1LL3A

Crystal structure of rabbit muscle glycogenin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
261
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSEMTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGENIN-1
publication title Crystal structure of the autocatalytic initiator of glycogen biosynthesis, glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 86
structure length 261
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1ll3A00
1FXOA 1FGGA 3I0EA 5CMFX 2Y4LA 1H5RB 1JVDA 3EE5A 1VZUA 4LW3A 3QVBA 3V0QA 2Y4KA 1HM8A 1FWYA 2RJ7A 5C47A 1HJLA 2VD4A 5AJPA 1G93A 2E8BA 3CKQA 4KRVA 4HO5A 1PZYB 3OC9A 4Y9XA 2BO6A 2XWMA 2VXLA 2FFUA 2AM4A 1HM0A 1E5KA 2YQHA 1VZTA 2AESA 2O1FA 1G23A 1ZIZA 3CKVA 1W77A 4Y7VA 2I5KA 2W0VA 3SXEA 1H7EA 5FU8A 4Y7TA 3R3IA 5CMIA 2I5EA 3U2WA 3E26A 1KWSA 4FREA 3USRA 5C3BA 3V0OA 4AYLA 2RJ0A 2NXVA 2Y4JA 1FOAA 4M2AA 1H4DA 2Y4MA 3D5NA 4EE3A 2P73A 2V0IA 4FROA 2OEFA 4MNDA 4P02A 2WGZA 3V90A 3ZF8A 4AC3A 1FRWA 3D8VA 2V0KA 4HCQA 2YQSA 1H5SB 1VPAA 3OH1A 1JV3A 4HO3A 4HG6A 4KC1A 5DDVA 1MC3A 4B2XA 3TQDA 1R7UA 3KIAA 1INIA 2PGVA 4IRQA 2AM3A 4K6RA 5C8RA 2RJ9A 3SXDA 5CMJA 3OH2A 1R7TA 4B4GA 3OAMA 3ZLKA 4E1KA 1G95A 5IDSA 2YCMA 1H7GA 1S4PA 5IFYA 5CQLX 5C1LA 5CQNX 2JCJA 5C4DA 5FYEA 4KNRA 1ON6A 1WT1A 1TW1A 4P00A 3SX3A 2XMHA 2YC5A 3TZTA 1TVYA 2YQJA 4CJ8A 2X60A 2PGYA 1H4CA 1FR8A 1O7QA 1ZJ3A 4KNXA 3I0FA 3U0YA 2WVLA 2ZU7A 5EJZA 1GWVA 1ZI1A 4NAKA 4HO6A 2O1HA 4B3UA 3NGWA 4KQLA 1H5RA 3I0KA 2JCKA 2OEGA 3V8YA 1VH3A 2OI6A 2DPWA 1ZCVA 1NMMB 4EVWA 4D48A 4Y7UA 1VGTA 3D98A 2FYBA 3SPTA 1VGWA 2WE9A 3CKJA 4G3PA 3CU0A 1NKHB 4G3SA 2RJ1A 1LZ7A 1OQMB 1R81A 3JTJA 2VSIA 3V0NA 1WT2A 2MZBA 3U2UA 2BO8A 1SS9A 1S4NA 4EEAA 4FCUA 1ZJ2A 4GBPA 5C4BA 4MYBA 1MP4A 3SX8A 5EJ1A 4EEOA 2D0JA 4LW6A 2D7RA 4DECA 2Z86A 3USQA 1V82A 1Z90A 1LL2A 4KXOA 1R7VA 4M2BA 3SXCA 2RJ8A 5C3DA 