1LL3A

Crystal structure of rabbit muscle glycogenin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
261
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSEMTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGENIN-1
publication title Crystal structure of the autocatalytic initiator of glycogen biosynthesis, glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 86
structure length 261
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1ll3A00
2ICYA 2RJ9A 2BO4A 1R7TA 2XWLA 3I0EA 3RMVA 4EVWA 2W0VA 3TZTA 3DJ4A 3DUVA 1H7QA 3SXBA 1VGZA 3D8VA 4ASYA 1LZJA 2CU2A 2OI6A 3TQDA 1FR8A 4CVHA 5L6SA 2I5KA 1GA8A 2WAWA 2Y6PA 4B2XA 1FO9A 1MP4A 2A8WA 4J18A 4Y7UA 3BRKX 1H5RB 1ZJ2A 5C3BA 4FRDA 1LZIA 4FRAA 1G3LA 2FYAA 1H7TA 1JV3A 1ZI1A 1O7QA 5IDSA 2XMHA 2GGOA 5FU0A 1S4NA 1VH1A 2OI7A 3CKNA 1H5SA 3I0FA 4FRLA 1G1LA 1HV9A 4Y6NA 2PA4A 2OI5A 2I5EA 4EEAA 5C47A 1LZ7A 4UEGA 4HO3A 1FXJA 4EE5A 3I0DA 2V0KA 4Y6UA 3V8ZA 1G0RA 1VZTA 4CJBA 2Q4JA 5J49A 4B4BA 5FU8A 3SXDA 3Q4SA 2VS3A 1ZCVA 3R3IA 4EEGA 2Y7AA 5C8RA 1QWJA 3NGWA 3JUKA 1Z90A 2Y4MA 2O1GA 2P73A 2UX8A 4Y64A 3CKQA 2RJ4A 4YS8A 1ZCTA 2YQCA 3IOHA 1LZ0A 4HO4A 2WEEA 2OEFA 2YC5A 1ZI4A 4ZDQA 4FCEA 1QGQA 4KQLA 3SX7A 1WT2A 1TW1A 5FYEA 2VXMA 3SXEA 1YROB 3T7OA 1ZJ0A 4HO9A 3Q80A 3SX5A 3V90A 1NMMB 1NF5B 1GWVA 3JTJA 3OC9A 3ZGGA 4D0TA 3DK5A 2P6WA 2YESA 4KPZA 3SPTA 1JYKA 1G9RA 3QVBA 1NKHB 5AJOA 5DDVA 1YP3A 1V83A 2Z87A 2RIYA 4KPXA 5FTVA 2FY7A 5C36A 1H5TA 1V84A 2AH9A 4KT7A 2RIZA 3ZLLA 5C38A 2WGZA 3SX8A 2BO6A 3OH4A 5C4CA 1G8OA 2VS4A 5CMJA 3PKQA 5CMFX 3GUEA 4NAKA 4FQWA 2X5SA 3U2UA 2XWMA 1FR9A 4B4MA 3I0HA 1WSZA 3KIAA 1W57A 4M28A 2XMEA 4B4GA 1VGWA 1ZI3A 2FFVA 2ZU8A 2PGYA 1XHBA 4B3UA 2JCKA 2JCJA 1ZCYA 5CQPA 2D0JA 3D98A 2RIXA 4KRVA 1VZXA 3PNNA 3V0MA 2BO7A 1FO8A 2VS5A 4AYLA 2I7BA 4CJ8A 5EJ1A 4ECMA 4HO8A 5JQQA 2FYDB 2RJ0A 2AM4A 1GWWA 2AE7A 5C4EA 3OH2A 1W77A 2ICXA 3PKPA 1V82A 3OGZA 1H7LA 1ZHJA 1FGGA 5C1LA 3JUJA 3I0IX 5C48A 3HL3A 1H7EA 4LW3A 3IOJA 1HM8A 1ZJPA 1HM0A 4K6RA 4HO6A 1MP3A 1YP4A 4EE3A 2FYCB 2Y4JA 3I0JA 1FGXA 5EIYA 5C1HA 2VSIA 2V0JA 3I0GA 1INJA 1R7UA 3F1YA 5L6VA 1HM9A 1FXOA 4MYBA 1NWGB 3OKRA 5C3AA 5CMGX 4B5BA 3FWWA 1ZJ1A 3I0LA 1SS9A 4JD0A 1H5RA 3T7NA 5C49A 5C3DA 2O1HA 5C1GA 3E25A 3V0NA 1LVWA 5DDTA 3CKOA 1ZDFA 1FG5N 1OQMB 1GX0A 5CQMX 3V0LA 5CQOA 3FOQA 1OMXA 3RMWA 4FRPA 2PX7A 3SX3A 3CKJA 4Y7FA 5CMHA 2V0LA 1H7GA 1I52A 1ON8A 2Y4KA 3V0QA 1H3MA 5CQNX 1GX4A 2ZU9A 1H7HA 2DPWA 2V0HA 3T7MA 4D48A 3ZLKA 1H7FA 1O7OA 1PZTA 4FREA 2WVKA 4Y9XA 1ZCUA 1OMZA 4HO2A 4IRQA 4ASJA 5AJPA 3U2VA 2YQHA 4G3SA 2X65A 4KC1A 2AGDA 3CGXA 2V0IA 5C4BA 2VFZA 1FWYA 1R80A 5FUHA 1O0RA 4HO5A 4IRPA 1LL3A 1H4DA 1WT1A 4AYJA 1PZYB 1G95A 1VGTA 3ST8A 4R7PA 3I0KA 5IDTA 4FRBA 1VM8A 1S4PA 3N9WA 4XWIA 2RJ1A 1JVGA 2QKXA 1G2VA 4BMAA 2VD4A 5C4DA 1MC3A 2VSHA 4Y7VA 5I1FA 1ZJOA 5HS2A 4L41C 2D7RA 1H4CA 4DE7A 2MZBA 2WVMA 2WVLA 4P02A 4KXOA 2NXVA 2E3DA 5CQLX 4EEMA 5BXCA 4P00A 3CKVA 2FFUA 4G87A 1TZFA 1ZDGA 3OAMA 3CU0A 1HJLA 3V8YA 1VICA 1H5SB 4KC4A 4CJCA 2YCMA 2QH5A 4D0ZA 1VZUA 4HG6A 2O1FA 4KC2A 3F1CA 4FCUA 2D7IA 1IINA 1R7YA 3POLA 3OH0A 4AAWA 3ZGFA 1H4EA 4HOCA 2RITA 2QGIA 3SXCA 4Y62A 1R81A 1TW5A 3LW6A 4M2BA 4KNRA 3IOIA 4GBPA 4M2AA 1S4OA 4D11C 3D5NA 1HJJA 1FZWA 1VPAA 2Y4LA 2AM5A 3OH3A 4JISA 4G3PA 4DDZA 3V0PA 1XZ6A 3U2TA 2JCLA 2AM3A 1R82A 1JYLA 2AECA 4FRQA 3EE5A 3U0YA 4NALA 2AESA 2APCA 3U2XA 1LL2A 4EE4A 3V91A 1FRWA 2VXLA 2RJ6A 5FV9A 1O23B 1NHEB 4HCQA 1H5SD 1JVDA 5IFYA 1WT0A 1G23A 4G3QA 2YQJA 3ZF8A 3U0XA 1ZJ3A 3SXAA 2JCOA 1VH3A 1W55A 3R2WA 2RJ7A 1G97A 5C4FA 