG X;  1H5T B;  1OMZ A;  3D98 A;  5FYE A;  4GBP A;  1HJL A;  1G1L A;  3NGW A;  1ZJ3 A;  2O1H A;  2AM4 A;  1JYK A;  1GX4 A;  4UEG A;  3U2W A;  4ARW A;  3ST8 A;  2RIX A;  1HJJ A;  4P00 A;  1WVC A;  4HO5 A;  5CQL X;  2O1F A;  4HO0 A;  4EE4 A;  3V91 A;  2E8B A;  5CQO A;  1O23 B;  3SXE A;  1VGZ A;  3ZF8 A;  3OH2 A;  2V0J A;  1H4C A;  5C4C A;  4KQL A;  2BO4 A;  1IIM A;  5C1L A;  1E5K A;  4M28 A;  4IRQ A;  1H7F A;  1ZIZ A;  5C1G A;  1H7G A;  1YP3 A;  4ASY A;  3K8E A;  2RJ8 A;  5C38 A;  4CVH A;  2RJ6 A;  2YQJ A;  2I7B A;  3OH4 A;  3BRK X;  4MND A;  2Y7A A;  2QGI A;  5AJP A;  1R7U A;  3I0E A;  4KXO A;  3CKO A;  4FRL A;  3I0K A;  2ZU7 A;  1ZCV A;  1JVD A;  1MC3 A;  3E26 A;  1YP4 A;  1FZW A;  5CMH A;  3V90 A;  4EE3 A;  4AC3 A;  4E1K A;  4Y9X A;  1SS9 A;  1ZI3 A;  4DE7 A;  2WGZ A;  4HG6 A;  3CGX A;  5C4F A;  2A8W A;  1ZDF A;  5C49 A;  1YRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...