1H5SC 2ZU9A 4KT7A 1WT0A 5C4CA 5JQQA 1H3MA 4Y62A 1LL0A 4KC2A 2O1GA 4EEMA 5C3AA 1G2VA 3O3PA 4FRBA 4EE5A 3V0PA 2RJ4A 5FV9A 1O0RA 5C49A 3T7NA 1G1LA 5DDTA 1H7TA 1LVWA 1H5SA 2GGOA 3ST8A 4Y6UA 1H7HA 4ASJA 1FO8A 1QGSA 2RIXA 1O23B 3OH3A 1G97A 5BXCA 4YS8A 4B4MA 1W57A 1YP4A 2YQCA 1ZJPA 2W0WA 5FUHA 1GA8A 2VFZA 3PKQA 1YROB 1K4VA 4FRQA 1VGZA 1GX4A 1YP3A 3OH0A 3R2WA 3U0XA 3Q7UA 4XWIA 4B5BA 1ZCYA 3K8EA 4ASYA 5C4FA 2RIYA 1GQCA 1ON8A 2A8UA 2AM5A 1ZJ1A 1LZIA 1LZJA 1ZI3A 3Q4SA 1ZCUA 2WEEA 4HO9A 2FFVA 1H7FA 2ZU8A 5CQPA 5CMGX 5AJNA 4J18A 3OGZA 2ICXA 3I0GA 3I0CA 1WT3A 1IIMA 3OKRA 3SXBA 4FRDA 4C2SA 4EEGA 3F1YA 1R7YA 2VSHA 1HJJA 1R80A 5EIYA 1JYLA 3BRKX 3I0HA 4HO2A 4HO0A 3ZGGA 4CJBA 5FTVA 1ZHJA 5CMHA 2FYCB 1NWGB 2GGQA 2AECA 3FOQA 4D11C 1QGQA 2VS3A 3I0IX 1R7XA 2RJ6A 3V91A 1EYRA 2RJ5A 3RSBA 3JUJA 4D0ZA 1XZ6A 2OI7A 1VGUA 1ZJ0A 1WVCA 1FGXA 3V0LA 3GUEA 1OMXA 3CGXA 4FRLA 4NALA 4FRAA 2AH9A 1FO9A 1ZJOA 3I0JA 3U2TA 1GQ9A 1H5TB 2FYDB 3POLA 4HO8A 3OH4A 2A8WA 5FU0A 5C38A 1INJA 4D11A 4KC4A 1JVGA 3RMVA 4Y7FA 2V0LA 1R82A 4BMAA 1QWJA 3Q80A 1NHEB 5IDTA 4NAIA 2X65A 4FRHA 2PX7A 2E3DA 1V84A 4R7PA 3ZGFA 4G87A 4AYJA 1NF5B 2AGDA 1LL3A 2ICYA 1H7LA 1LZ0A 5FTSA 5C1HA 3JUKA 4KPXA 3DK5A 1IINA 1MP3A 2P72A 2XWLA 2YESA 1G8OA 3CKOA 1I52A 2UX8A 3IOJA 1PZTA 1ZDGA 5L6SA 2VS5A 2RITA 2QKXA 1YP2A 2JCLA 3I0DA 1VICA 2X5ZA 4FCEA 4HOCA 1JV1A 3IOHA 4KPZA 5J49A 4JISA 4DDZA 3SX5A 1WSZA 2Y6PA 5AJOA 1H5SD 3ZLLA 2QGIA 2YC3A 3SXGA 3LW6A 3T7MA 1ZI4A 2QH5A 2AE7A 1EZIA 2Y7AA 2PA4A 4FRPA 4D0TA 4Y6NA 2FY7A 5CQMX 3PKPA 3E25A 4JD0A 5I1FA 2Z87A 1FG5N 5C36A 2FYAA 3RMWA 2JCOA 1TZFA 3V0MA 4AAWA 5C4EA 1G0RA 4G3QA 5C1GA 1HM9A 1S4OA 2X5SA 4Y63A 4B42A 3PNNA 2XMEA 2CU2A 4M28A 4B4BA 1GX0A 1V83A 5C48A 2V0JA 3SXAA 1H7QA 2Q4JA 1H4EA 1MP5A 1ZI5A 1FXJA 2VXMA 4B2WA 1GWWA 4ARWA 3CKNA 1O7OA 2WVMA 5CQOA 4BQHA 1OMZA 3FWWA 2RIZA 5HS2A 3F1CA 