2W0WA 1INIA 1IIMA 4Y7GA 1MP5A 4M4KA 4FRMA 4D11A 1H5TB 3BCVA 2XWNA 1ZIZA 2OEGA 4FRHA 1JV1A 1WT3A 3RSBA 5FTSA 1ON6A 4HO0A 5EJZA 3V0OA 3OH1A 4C2SA 4NAIA 4KNXA 1GQCA 2RJ8A 3Q7UA 1NQIB 1EYRA 5AJNA 4ARWA 3SXGA 1ZI5A 3E26A 3U2WA 3USRA 2GGQA 2WE9A 1E5KA 2RJ5A 4B2WA 4AC3A 1EZIA 2P72A 4Y7TA 2E8BA 2YQSA 4BQHA 2YC3A 5CMIA 2BO8A 1K4VA 4EEOA 3O3PA 1QGSA 2ZU7A 1GQ9A 1TVYA 2PGVA 1R7VA 3I0CA 4E1KA 2A8UA 4FROA 3K8EA 4NANA 3K8DA 1FOAA 1WVCA 2X60A 4B42A 1LL0A 4MNDA 1VGUA 1G93A 1KWSA 1QG8A 4Y63A 4DECA 4LW6A 2FYBA 3USQA 2Z86A 2X5ZA 1H5SC 1R7XA 1YP2A
chains in the Genus database with same CATH superfamily
5D92A 2ICYA 2RJ9A 2BO4A 1R7TA 2XWLA 3I0EA 4FIXA 3RMVA 4EVWA 2W0VA 3TZTA 3DJ4A 3DUVA 1H7QA 3SXBA 1VGZA 3D8VA 4ASYA 1LZJA 2CU2A 2OI6A 3TQDA 1FR8A 4CVHA 5L6SA 2I5KA 1GA8A 2WAWA 2Y6PA 4B2XA 1FO9A 1MP4A 2A8WA 4J18A 4Y7UA 3BRKX 1H5RB 1ZJ2A 5C3BA 4FRDA 1LZIA 4FRAA 1G3LA 4MIXA 2FYAA 1H7TA 1JV3A 1ZI1A 1O7QA 5IDSA 2XMHA 2GGOA 5FU0A 1S4NA 1VH1A 4O6MA 2OI7A 3CKNA 1H5SA 3I0FA 4FRLA 1G1LA 1HV9A 4Y6NA 2PA4A 2OI5A 2I5EA 4EEAA 5C47A 1LZ7A 4UEGA 4HO3A 1FXJA 4EE5A 3I0DA 2V0KA 4Y6UA 3V8ZA 1G0RA 1VZTA 4CJBA 2Q4JA 5J49A 4B4BA 5FU8A 3SXDA 3Q4SA 2VS3A 1ZCVA 3R3IA 4EEGA 2Y7AA 5C8RA 1QWJA 3NGWA 4Q7CA 3JUKA 1Z90A 2Y4MA 2O1GA 2P73A 2UX8A 4Y64A 3CKQA 2RJ4A 4YS8A 1ZCTA 2YQCA 3IOHA 1LZ0A 4HO4A 2WEEA 2OEFA 2YC5A 1ZI4A 5D91A 4ZDQA 4FCEA 1QGQA 4KQLA 3SX7A 1WT2A 1TW1A 5FYEA 2VXMA 3SXEA 1YROB 3T7OA 1ZJ0A 4HO9A 3Q80A 3SX5A 3V90A 1NMMB 2C0NA 1NF5B 1GWVA 3JTJA 3OC9A 3ZGGA 4D0TA 3DK5A 2P6WA 2YESA 4KPZA 3SPTA 1JYKA 1G9RA 3QVBA 1NKHB 5AJOA 5DDVA 1YP3A 1V83A 2Z87A 2RIYA 4KPXA 5FTVA 2FY7A 5C36A 1H5TA 1V84A 2AH9A 4KT7A 2RIZA 3ZLLA 5C38A 2WGZA 3SX8A 2BO6A 3OH4A 5C4CA 1G8OA 2VS4A 5CMJA 3PKQA 5CMFX 3GUEA 4NAKA 4FQWA 2X5SA 3U2UA 2XWMA 1FR9A 4B4MA 3I0HA 1WSZA 3KIAA 1W57A 4M28A 2XMEA 4B4GA 1VGWA 1ZI3A 2FFVA 2ZU8A 2PGYA 1XHBA 4B3UA 2JCKA 2JCJA 1ZCYA 5CQPA 2D0JA 3D98A 2RIXA 4KRVA 1VZXA 3PNNA 3V0MA 2BO7A 1FO8A 2VS5A 4AYLA 2I7BA 4CJ8A 5EJ1A 4ECMA 4HO8A 5JQQA 2FYDB 2RJ0A 2AM4A 1GWWA 2AE7A 5C4EA 3OH2A 1W77A 2ICXA 3PKPA 1V82A 3OGZA 1H7LA 1ZHJA 1FGGA 5C1LA 3JUJA 3I0IX 5C48A 3HL3A 1H7EA 4LW3A 3IOJA 1HM8A 1ZJPA 1HM0A 4K6RA 4HO6A 1MP3A 1YP4A 2J0AA 4EE3A 2FYCB 2Y4JA 3I0JA 1FGXA 5EIYA 5C1HA 2VSIA 2V0JA 3I0GA 1INJA 1R7UA 3F1YA 5L6VA 1HM9A 1FXOA 4MYBA 1NWGB 3OKRA 4FIYA 5C3AA 5CMGX 4B5BA 3FWWA 1ZJ1A 3I0LA 1SS9A 4JD0A 1H5RA 3T7NA 5C49A 5C3DA 2O1HA 5C1GA 3E25A 3V0NA 1LVWA 5DDTA 3CKOA 1ZDFA 1FG5N 1OQMB 1GX0A 5CQMX 3V0LA 5CQOA 3FOQA 1OMXA 3RMWA 4FRPA 2PX7A 3SX3A 3CKJA 4Y7FA 5CMHA 2V0LA 1H7GA 1I52A 1ON8A 2Y4KA 3V0QA 1H3MA 5CQNX 1GX4A 2ZU9A 1H7HA 2DPWA 2V0HA 3T7MA 4D48A 3ZLKA 1H7FA 1O7OA 1PZTA 4FREA 2WVKA 4Y9XA 1ZCUA 1OMZA 4HO2A 4IRQA 4ASJA 5AJPA 3U2VA 2YQHA 4G3SA 2X65A 4KC1A 2AGDA 3CGXA 2J0BA 2V0IA 5C4BA 2VFZA 1FWYA 1R80A 5FUHA 1O0RA 4HO5A 4IRPA 1LL3A 1H4DA 1WT1A 4AYJA 1PZYB 1G95A 1VGTA 3ST8A 4R7PA 3I0KA 5IDTA 4FRBA 1VM8A 1S4PA 3N9WA 4XWIA 2RJ1A 1JVGA 2QKXA 1G2VA 4BMAA 2VD4A 5C4DA 1MC3A 2VSHA 4O6NA 4Y7VA 1ZJOA 5I1FA 5HS2A 4L41C 2D7RA 1H4CA 4DE7A 2MZBA 2WVMA 2WVLA 4P02A 4KXOA 2NXVA 2E3DA 5CQLX 4EEMA 5BXCA 4P00A 3CKVA 2FFUA 4G87A 1TZFA 1ZDGA 3OAMA 3CU0A 1HJLA 2VK9A 3V8YA 1VICA 1H5SB 4KC4A 4CJCA 2YCMA 2QH5A 4D0ZA 1VZUA 4HG6A 2O1FA 4KC2A 3F1CA 4FCUA 2D7IA 1IINA 1R7YA 3POLA 3OH0A 4AAWA 3ZGFA 1H4EA 4HOCA 2RITA 2QGIA 3SXCA 4Y62A 1R81A 1TW5A 3LW6A 4M2BA 4KNRA 3IOIA 4GBPA 4M2AA 1S4OA 4D11C 3D5NA 1HJJA 1FZWA 1VPAA 2Y4LA 2AM5A 3OH3A 4JISA 4G3PA 4DDZA 3V0PA 1XZ6A 3U2TA 2JCLA 2AM3A 1R82A 1JYLA 2AECA 4FRQA 3EE5A 3U0YA 4NALA 2AESA 2APCA 3U2XA 1LL2A 4EE4A 3V91A 1FRWA 2VXLA 2RJ6A 5FV9A 1O23B 1NHEB 4HCQA 1H5SD 1JVDA 5IFYA 1WT0A 1G23A 4G3QA 2YQJA 3ZF8A 3U0XA 1ZJ3A 3SXAA 2JCOA 1VH3A 1W55A 3R2WA 2RJ7A 1G97A 5C4FA 2W0WA 1INIA 1IIMA 4Y7GA 1MP5A 4M4KA 4FRMA 4D11A 1H5TB 3BCVA 2XWNA 1ZIZA 2OEGA 4FRHA 1JV1A 1WT3A 3RSBA 5FTSA 1ON6A 4HO0A 5EJZA 3V0OA 3OH1A 4C2SA 4NAIA 4KNXA 1GQCA 2RJ8A 3Q7UA 1NQIB 1EYRA 5AJNA 4ARWA 3SXGA 1ZI5A 3E26A 3U2WA 3USRA 2GGQA 2WE9A 1E5KA 2RJ5A 4B2WA 4AC3A 1EZIA 2P72A 4Y7TA 2E8BA 2YQSA 4BQHA 2YC3A 5CMIA 2BO8A 1K4VA 4EEOA 3O3PA 1QGSA 2ZU7A 1GQ9A 1TVYA 2PGVA 1R7VA 3I0CA 4E1KA 2A8UA 4FROA 3K8EA 4NANA 3K8DA 1FOAA 1WVCA 2X60A 4B42A 1LL0A 4MNDA 1VGUA 1G93A 1KWSA 1QG8A 4Y63A 4DECA 4LW6A 2FYBA 3USQA 2Z86A 2X5ZA 1H5SC 1R7XA 1YP2A
chains in the Genus database with same CATH topology
5D92A 2ICYA 2RJ9A 2BO4A 1R7TA 2XWLA 3I0EA 4FIXA 3RMVA 4EVWA 2W0VA 3TZTA 3DJ4A 3DUVA 1H7QA 3SXBA 1VGZA 3D8VA 4ASYA 1LZJA 2CU2A 2OI6A 3TQDA 1FR8A 4CVHA 5L6SA 2I5KA 1GA8A 2WAWA 2Y6PA 4B2XA 1FO9A 1MP4A 2A8WA 4J18A 4Y7UA 3BRKX 1H5RB 1ZJ2A 5C3BA 4FRDA 1LZIA 4FRAA 1G3LA 4MIXA 2FYAA 1H7TA 1JV3A 1ZI1A 1O7QA 5IDSA 2XMHA 2GGOA 5FU0A 1S4NA 1VH1A 4O6MA 2OI7A 3CKNA 1H5SA 3I0FA 4FRLA 1G1LA 1HV9A 4Y6NA 2PA4A 2OI5A 2I5EA 4EEAA 5C47A 1LZ7A 4UEGA 4HO3A 1FXJA 4EE5A 3I0DA 2V0KA 4Y6UA 3V8ZA 1G0RA 1VZTA 4CJBA 2Q4JA 5J49A 4B4BA 5FU8A 3SXDA 3Q4SA 2VS3A 1ZCVA 3R3IA 4EEGA 2Y7AA 5C8RA 1QWJA 3NGWA 4Q7CA 3JUKA 1Z90A 2Y4MA 2O1GA 2P73A 2UX8A 4Y64A 3CKQA 2RJ4A 4YS8A 1ZCTA 2YQCA 3IOHA 1LZ0A 4HO4A 2WEEA 2OEFA 2YC5A 1ZI4A 5D91A 4ZDQA 4FCEA 1QGQA 4KQLA 3SX7A 1WT2A 1TW1A 5FYEA 2VXMA 3SXEA 1YROB 3T7OA 1ZJ0A 4HO9A 3Q80A 3SX5A 3V90A 1NMMB 2C0NA 1NF5B 1GWVA 3JTJA 3OC9A 3ZGGA 4D0TA 3DK5A 2P6WA 2YESA 4KPZA 3SPTA 1JYKA 1G9RA 3QVBA 1NKHB 5AJOA 5DDVA 1YP3A 1V83A 2Z87A 2RIYA 4KPXA 5FTVA 2FY7A 5C36A 1H5TA 1V84A 2AH9A 4KT7A 2RIZA 3ZLLA 5C38A 2WGZA 3SX8A 2BO6A 3OH4A 5C4CA 1G8OA 2VS4A 5CMJA 3PKQA 5CMFX 3GUEA 4NAKA 4FQWA 2X5SA 3U2UA 2XWMA 1FR9A 4B4MA 3I0HA 1WSZA 3KIAA 1W57A 4M28A 2XMEA 4B4GA 1VGWA 1ZI3A 2FFVA 2ZU8A 2PGYA 1XHBA 4B3UA 2JCKA 2JCJA 1ZCYA 5CQPA 2D0JA 3D98A 2RIXA 4KRVA 1VZXA 3PNNA 3V0MA 2BO7A 1FO8A 2VS5A 4AYLA 2I7BA 4CJ8A 5EJ1A 4ECMA 4HO8A 5JQQA 2FYDB 2RJ0A 2AM4A 1GWWA 2AE7A 5C4EA 3OH2A 1W77A 2ICXA 3PKPA 1V82A 3OGZA 1H7LA 1ZHJA 1FGGA 5C1LA 3JUJA 3I0IX 5C48A 3HL3A 1H7EA 4LW3A 3IOJA 1HM8A 1ZJPA 1HM0A 4K6RA 4HO6A 1MP3A 1YP4A 2J0AA 4EE3A 2FYCB 2Y4JA 3I0JA 1FGXA 5EIYA 5C1HA 2VSIA 2V0JA 3I0GA 1INJA 1R7UA 3F1YA 5L6VA 1HM9A 1FXOA 4MYBA 1NWGB 3OKRA 4FIYA 5C3AA 5CMGX 4B5BA 3FWWA 1ZJ1A 3I0LA 1SS9A 4JD0A 1H5RA 3T7NA 5C49A 5C3DA 2O1HA 5C1GA 3E25A 3V0NA 1LVWA 5DDTA 3CKOA 1ZDFA 1FG5N 1OQMB 1GX0A 5CQMX 3V0LA 5CQOA 3FOQA 1OMXA 3RMWA 4FRPA 2PX7A 3SX3A 3CKJA 4Y7FA 5CMHA 2V0LA 1H7GA 1I52A 1ON8A 2Y4KA 3V0QA 1H3MA 5CQNX 1GX4A 2ZU9A 1H7HA 2DPWA 2V0HA 3T7MA 4D48A 3ZLKA 1H7FA 1O7OA 1PZTA 4FREA 2WVKA 4Y9XA 1ZCUA 1OMZA 4HO2A 4IRQA 4ASJA 5AJPA 3U2VA 2YQHA 4G3SA 2X65A 4KC1A 2AGDA 3CGXA 2J0BA 2V0IA 5C4BA 2VFZA 1FWYA 1R80A 5FUHA 1O0RA 4HO5A 4IRPA 1LL3A 1H4DA 1WT1A 4AYJA 1PZYB 1G95A 1VGTA 3ST8A 4R7PA 3I0KA 5IDTA 4FRBA 1VM8A 1S4PA 3N9WA 4XWIA 2RJ1A 1JVGA 2QKXA 1G2VA 4BMAA 2VD4A 5C4DA 1MC3A 2VSHA 4O6NA 4Y7VA 1ZJOA 5I1FA 5HS2A 4L41C 2D7RA 1H4CA 4DE7A 2MZBA 2WVMA 2WVLA 4P02A 4KXOA 2NXVA 2E3DA 5CQLX 4EEMA 5BXCA 4P00A 3CKVA 2FFUA 4G87A 1TZFA 1ZDGA 3OAMA 3CU0A 1HJLA 2VK9A 3V8YA 1VICA 1H5SB 4KC4A 4CJCA 2YCMA 2QH5A 4D0ZA 1VZUA 4HG6A 2O1FA 4KC2A 3F1CA 4FCUA 2D7IA 1IINA 1R7YA 3POLA 3OH0A 4AAWA 3ZGFA 1H4EA 4HOCA 2RITA 