3BCVA 2BO7A 1TW5A 4IRPA 1ZCTA 3I0LA 4CJCA 4EE4A 4HO4A 1XHBA 1H5TA 3DUVA 4Y7GA 2VS4A 2BO4A 4L41C 2WAWA 1VH1A 1W55A 4ECMA 2V0HA 4NANA 3U2XA 1HV9A 4UEGA 1G9RA 1NQIB 1QG8A 1FR9A 1G3LA 2I7BA 4FQWA 3IOIA 2D7IA 4CVHA 2P6WA 3N9WA 2APCA 3HL3A 3SX7A 3DJ4A 1FZWA 4Y64A 4ZDQA 3K8DA 5L6VA 1JYKA 1VZXA 2OI5A 3U2VA 3V8ZA 1ZDFA 4DE7A 2XWNA 3T7OA 4M4KA 1VM8A 2WVKA 4FRMA
chains in the Genus database with same CATH superfamily
1FXOA 1FGGA 3I0EA 5CMFX 2Y4LA 1H5RB 1JVDA 3EE5A 1VZUA 4LW3A 3QVBA 3V0QA 2Y4KA 1HM8A 1FWYA 2RJ7A 5C47A 1HJLA 2VD4A 5AJPA 1G93A 2E8BA 3CKQA 4KRVA 4HO5A 1PZYB 3OC9A 4Y9XA 2BO6A 2XWMA 2VXLA 2FFUA 2AM4A 1HM0A 1E5KA 2YQHA 1VZTA 2AESA 2O1FA 1G23A 1ZIZA 3CKVA 1W77A 4Y7VA 2I5KA 2W0VA 4O6NA 3SXEA 1H7EA 5FU8A 4Y7TA 3R3IA 5CMIA 2I5EA 3U2WA 3E26A 1KWSA 4FREA 3USRA 5C3BA 3V0OA 4AYLA 2RJ0A 2NXVA 2Y4JA 1FOAA 4M2AA 1H4DA 2Y4MA 3D5NA 4EE3A 2P73A 2V0IA 4FROA 2OEFA 4MNDA 4P02A 2WGZA 3V90A 3ZF8A 4AC3A 1FRWA 3D8VA 2V0KA 4HCQA 2YQSA 1H5SB 1VPAA 3OH1A 1JV3A 4HO3A 4HG6A 4KC1A 5DDVA 1MC3A 4B2XA 3TQDA 1R7UA 3KIAA 1INIA 2PGVA 4IRQA 2AM3A 4K6RA 5C8RA 2RJ9A 3SXDA 5CMJA 3OH2A 1R7TA 4B4GA 3OAMA 3ZLKA 4E1KA 1G95A 5IDSA 2YCMA 1H7GA 1S4PA 5IFYA 5CQLX 5C1LA 5CQNX 2JCJA 5C4DA 5FYEA 4KNRA 1ON6A 1WT1A 1TW1A 4P00A 3SX3A 2XMHA 2YC5A 3TZTA 1TVYA 2YQJA 4CJ8A 2X60A 2PGYA 1H4CA 1FR8A 1O7QA 1ZJ3A 4KNXA 3I0FA 3U0YA 2WVLA 2ZU7A 5EJZA 1GWVA 1ZI1A 4NAKA 4HO6A 2O1HA 4B3UA 3NGWA 4KQLA 1H5RA 3I0KA 2JCKA 2OEGA 3V8YA 1VH3A 2OI6A 2DPWA 1ZCVA 1NMMB 4EVWA 4D48A 4Y7UA 1VGTA 3D98A 2FYBA 3SPTA 1VGWA 2WE9A 3CKJA 4G3PA 3CU0A 1NKHB 4G3SA 2RJ1A 1LZ7A 1OQMB 1R81A 3JTJA 2VSIA 3V0NA 1WT2A 2MZBA 3U2UA 2BO8A 1SS9A 1S4NA 4EEAA 4FCUA 1ZJ2A 4GBPA 5C4BA 4MYBA 1MP4A 3SX8A 5EJ1A 4EEOA 2D0JA 4LW6A 2D7RA 4DECA 2Z86A 3USQA 1V82A 1Z90A 1LL2A 4KXOA 1R7VA 4MIXA 4M2BA 3SXCA 2RJ8A 5C3DA 1H5SC 2ZU9A 4KT7A 1WT0A 5C4CA 5JQQA 1H3MA 