2QGIA 3SXCA 4Y62A 1R81A 1TW5A 3LW6A 4M2BA 4KNRA 3IOIA 4GBPA 4M2AA 1S4OA 4D11C 3D5NA 1HJJA 1FZWA 1VPAA 2Y4LA 2AM5A 3OH3A 4JISA 4G3PA 4DDZA 3V0PA 1XZ6A 3U2TA 2JCLA 2AM3A 1R82A 1JYLA 2AECA 4FRQA 3EE5A 3U0YA 4NALA 2AESA 2APCA 3U2XA 1LL2A 4EE4A 3V91A 1FRWA 2VXLA 2RJ6A 5FV9A 1O23B 1NHEB 4HCQA 1H5SD 1JVDA 5IFYA 1WT0A 1G23A 4G3QA 2YQJA 3ZF8A 3U0XA 1ZJ3A 3SXAA 2JCOA 1VH3A 1W55A 3R2WA 2RJ7A 1G97A 5C4FA 2W0WA 1INIA 1IIMA 4Y7GA 1MP5A 4M4KA 4FRMA 4D11A 1H5TB 3BCVA 2XWNA 1ZIZA 2OEGA 4FRHA 1JV1A 1WT3A 3RSBA 5FTSA 1ON6A 4HO0A 5EJZA 3V0OA 3OH1A 4C2SA 4NAIA 4KNXA 1GQCA 2RJ8A 3Q7UA 1NQIB 1EYRA 5AJNA 4ARWA 3SXGA 1ZI5A 3E26A 3U2WA 3USRA 2GGQA 2WE9A 1E5KA 2RJ5A 4B2WA 4AC3A 1EZIA 2P72A 4Y7TA 2E8BA 2YQSA 4BQHA 2YC3A 5CMIA 2BO8A 1K4VA 4EEOA 3O3PA 1QGSA 2ZU7A 1GQ9A 1TVYA 2PGVA 1R7VA 3I0CA 4E1KA 2A8UA 4FROA 3K8EA 4NANA 3K8DA 1FOAA 1WVCA 2X60A 4B42A 1LL0A 4MNDA 1VGUA 1G93A 1KWSA 1QG8A 4Y63A 4DECA 4LW6A 2FYBA 3USQA 2Z86A 2X5ZA 1H5SC 1R7XA 1YP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICY A;  2RJ9 A;  2BO4 A;  1R7T A;  2XWL A;  3I0E A;  3RMV A;  4EVW A;  2W0V A;  3TZT A;  3DJ4 A;  3DUV A;  1H7Q A;  3SXB A;  1VGZ A;  3D8V A;  4ASY A;  1LZJ A;  2CU2 A;  2OI6 A;  3TQD A;  1FR8 A;  4CVH A;  5L6S A;  2I5K A;  1GA8 A;  2WAW A;  2Y6P A;  4B2X A;  1FO9 A;  1MP4 A;  2A8W A;  4J18 A;  4Y7U A;  3BRK X;  1H5R B;  1ZJ2 A;  5C3B A;  4FRD A;  1LZI A;  4FRA A;  1G3L A;  2FYA A;  1H7T A;  1JV3 A;  1ZI1 A;  1O7Q A;  5IDS A;  2XMH A;  2GGO A;  5FU0 A;  1S4N A;  1VH1 A;  2OI7 A;  3CKN A;  1H5S A;  3I0F A;  4FRL A;  1G1L A;  1HV9 A;  4Y6N A;  2PA4 A;  2OI5 A;  2I5E A;  4EEA A;  5C47 A;  1LZ7 A;  4UEG A;  4HO3 A;  1FXJ A;  4EE5 A;  3I0D A;  2V0K A;  4Y6U A;  3V8Z A;  1G0R A;  1VZT A;  4CJB A;  2Q4J A;  5J49 A;  4B4B A;  5FU8 A;  3SXD A;  3Q4S A;  2VS3 A;  1ZCV A;  3R3I A;  4EEG A;  2Y7A A;  5C8R A;  1QWJ A;  3NGW A;  3JUK A;  1Z90 A;  2Y4M A;  2O1G A;  2P73 A;  2UX8 A;  4Y64 A;  3CKQ A;  2RJ4 A;  4YS8 A;  1ZCT A;  2YQC A;  3IOH A;  1LZ0 A;  4HO4 A;  2WEE A;  2OEF A;  2YC5 A;  1ZI4 A;  4ZDQ A;  4FCE A;  1QGQ A;  4KQL A;  3SX7 A;  1WT2 A;  1TW1 A;  5FYE A;  2VXM A;  3SXE A;  1YRO B;  3T7O A;  1ZJ0 A;  4HO9 A;  3Q80 A;  3SX5 A;  3V90 A;  1NMM B;  1NF5 B;  1GWV A;  3JTJ A;  3OC9 A;  3ZGG A;  4D0T A;  3DK5 A;  2P6W A;  2YES A;  4KPZ A;  3SPT A;  1JYK A;  1G9R A;  3QVB A;  1NKH B;  5AJO A;  5DDV A;  1YP3 A;  1V83 A;  2Z87 A;  2RIY A;  4KPX A;  5FTV A;  2FY7 A;  5C36 A;  1H5T A;  1V84 A;  2AH9 A;  4KT7 A;  2RIZ A;  3ZLL A;  5C38 A;  2WGZ A;  3SX8 A;  2BO6 A;  3OH4 A;  5C4C A;  1G8O A;  2VS4 A;  5CMJ A;  3PKQ A;  5CMF X;  3GUE A;  4NAK A;  4FQW A;  2X5S A;  3U2U A;  2XWM A;  1FR9 A;  4B4M A;  3I0H A;  1WSZ A;  3KIA A;  1W57 A;  4M28 A;  2XME A;  4B4G A;  1VGW A;  1ZI3 A;  2FFV A;  2ZU8 A;  2PGY A;  1XHB A;  4B3U A;  2JCK A;  2JCJ A;  1ZCY A;  5CQP A;  2D0J A;  3D98 A;  2RIX A;  4KRV A;  1VZX A;  3PNN A;  3V0M A;  2BO7 A;  1FO8 A;  2VS5 A;  4AYL A;  2I7B A;  4CJ8 A;  5EJ1 A;  4ECM A;  4HO8 A;  5JQQ A;  2FYD B;  2RJ0 A;  2AM4 A;  1GWW A;  2AE7 A;  5C4E A;  3OH2 A;  1W77 A;  2ICX A;  3PKP A;  1V82 A;  3OGZ A;  1H7L A;  1ZHJ A;  1FGG A;  5C1L A;  3JUJ A;  3I0I X;  5C48 A;  3HL3 A;  1H7E A;  4LW3 A;  3IOJ A;  1HM8 A;  1ZJP A;  1HM0 A;  4K6R A;  4HO6 A;  1MP3 A;  1YP4 A;  4EE3 A;  2FYC B;  2Y4J A;  3I0J A;  1FGX A;  5EIY A;  5C1H A;  2VSI A;  2V0J A;  3I0G A;  1INJ A;  1R7U A;  3F1Y A;  5L6V A;  1HM9 A;  1FXO A;  4MYB A;  1NWG B;  3OKR A;  5C3A A;  5CMG X;  