4Y62A 1LL0A 4KC2A 2O1GA 4EEMA 5C3AA 1G2VA 3O3PA 4FRBA 4EE5A 3V0PA 2RJ4A 5FV9A 1O0RA 5C49A 3T7NA 1G1LA 5DDTA 1H7TA 1LVWA 1H5SA 2GGOA 3ST8A 4Y6UA 1H7HA 4ASJA 1FO8A 1QGSA 2RIXA 1O23B 3OH3A 1G97A 5BXCA 4YS8A 4B4MA 1W57A 1YP4A 2J0BA 1ZJPA 2W0WA 2YQCA 5FUHA 1GA8A 2VFZA 3PKQA 1YROB 5D91A 1K4VA 4FRQA 1VGZA 1GX4A 1YP3A 3OH0A 3R2WA 3U0XA 3Q7UA 4XWIA 4B5BA 1ZCYA 3K8EA 4ASYA 5C4FA 2RIYA 1GQCA 1ON8A 2A8UA 2AM5A 1ZJ1A 1LZIA 1LZJA 1ZI3A 3Q4SA 1ZCUA 2WEEA 4HO9A 2FFVA 1H7FA 2ZU8A 5CQPA 5CMGX 5AJNA 4J18A 3OGZA 2ICXA 3I0GA 3I0CA 1WT3A 1IIMA 3OKRA 3SXBA 4FRDA 4C2SA 4EEGA 3F1YA 1R7YA 2VSHA 1HJJA 1R80A 5EIYA 1JYLA 3BRKX 3I0HA 4HO2A 4HO0A 3ZGGA 4CJBA 5FTVA 1ZHJA 2J0AA 5CMHA 2FYCB 1NWGB 2GGQA 2AECA 3FOQA 4D11C 1QGQA 2VS3A 3I0IX 1R7XA 2RJ6A 3V91A 1EYRA 2RJ5A 3RSBA 3JUJA 4D0ZA 1XZ6A 2OI7A 1VGUA 1ZJ0A 1WVCA 1FGXA 3V0LA 3GUEA 1OMXA 3CGXA 4FRLA 4NALA 4FRAA 2AH9A 1FO9A 1ZJOA 3I0JA 3U2TA 1GQ9A 1H5TB 2FYDB 3POLA 4HO8A 3OH4A 2A8WA 5FU0A 5C38A 1INJA 4D11A 4KC4A 1JVGA 3RMVA 4Y7FA 2V0LA 1R82A 4BMAA 1QWJA 3Q80A 1NHEB 5IDTA 4NAIA 2X65A 4FRHA 2PX7A 2E3DA 1V84A 4R7PA 3ZGFA 4G87A 4AYJA 1NF5B 2AGDA 1LL3A 2ICYA 1H7LA 1LZ0A 5FTSA 5C1HA 4Q7CA 3JUKA 4KPXA 3DK5A 1IINA 1MP3A 2P72A 2VK9A 2XWLA 2YESA 1G8OA 3CKOA 1I52A 2UX8A 3IOJA 1PZTA 1ZDGA 5L6SA 2VS5A 2RITA 2QKXA 1YP2A 2JCLA 3I0DA 1VICA 2X5ZA 4FCEA 4HOCA 1JV1A 3IOHA 4KPZA 5J49A 4JISA 4DDZA 3SX5A 1WSZA 2Y6PA 5AJOA 1H5SD 3ZLLA 2QGIA 2YC3A 3SXGA 3LW6A 3T7MA 1ZI4A 2QH5A 2AE7A 1EZIA 2Y7AA 2PA4A 4FRPA 4D0TA 4Y6NA 2FY7A 5CQMX 2C0NA 3PKPA 3E25A 4JD0A 5I1FA 2Z87A 1FG5N 5C36A 2FYAA 3RMWA 2JCOA 1TZFA 3V0MA 4AAWA 5C4EA 1G0RA 4G3QA 5C1GA 1HM9A 1S4OA 2X5SA 4Y63A 4B42A 3PNNA 2XMEA 2CU2A 4M28A 4B4BA 1GX0A 1V83A 5C48A 2V0JA 3SXAA 1H7QA 2Q4JA 1H4EA 1MP5A 1ZI5A 1FXJA 2VXMA 4B2WA 1GWWA 4ARWA 3CKNA 1O7OA 2WVMA 5CQOA 4BQHA 1OMZA 3FWWA 2RIZA 5HS2A 3F1CA 3BCVA 