4B5B A;  3FWW A;  1ZJ1 A;  3I0L A;  1SS9 A;  4JD0 A;  1H5R A;  3T7N A;  5C49 A;  5C3D A;  2O1H A;  5C1G A;  3E25 A;  3V0N A;  1LVW A;  5DDT A;  3CKO A;  1ZDF A;  1FG5 N;  1OQM B;  1GX0 A;  5CQM X;  3V0L A;  5CQO A;  3FOQ A;  1OMX A;  3RMW A;  4FRP A;  2PX7 A;  3SX3 A;  3CKJ A;  4Y7F A;  5CMH A;  2V0L A;  1H7G A;  1I52 A;  1ON8 A;  2Y4K A;  3V0Q A;  1H3M A;  5CQN X;  1GX4 A;  2ZU9 A;  1H7H A;  2DPW A;  2V0H A;  3T7M A;  4D48 A;  3ZLK A;  1H7F A;  1O7O A;  1PZT A;  4FRE A;  2WVK A;  4Y9X A;  1ZCU A;  1OMZ A;  4HO2 A;  4IRQ A;  4ASJ A;  5AJP A;  3U2V A;  2YQH A;  4G3S A;  2X65 A;  4KC1 A;  2AGD A;  3CGX A;  2V0I A;  5C4B A;  2VFZ A;  1FWY A;  1R80 A;  5FUH A;  1O0R A;  4HO5 A;  4IRP A;  1LL3 A;  1H4D A;  1WT1 A;  4AYJ A;  1PZY B;  1G95 A;  1VGT A;  3ST8 A;  4R7P A;  3I0K A;  5IDT A;  4FRB A;  1VM8 A;  1S4P A;  3N9W A;  4XWI A;  2RJ1 A;  1JVG A;  2QKX A;  1G2V A;  4BMA A;  2VD4 A;  5C4D A;  1MC3 A;  2VSH A;  4Y7V A;  5I1F A;  1ZJO A;  5HS2 A;  4L41 C;  2D7R A;  1H4C A;  4DE7 A;  2MZB A;  2WVM A;  2WVL A;  4P02 A;  4KXO A;  2NXV A;  2E3D A;  5CQL X;  4EEM A;  5BXC A;  4P00 A;  3CKV A;  2FFU A;  4G87 A;  1TZF A;  1ZDG A;  3OAM A;  3CU0 A;  1HJL A;  3V8Y A;  1VIC A;  1H5S B;  4KC4 A;  4CJC A;  2YCM A;  2QH5 A;  4D0Z A;  1VZU A;  4HG6 A;  2O1F A;  4KC2 A;  3F1C A;  4FCU A;  2D7I A;  1IIN A;  1R7Y A;  3POL A;  3OH0 A;  4AAW A;  3ZGF A;  1H4E A;  4HOC A;  2RIT A;  2QGI A;  3SXC A;  4Y62 A;  1R81 A;  1TW5 A;  3LW6 A;  4M2B A;  4KNR A;  3IOI A;  4GBP A;  4M2A A;  1S4O A;  4D11 C;  3D5N A;  1HJJ A;  1FZW A;  1VPA A;  2Y4L A;  2AM5 A;  3OH3 A;  4JIS A;  4G3P A;  4DDZ A;  3V0P A;  1XZ6 A;  3U2T A;  2JCL A;  2AM3 A;  1R82 A;  1JYL A;  2AEC A;  4FRQ A;  3EE5 A;  3U0Y A;  4NAL A;  2AES A;  2APC A;  3U2X A;  1LL2 A;  4EE4 A;  3V91 A;  1FRW A;  2VXL A;  2RJ6 A;  5FV9 A;  1O23 B;  1NHE B;  4HCQ A;  1H5S D;  1JVD A;  5IFY A;  1WT0 A;  1G23 A;  4G3Q A;  2YQJ A;  3ZF8 A;  3U0X A;  1ZJ3 A;  3SXA A;  2JCO A;  1VH3 A;  1W55 A;  3R2W A;  2RJ7 A;  1G97 A;  5C4F A;  2W0W A;  1INI A;  1IIM A;  4Y7G A;  1MP5 A;  4M4K A;  4FRM A;  4D11 A;  1H5T B;  3BCV A;  2XWN A;  1ZIZ A;  2OEG A;  4FRH A;  1JV1 A;  1WT3 A;  3RSB A;  5FTS A;  1ON6 A;  4HO0 A;  5EJZ A;  3V0O A;  3OH1 A;  4C2S A;  4NAI A;  4KNX A;  1GQC A;  2RJ8 A;  3Q7U A;  1NQI B;  1EYR A;  5AJN A;  4ARW A;  3SXG A;  1ZI5 A;  3E26 A;  3U2W A;  3USR A;  2GGQ A;  2WE9 A;  1E5K A;  2RJ5 A;  4B2W A;  4AC3 A;  1EZI A;  2P72 A;  4Y7T A;  2E8B A;  2YQS A;  4BQH A;  2YC3 A;  5CMI A;  2BO8 A;  1K4V A;  4EEO A;  3O3P A;  1QGS A;  2ZU7 A;  1GQ9 A;  1TVY A;  2PGV A;  1R7V A;  3I0C A;  4E1K A;  2A8U A;  4FRO A;  3K8E A;  4NAN A;  3K8D A;  1FOA A;  1WVC A;  2X60 A;  4B42 A;  1LL0 A;  4MND A;  1VGU A;  1G93 A;  1KWS A;  1QG8 A;  4Y63 A;  4DEC A;  4LW6 A;  2FYB A;  3USQ A;  2Z86 A;  2X5Z A;  1H5S C;  1R7X A;  1YP2 A; 
#chains in the Genus database with same CATH topology
 5D92 A;  2ICY A;  2RJ9 A;  2BO4 A;  1R7T A;  2XWL A;  3I0E A;  4FIX A;  3RMV A;  4EVW A;  2W0V A;  3TZT A;  3DJ4 A;  3DUV A;  1H7Q A;  3SXB A;  1VGZ A;  3D8V A;  4ASY A;  1LZJ A;  2CU2 A;  2OI6 A;  3TQD A;  1FR8 A;  4CVH A;  5L6S A;  2I5K A;  1GA8 A;  2WAW A;  2Y6P A;  4B2X A;  1FO9 A;  1MP4 A;  2A8W A;  4J18 A;  4Y7U A;  3BRK X;  1H5R B;  1ZJ2 A;  5C3B A;  4FRD A;  1LZI A;  4FRA A;  1G3L A;  4MIX A;  2FYA A;  1H7T A;  1JV3 A;  1ZI1 A;  1O7Q A;  5IDS A;  2XMH A;  2GGO A;  5FU0 A;  1S4N A;  1VH1 A;  4O6M A;  2OI7 A;  3CKN A;  1H5S A;  