2BO7A 1TW5A 4IRPA 1ZCTA 3I0LA 4CJCA 4EE4A 4HO4A 1XHBA 1H5TA 3DUVA 4Y7GA 2VS4A 2BO4A 4L41C 2WAWA 1VH1A 1W55A 4ECMA 2V0HA 4NANA 5D92A 3U2XA 1HV9A 4UEGA 1G9RA 1NQIB 1QG8A 1FR9A 4FIYA 1G3LA 2I7BA 4FQWA 3IOIA 2D7IA 4CVHA 2P6WA 3N9WA 4O6MA 2APCA 3HL3A 3SX7A 3DJ4A 1FZWA 4Y64A 4ZDQA 3K8DA 5L6VA 1JYKA 1VZXA 2OI5A 3U2VA 3V8ZA 1ZDFA 4DE7A 4FIXA 2XWNA 3T7OA 4M4KA 1VM8A 2WVKA 4FRMA
chains in the Genus database with same CATH topology
1FXOA 1FGGA 3I0EA 5CMFX 2Y4LA 1H5RB 1JVDA 3EE5A 1VZUA 4LW3A 3QVBA 3V0QA 2Y4KA 1HM8A 1FWYA 2RJ7A 5C47A 1HJLA 2VD4A 5AJPA 1G93A 2E8BA 3CKQA 4KRVA 4HO5A 1PZYB 3OC9A 4Y9XA 2BO6A 2XWMA 2VXLA 2FFUA 2AM4A 1HM0A 1E5KA 2YQHA 1VZTA 2AESA 2O1FA 1G23A 1ZIZA 3CKVA 1W77A 4Y7VA 2I5KA 2W0VA 4O6NA 3SXEA 1H7EA 5FU8A 4Y7TA 3R3IA 5CMIA 2I5EA 3U2WA 3E26A 1KWSA 4FREA 3USRA 5C3BA 3V0OA 4AYLA 2RJ0A 2NXVA 2Y4JA 1FOAA 4M2AA 1H4DA 2Y4MA 3D5NA 4EE3A 2P73A 2V0IA 4FROA 2OEFA 4MNDA 4P02A 2WGZA 3V90A 3ZF8A 4AC3A 1FRWA 3D8VA 2V0KA 4HCQA 2YQSA 1H5SB 1VPAA 3OH1A 1JV3A 4HO3A 4HG6A 4KC1A 5DDVA 1MC3A 4B2XA 3TQDA 1R7UA 3KIAA 1INIA 2PGVA 4IRQA 2AM3A 4K6RA 5C8RA 2RJ9A 3SXDA 5CMJA 3OH2A 1R7TA 4B4GA 3OAMA 3ZLKA 4E1KA 1G95A 5IDSA 2YCMA 1H7GA 1S4PA 5IFYA 5CQLX 5C1LA 5CQNX 2JCJA 5C4DA 5FYEA 4KNRA 1ON6A 1WT1A 1TW1A 4P00A 3SX3A 2XMHA 2YC5A 3TZTA 1TVYA 2YQJA 4CJ8A 2X60A 2PGYA 1H4CA 1FR8A 1O7QA 1ZJ3A 4KNXA 3I0FA 3U0YA 2WVLA 2ZU7A 5EJZA 1GWVA 1ZI1A 4NAKA 4HO6A 2O1HA 4B3UA 3NGWA 4KQLA 1H5RA 3I0KA 2JCKA 2OEGA 3V8YA 1VH3A 2OI6A 2DPWA 1ZCVA 1NMMB 4EVWA 4D48A 4Y7UA 1VGTA 3D98A 2FYBA 3SPTA 1VGWA 2WE9A 3CKJA 4G3PA 3CU0A 1NKHB 4G3SA 2RJ1A 1LZ7A 1OQMB 1R81A 3JTJA 2VSIA 3V0NA 1WT2A 2MZBA 3U2UA 2BO8A 1SS9A 1S4NA 4EEAA 4FCUA 1ZJ2A 4GBPA 5C4BA 4MYBA 1MP4A 3SX8A 5EJ1A 4EEOA 2D0JA 4LW6A 2D7RA 4DECA 2Z86A 3USQA 1V82A 1Z90A 1LL2A 4KXOA 1R7VA 4MIXA 4M2BA 3SXCA 2RJ8A 5C3DA 1H5SC 2ZU9A 4KT7A 1WT0A 