3I0F A;  4FRL A;  1G1L A;  1HV9 A;  4Y6N A;  2PA4 A;  2OI5 A;  2I5E A;  4EEA A;  5C47 A;  1LZ7 A;  4UEG A;  4HO3 A;  1FXJ A;  4EE5 A;  3I0D A;  2V0K A;  4Y6U A;  3V8Z A;  1G0R A;  1VZT A;  4CJB A;  2Q4J A;  5J49 A;  4B4B A;  5FU8 A;  3SXD A;  3Q4S A;  2VS3 A;  1ZCV A;  3R3I A;  4EEG A;  2Y7A A;  5C8R A;  1QWJ A;  3NGW A;  4Q7C A;  3JUK A;  1Z90 A;  2Y4M A;  2O1G A;  2P73 A;  2UX8 A;  4Y64 A;  3CKQ A;  2RJ4 A;  4YS8 A;  1ZCT A;  2YQC A;  3IOH A;  1LZ0 A;  4HO4 A;  2WEE A;  2OEF A;  2YC5 A;  1ZI4 A;  5D91 A;  4ZDQ A;  4FCE A;  1QGQ A;  4KQL A;  3SX7 A;  1WT2 A;  1TW1 A;  5FYE A;  2VXM A;  3SXE A;  1YRO B;  3T7O A;  1ZJ0 A;  4HO9 A;  3Q80 A;  3SX5 A;  3V90 A;  1NMM B;  2C0N A;  1NF5 B;  1GWV A;  3JTJ A;  3OC9 A;  3ZGG A;  4D0T A;  3DK5 A;  2P6W A;  2YES A;  4KPZ A;  3SPT A;  1JYK A;  1G9R A;  3QVB A;  1NKH B;  5AJO A;  5DDV A;  1YP3 A;  1V83 A;  2Z87 A;  2RIY A;  4KPX A;  5FTV A;  2FY7 A;  5C36 A;  1H5T A;  1V84 A;  2AH9 A;  4KT7 A;  2RIZ A;  3ZLL A;  5C38 A;  2WGZ A;  3SX8 A;  2BO6 A;  3OH4 A;  5C4C A;  1G8O A;  2VS4 A;  5CMJ A;  3PKQ A;  5CMF X;  3GUE A;  4NAK A;  4FQW A;  2X5S A;  3U2U A;  2XWM A;  1FR9 A;  4B4M A;  3I0H A;  1WSZ A;  3KIA A;  1W57 A;  4M28 A;  2XME A;  4B4G A;  1VGW A;  1ZI3 A;  2FFV A;  2ZU8 A;  2PGY A;  1XHB A;  4B3U A;  2JCK A;  2JCJ A;  1ZCY A;  5CQP A;  2D0J A;  3D98 A;  2RIX A;  4KRV A;  1VZX A;  3PNN A;  3V0M A;  2BO7 A;  1FO8 A;  2VS5 A;  4AYL A;  2I7B A;  4CJ8 A;  5EJ1 A;  4ECM A;  4HO8 A;  5JQQ A;  2FYD B;  2RJ0 A;  2AM4 A;  1GWW A;  2AE7 A;  5C4E A;  3OH2 A;  1W77 A;  2ICX A;  3PKP A;  1V82 A;  3OGZ A;  1H7L A;  1ZHJ A;  1FGG A;  5C1L A;  3JUJ A;  3I0I X;  5C48 A;  3HL3 A;  1H7E A;  4LW3 A;  3IOJ A;  1HM8 A;  1ZJP A;  1HM0 A;  4K6R A;  4HO6 A;  1MP3 A;  1YP4 A;  2J0A A;  4EE3 A;  2FYC B;  2Y4J A;  3I0J A;  1FGX A;  5EIY A;  5C1H A;  2VSI A;  2V0J A;  3I0G A;  1INJ A;  1R7U A;  3F1Y A;  5L6V A;  1HM9 A;  1FXO A;  4MYB A;  1NWG B;  3OKR A;  4FIY A;  5C3A A;  5CMG X;  4B5B A;  3FWW A;  1ZJ1 A;  3I0L A;  1SS9 A;  4JD0 A;  1H5R A;  3T7N A;  5C49 A;  5C3D A;  2O1H A;  5C1G A;  3E25 A;  3V0N A;  1LVW A;  5DDT A;  3CKO A;  1ZDF A;  1FG5 N;  1OQM B;  1GX0 A;  5CQM X;  3V0L A;  5CQO A;  3FOQ A;  1OMX A;  3RMW A;  4FRP A;  2PX7 A;  3SX3 A;  3CKJ A;  4Y7F A;  5CMH A;  2V0L A;  1H7G A;  1I52 A;  1ON8 A;  2Y4K A;  3V0Q A;  1H3M A;  5CQN X;  1GX4 A;  2ZU9 A;  1H7H A;  2DPW A;  2V0H A;  3T7M A;  4D48 A;  3ZLK A;  1H7F A;  1O7O A;  1PZT A;  4FRE A;  2WVK A;  4Y9X A;  1ZCU A;  1OMZ A;  4HO2 A;  4IRQ A;  4ASJ A;  5AJP A;  3U2V A;  2YQH A;  4G3S A;  2X65 A;  4KC1 A;  2AGD A;  3CGX A;  2J0B A;  2V0I A;  5C4B A;  2VFZ A;  1FWY A;  1R80 A;  5FUH A;  1O0R A;  4HO5 A;  4IRP A;  1LL3 A;  1H4D A;  1WT1 A;  4AYJ A;  1PZY B;  1G95 A;  1VGT A;  3ST8 A;  4R7P A;  3I0K A;  5IDT A;  4FRB A;  1VM8 A;  1S4P A;  3N9W A;  4XWI A;  2RJ1 A;  1JVG A;  2QKX A;  1G2V A;  4BMA A;  2VD4 A;  5C4D A;  1MC3 A;  2VSH A;  4O6N A;  4Y7V A;  1ZJO A;  5I1F A;  5HS2 A;  4L41 C;  2D7R A;  1H4C A;  4DE7 A;  2MZB A;  2WVM A;  2WVL A;  4P02 A;  4KXO A;  2NXV A;  2E3D A;  5CQL X;  4EEM A;  5BXC A;  4P00 A;  3CKV A;  2FFU A;  4G87 A;  1TZF A;  1ZDG A;  3OAM A;  3CU0 A;  1HJL A;  2VK9 A;  3V8Y A;  1VIC A;  1H5S B;  4KC4 A;  4CJC A;  2YCM A;  2QH5 A;  4D0Z A;  1VZU A;  4HG6 A;  2O1F A;  4KC2 A;  3F1C A;  4FCU A;  2D7I A;  1IIN A;  1R7Y A;  3POL A;  3OH0 A;  4AAW A;  3ZGF A;  1H4E A;  4HOC A;  2RIT A;  2QGI A;  3SXC A;  4Y62 A;  1R81 A;  1TW5 A;  3LW6 A;  4M2B A;  4KNR A;  3IOI A;  4GBP A;  4M2A A;  1S4O A;  4D11 C;  3D5N A;  1HJJ A;  1FZW A;  1VPA A;  2Y4L A;  2AM5 A;  3OH3 A;  4JIS A;  4G3P A;  4DDZ A;  3V0P A;  1XZ6 A;  3U2T A;  2JCL A;  2AM3 A;  1R82 A;  1JYL A;  2AEC A;  4FRQ A;  3EE5 A;  3U0Y A;  4NAL A;  2AES A;  2APC A;  3U2X A;  1LL2 A;  4EE4 A;  3V91 A;  1FRW A;  2VXL A;  2RJ6 A;  5FV9 A;  1O23 B;  1NHE B;  4HCQ A;  1H5S D;  1JVD A;  5IFY A;  1WT0 A;  1G23 A;  4G3Q A;  2YQJ A;  3ZF8 A;  3U0X A;  1ZJ3 A;  3SXA A;  2JCO A;  1VH3 A;  1W55 A;  3R2W A;  2RJ7 A;  1G97 A;  5C4F A;  2W0W A;  1INI A;  1IIM A;  4Y7G A;  1MP5 A;  4M4K A;  4FRM A;  4D11 A;  1H5T B;  3BCV A;  2XWN A;  1ZIZ A;  2OEG A;  4FRH A;  1JV1 A;  1WT3 A;  3RSB A;  5FTS A;  1ON6 A;  4HO0 A;  5EJZ A;  3V0O A;  3OH1 A;  4C2S A;  4NAI A;  4KNX A;  1GQC A;  2RJ8 A;  3Q7U A;  1NQI B;  1EYR A;  5AJN A;  4ARW A;  3SXG A;  1ZI5 A;  3E26 A;  3U2W A;  3USR A;  2GGQ A;  2WE9 A;  1E5K A;  2RJ5 A;  4B2W A;  4AC3 A;  1EZI A;  2P72 A;  4Y7T A;  2E8B A;  2YQS A;  4BQH A;  2YC3 A;  5CMI A;  2BO8 A;  1K4V A;  4EEO A;  3O3P A;  1QGS A;  2ZU7 A;  1GQ9 A;  1TVY A;  2PGV A;  1R7V A;  3I0C A;  4E1K A;  2A8U A;  4FRO A;  3K8E A;  4NAN A;  3K8D A;  1FOA A;  1WVC A;  2X60 A;  4B42 A;  1LL0 A;  4MND A;  1VGU A;  1G93 A;  1KWS A;  1QG8 A;  4Y63 A;  4DEC A;  4LW6 A;  2FYB A;  3USQ A;  2Z86 A;  2X5Z A;  1H5S C;  1R7X A;  1YP2 A; 
#chains in the Genus database with same CATH homology
 5D92 A;  2ICY A;  2RJ9 A;  2BO4 A;  1R7T A;  2XWL A;  3I0E A;  4FIX A;  3RMV A;  4EVW A;  2W0V A;  3TZT A;  3DJ4 A;  3DUV A;  1H7Q A;  3SXB A;  1VGZ A;  3D8V A;  4ASY A;  1LZJ A;  2CU2 A;  2OI6 A;  3TQD A;  1FR8 A;  4CVH A;  5L6S A;  2I5K A;  1GA8 A;  2WAW A;  2Y6P A;  4B2X A;  1FO9 A;  1MP4 A;  2A8W A;  4J18 A;  4Y7U A;  3BRK X;  1H5R B;  1ZJ2 A;  5C3B A;  4FRD A;  1LZI A;  4FRA A;  1G3L A;  4MIX A;  2FYA A;  1H7T A;  1JV3 A;  1ZI1 A;  1O7Q A;  5IDS A;  2XMH A;  2GGO A;  5FU0 A;  1S4N A;  1VH1 A;  4O6M A;  2OI7 A;  3CKN A;  1H5S A;  3I0F A;  4FRL A;  1G1L A;  1HV9 A;  4Y6N A;  2PA4 A;  2OI5 A;  2I5E A;  4EEA A;  5C47 A;  1LZ7 A;  4UEG A;  4HO3 A;  1FXJ A;  4EE5 A;  3I0D A;  2V0K A;  4Y6U A;  3V8Z A;  1G0R A;  1VZT A;  4CJB A;  2Q4J A;  5J49 A;  4B4B A;  5FU8 A;  3SXD A;  3Q4S A;  2VS3 A;  1ZCV A;  3R3I A;  4EEG A;  2Y7A A;  5C8R A;  1QWJ A;  3NGW A;  4Q7C A;  3JUK A;  1Z90 A;  2Y4M A;  2O1G A;  2P73 A;  2UX8 A;  4Y64 A;  3CKQ A;  2RJ4 A;  4YS8 A;  1ZCT A;  2YQC A;  3IOH A;  1LZ0 A;  4HO4 A;  2WEE A;  2OEF A;  2YC5 A;  1ZI4 A;  5D91 A;  4ZDQ A;  4FCE A;  1QGQ A;  4KQL A;  3SX7 A;  1WT2 A;  1TW1 A;  5FYE A;  2VXM A;  3SXE A;  1YRO B;  3T7O A;  1ZJ0 A;  4HO9 A;  3Q80 A;  3SX5 A;  3V90 A;  1NMM B;  2C0N A;  1NF5 B;  1GWV A;  3JTJ A;  3OC9 A;  3ZGG A;  4D0T A;  3DK5 A;  2P6W A;  2YES A;  4KPZ A;  3SPT A;  1JYK A;  1G9R A;  3QVB A;  1NKH B;  5AJO A;  5DDV A;  1YP3 A;  1V83 A;  2Z87 A;  2RIY A;  4KPX A;  5FTV A;  2FY7 A;  5C36 A;  1H5T A;  1V84 A;  2AH9 A;  4KT7 A;  2RIZ A;  3ZLL A;  5C38 A;  2WGZ A;  3SX8 A;  2BO6 A;  3OH4 A;  5C4C A;  1G8O A;  2VS4 A;  5CMJ A;  3PKQ A;  5CMF X;  3GUE A;  4NAK A;  4FQW A;  2X5S A;  3U2U A;  2XWM A;  1FR9 A;  4B4M A;  3I0H A;  1WSZ A;  3KIA A;  1W57 A;  4M28 A;  2XME A;  4B4G A;  1VGW A;  1ZI3 A;  2FFV A;  2ZU8 A;  2PGY A;  1XHB A;  4B3U A;  2JCK A;  2JCJ A;  1ZCY A;  5CQP A;  2D0J A;  3D98 A;  2RIX A;  4KRV A;  1VZX A;  3PNN A;  3V0M A;  2BO7 A;  1FO8 A;  2VS5 A;  4AYL A;  2I7B A;  4CJ8 