5C4CA 5JQQA 1H3MA 4Y62A 1LL0A 4KC2A 2O1GA 4EEMA 5C3AA 1G2VA 3O3PA 4FRBA 4EE5A 3V0PA 2RJ4A 5FV9A 1O0RA 5C49A 3T7NA 1G1LA 5DDTA 1H7TA 1LVWA 1H5SA 2GGOA 3ST8A 4Y6UA 1H7HA 4ASJA 1FO8A 1QGSA 2RIXA 1O23B 3OH3A 1G97A 5BXCA 4YS8A 4B4MA 1W57A 1YP4A 2J0BA 1ZJPA 2W0WA 2YQCA 5FUHA 1GA8A 2VFZA 3PKQA 1YROB 5D91A 1K4VA 4FRQA 1VGZA 1GX4A 1YP3A 3OH0A 3R2WA 3U0XA 3Q7UA 4XWIA 4B5BA 1ZCYA 3K8EA 4ASYA 5C4FA 2RIYA 1GQCA 1ON8A 2A8UA 2AM5A 1ZJ1A 1LZIA 1LZJA 1ZI3A 3Q4SA 1ZCUA 2WEEA 4HO9A 2FFVA 1H7FA 2ZU8A 5CQPA 5CMGX 5AJNA 4J18A 3OGZA 2ICXA 3I0GA 3I0CA 1WT3A 1IIMA 3OKRA 3SXBA 4FRDA 4C2SA 4EEGA 3F1YA 1R7YA 2VSHA 1HJJA 1R80A 5EIYA 1JYLA 3BRKX 3I0HA 4HO2A 4HO0A 3ZGGA 4CJBA 5FTVA 1ZHJA 2J0AA 5CMHA 2FYCB 1NWGB 2GGQA 2AECA 3FOQA 4D11C 1QGQA 2VS3A 3I0IX 1R7XA 2RJ6A 3V91A 1EYRA 2RJ5A 3RSBA 3JUJA 4D0ZA 1XZ6A 2OI7A 1VGUA 1ZJ0A 1WVCA 1FGXA 3V0LA 3GUEA 1OMXA 3CGXA 4FRLA 4NALA 4FRAA 2AH9A 1FO9A 1ZJOA 3I0JA 3U2TA 1GQ9A 1H5TB 2FYDB 3POLA 4HO8A 3OH4A 2A8WA 5FU0A 5C38A 1INJA 4D11A 4KC4A 1JVGA 3RMVA 4Y7FA 2V0LA 1R82A 4BMAA 1QWJA 3Q80A 1NHEB 5IDTA 4NAIA 2X65A 4FRHA 2PX7A 2E3DA 1V84A 4R7PA 3ZGFA 4G87A 4AYJA 1NF5B 2AGDA 1LL3A 2ICYA 1H7LA 1LZ0A 5FTSA 5C1HA 4Q7CA 3JUKA 4KPXA 3DK5A 1IINA 1MP3A 2P72A 2VK9A 2XWLA 2YESA 1G8OA 3CKOA 1I52A 2UX8A 3IOJA 1PZTA 1ZDGA 5L6SA 2VS5A 2RITA 2QKXA 1YP2A 2JCLA 3I0DA 1VICA 2X5ZA 4FCEA 4HOCA 1JV1A 3IOHA 4KPZA 5J49A 4JISA 4DDZA 3SX5A 1WSZA 2Y6PA 5AJOA 1H5SD 3ZLLA 2QGIA 2YC3A 3SXGA 3LW6A 3T7MA 1ZI4A 2QH5A 2AE7A 1EZIA 2Y7AA 2PA4A 4FRPA 4D0TA 4Y6NA 2FY7A 5CQMX 2C0NA 3PKPA 3E25A 4JD0A 5I1FA 2Z87A 1FG5N 5C36A 2FYAA 3RMWA 2JCOA 1TZFA 3V0MA 4AAWA 5C4EA 1G0RA 4G3QA 5C1GA 1HM9A 1S4OA 2X5SA 4Y63A 4B42A 3PNNA 2XMEA 2CU2A 4M28A 4B4BA 1GX0A 1V83A 5C48A 2V0JA 3SXAA 1H7QA 2Q4JA 1H4EA 1MP5A 1ZI5A 1FXJA 2VXMA 4B2WA 1GWWA 4ARWA 3CKNA 1O7OA 2WVMA 5CQOA 4BQHA 1OMZA 3FWWA 2RIZA 5HS2A 