A;  5EJ1 A;  4ECM A;  4HO8 A;  5JQQ A;  2FYD B;  2RJ0 A;  2AM4 A;  1GWW A;  2AE7 A;  5C4E A;  3OH2 A;  1W77 A;  2ICX A;  3PKP A;  1V82 A;  3OGZ A;  1H7L A;  1ZHJ A;  1FGG A;  5C1L A;  3JUJ A;  3I0I X;  5C48 A;  3HL3 A;  1H7E A;  4LW3 A;  3IOJ A;  1HM8 A;  1ZJP A;  1HM0 A;  4K6R A;  4HO6 A;  1MP3 A;  1YP4 A;  2J0A A;  4EE3 A;  2FYC B;  2Y4J A;  3I0J A;  1FGX A;  5EIY A;  5C1H A;  2VSI A;  2V0J A;  3I0G A;  1INJ A;  1R7U A;  3F1Y A;  5L6V A;  1HM9 A;  1FXO A;  4MYB A;  1NWG B;  3OKR A;  4FIY A;  5C3A A;  5CMG X;  4B5B A;  3FWW A;  1ZJ1 A;  3I0L A;  1SS9 A;  4JD0 A;  1H5R A;  3T7N A;  5C49 A;  5C3D A;  2O1H A;  5C1G A;  3E25 A;  3V0N A;  1LVW A;  5DDT A;  3CKO A;  1ZDF A;  1FG5 N;  1OQM B;  1GX0 A;  5CQM X;  3V0L A;  5CQO A;  3FOQ A;  1OMX A;  3RMW A;  4FRP A;  2PX7 A;  3SX3 A;  3CKJ A;  4Y7F A;  5CMH A;  2V0L A;  1H7G A;  1I52 A;  1ON8 A;  2Y4K A;  3V0Q A;  1H3M A;  5CQN X;  1GX4 A;  2ZU9 A;  1H7H A;  2DPW A;  2V0H A;  3T7M A;  4D48 A;  3ZLK A;  1H7F A;  1O7O A;  1PZT A;  4FRE A;  2WVK A;  4Y9X A;  1ZCU A;  1OMZ A;  4HO2 A;  4IRQ A;  4ASJ A;  5AJP A;  3U2V A;  2YQH A;  4G3S A;  2X65 A;  4KC1 A;  2AGD A;  3CGX A;  2J0B A;  2V0I A;  5C4B A;  2VFZ A;  1FWY A;  1R80 A;  5FUH A;  1O0R A;  4HO5 A;  4IRP A;  1LL3 A;  1H4D A;  1WT1 A;  4AYJ A;  1PZY B;  1G95 A;  1VGT A;  3ST8 A;  4R7P A;  3I0K A;  5IDT A;  4FRB A;  1VM8 A;  1S4P A;  3N9W A;  4XWI A;  2RJ1 A;  1JVG A;  2QKX A;  1G2V A;  4BMA A;  2VD4 A;  5C4D A;  1MC3 A;  2VSH A;  4O6N A;  4Y7V A;  1ZJO A;  5I1F A;  5HS2 A;  4L41 C;  2D7R A;  1H4C A;  4DE7 A;  2MZB A;  2WVM A;  2WVL A;  4P02 A;  4KXO A;  2NXV A;  2E3D A;  5CQL X;  4EEM A;  5BXC A;  4P00 A;  3CKV A;  2FFU A;  4G87 A;  1TZF A;  1ZDG A;  3OAM A;  3CU0 A;  1HJL A;  2VK9 A;  3V8Y A;  1VIC A;  1H5S B;  4KC4 A;  4CJC A;  2YCM A;  2QH5 A;  4D0Z A;  1VZU A;  4HG6 A;  2O1F A;  4KC2 A;  3F1C A;  4FCU A;  2D7I A;  1IIN A;  1R7Y A;  3POL A;  3OH0 A;  4AAW A;  3ZGF A;  1H4E A;  4HOC A;  2RIT A;  2QGI A;  3SXC A;  4Y62 A;  1R81 A;  1TW5 A;  3LW6 A;  4M2B A;  4KNR A;  3IOI A;  4GBP A;  4M2A A;  1S4O A;  4D11 C;  3D5N A;  1HJJ A;  1FZW A;  1VPA A;  2Y4L A;  2AM5 A;  3OH3 A;  4JIS A;  4G3P A;  4DDZ A;  3V0P A;  1XZ6 A;  3U2T A;  2JCL A;  2AM3 A;  1R82 A;  1JYL A;  2AEC A;  4FRQ A;  3EE5 A;  3U0Y A;  4NAL A;  2AES A;  2APC A;  3U2X A;  1LL2 A;  4EE4 A;  3V91 A;  1FRW A;  2VXL A;  2RJ6 A;  5FV9 A;  1O23 B;  1NHE B;  4HCQ A;  1H5S D;  1JVD A;  5IFY A;  1WT0 A;  1G23 A;  4G3Q A;  2YQJ A;  3ZF8 A;  3U0X A;  1ZJ3 A;  3SXA A;  2JCO A;  1VH3 A;  1W55 A;  3R2W A;  2RJ7 A;  1G97 A;  5C4F A;  2W0W A;  1INI A;  1IIM A;  4Y7G A;  1MP5 A;  4M4K A;  4FRM A;  4D11 A;  1H5T B;  3BCV A;  2XWN A;  1ZIZ A;  2OEG A;  4FRH A;  1JV1 A;  1WT3 A;  3RSB A;  5FTS A;  1ON6 A;  4HO0 A;  5EJZ A;  3V0O A;  3OH1 A;  4C2S A;  4NAI A;  4KNX A;  1GQC A;  2RJ8 A;  3Q7U A;  1NQI B;  1EYR A;  5AJN A;  4ARW A;  3SXG A;  1ZI5 A;  3E26 A;  3U2W A;  3USR A;  2GGQ A;  2WE9 A;  1E5K A;  2RJ5 A;  4B2W A;  4AC3 A;  1EZI A;  2P72 A;  4Y7T A;  2E8B A;  2YQS A;  4BQH A;  2YC3 A;  5CMI A;  2BO8 A;  1K4V A;  4EEO A;  3O3P A;  1QGS A;  2ZU7 A;  1GQ9 A;  1TVY A;  2PGV A;  1R7V A;  3I0C A;  4E1K A;  2A8U A;  4FRO A;  3K8E A;  4NAN A;  3K8D A;  1FOA A;  1WVC A;  2X60 A;  4B42 A;  1LL0 A;  4MND A;  1VGU A;  1G93 A;  1KWS A;  1QG8 A;  4Y63 A;  4DEC A;  4LW6 A;  2FYB A;  3USQ A;  2Z86 A;  2X5Z A;  1H5S C;  1R7X A;  1YP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...