3F1CA 3BCVA 2BO7A 1TW5A 4IRPA 1ZCTA 3I0LA 4CJCA 4EE4A 4HO4A 1XHBA 1H5TA 3DUVA 4Y7GA 2VS4A 2BO4A 4L41C 2WAWA 1VH1A 1W55A 4ECMA 2V0HA 4NANA 5D92A 3U2XA 1HV9A 4UEGA 1G9RA 1NQIB 1QG8A 1FR9A 4FIYA 1G3LA 2I7BA 4FQWA 3IOIA 2D7IA 4CVHA 2P6WA 3N9WA 4O6MA 2APCA 3HL3A 3SX7A 3DJ4A 1FZWA 4Y64A 4ZDQA 3K8DA 5L6VA 1JYKA 1VZXA 2OI5A 3U2VA 3V8ZA 1ZDFA 4DE7A 4FIXA 2XWNA 3T7OA 4M4KA 1VM8A 2WVKA 4FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXO A;  1FGG A;  3I0E A;  5CMF X;  2Y4L A;  1H5R B;  1JVD A;  3EE5 A;  1VZU A;  4LW3 A;  3QVB A;  3V0Q A;  2Y4K A;  1HM8 A;  1FWY A;  2RJ7 A;  5C47 A;  1HJL A;  2VD4 A;  5AJP A;  1G93 A;  2E8B A;  3CKQ A;  4KRV A;  4HO5 A;  1PZY B;  3OC9 A;  4Y9X A;  2BO6 A;  2XWM A;  2VXL A;  2FFU A;  2AM4 A;  1HM0 A;  1E5K A;  2YQH A;  1VZT A;  2AES A;  2O1F A;  1G23 A;  1ZIZ A;  3CKV A;  1W77 A;  4Y7V A;  2I5K A;  2W0V A;  3SXE A;  1H7E A;  5FU8 A;  4Y7T A;  3R3I A;  5CMI A;  2I5E A;  3U2W A;  3E26 A;  1KWS A;  4FRE A;  3USR A;  5C3B A;  3V0O A;  4AYL A;  2RJ0 A;  2NXV A;  2Y4J A;  1FOA A;  4M2A A;  1H4D A;  2Y4M A;  3D5N A;  4EE3 A;  2P73 A;  2V0I A;  4FRO A;  2OEF A;  4MND A;  4P02 A;  2WGZ A;  3V90 A;  3ZF8 A;  4AC3 A;  1FRW A;  3D8V A;  2V0K A;  4HCQ A;  2YQS A;  1H5S B;  1VPA A;  3OH1 A;  1JV3 A;  4HO3 A;  4HG6 A;  4KC1 A;  5DDV A;  1MC3 A;  4B2X A;  3TQD A;  1R7U A;  3KIA A;  1INI A;  2PGV A;  4IRQ A;  2AM3 A;  4K6R A;  5C8R A;  2RJ9 A;  3SXD A;  5CMJ A;  3OH2 A;  1R7T A;  4B4G A;  3OAM A;  3ZLK A;  4E1K A;  1G95 A;  5IDS A;  2YCM A;  1H7G A;  1S4P A;  5IFY A;  5CQL X;  5C1L A;  5CQN X;  2JCJ A;  5C4D A;  5FYE A;  4KNR A;  1ON6 A;  1WT1 A;  1TW1 A;  4P00 A;  3SX3 A;  2XMH A;  2YC5 A;  3TZT A;  1TVY A;  2YQJ A;  4CJ8 A;  2X60 A;  2PGY A;  1H4C A;  1FR8 A;  1O7Q A;  1ZJ3 A;  4KNX A;  3I0F A;  3U0Y A;  2WVL A;  2ZU7 A;  5EJZ A;  1GWV A;  1ZI1 A;  4NAK A;  4HO6 A;  2O1H A;  4B3U A;  3NGW A;  4KQL A;  1H5R A;  3I0K A;  2JCK A;  2OEG A;  3V8Y A;  1VH3 A;  2OI6 A;  2DPW A;  1ZCV A;  1NMM B;  4EVW A;  4D48 A;  4Y7U A;  1VGT A;  3D98 A;  2FYB A;  3SPT A;  1VGW A;  2WE9 A;  3CKJ A;  4G3P A;  3CU0 A;  1NKH B;  4G3S A;  2RJ1 A;  1LZ7 A;  1OQM B;  1R81 A;  3JTJ A;  2VSI A;  3V0N A;  1WT2 A;  2MZB A;  3U2U A;  2BO8 A;  1SS9 A;  1S4N A;  4EEA A;  4FCU A;  1ZJ2 A;  4GBP A;  5C4B A;  4MYB A;  1MP4 A;  3SX8 A;  5EJ1 A;  4EEO A;  2D0J A;  4LW6 A;  2D7R A;  4DEC A;  2Z86 A;  3USQ A;  1V82 A;  1Z90 A;  1LL2 A;  4KXO A;  1R7V A;  4M2B A;  3SXC A;  2RJ8 A;  5C3D A;  1H5S C;  2ZU9 A;  4KT7 A;  1WT0 A;  5C4C A;  5JQQ A;  1H3M A;  4Y62 A;  1LL0 A;  4KC2 A;  2O1G A;  4EEM A;  5C3A A;  1G2V A;  3O3P A;  4FRB A;  4EE5 A;  3V0P A;  2RJ4 A;  5FV9 A;  1O0R A;  5C49 A;  3T7N A;  1G1L A;  5DDT A;  1H7T A;  1LVW A;  1H5S A;  2GGO A;  3ST8 A;  4Y6U A;  1H7H A;  4ASJ A;  1FO8 A;  1QGS A;  2RIX A;  1O23 B;  3OH3 A;  1G97 A;  5BXC A;  4YS8 A;  4B4M A;  1W57 A;  1YP4 A;  2YQC A;  1ZJP A;  2W0W A;  5FUH A;  1GA8 A;  2VFZ A;  3PKQ A;  1YRO B;  1K4V A;  4FRQ A;  1VGZ A;  1GX4 A;  1YP3 A;  3OH0 A;  3R2W A;  3U0X A;  3Q7U A;  4XWI A;  4B5B A;  1ZCY A;  3K8E A;  4ASY A;  5C4F A;  2RIY A;  1GQC A;  1ON8 A;  2A8U A;  2AM5 A;  1ZJ1 A;  1LZI A;  1LZJ A;  1ZI3 A;  3Q4S A;  1ZCU A;  2WEE A;  4HO9 A;  2FFV A;  1H7F A;  2ZU8 A;  5CQP A;  5CMG X;  5AJN A;  4J18 A;  3OGZ A;  2ICX A;  3I0G A;  3I0C A;  1WT3 A;  1IIM A;  3OKR A;  3SXB A;  4FRD A;  4C2S A;  4EEG A;  3F1Y A;  1R7Y A;  2VSH A;  1HJJ A;  1R80 A;  5EIY A;  1JYL A;  3BRK X;  3I0H A;  4HO2 A;  4HO0 A;  3ZGG A;  4CJB A;  5FTV A;  1ZHJ A;  5CMH A;  2FYC B;  1NWG B;  2GGQ A;  2AEC A;  3FOQ A;  4D11 C;  1QGQ A;  2VS3 A;  3I0I X;  1R7X A;  2RJ6 A;  3V91 A;  1EYR A;  2RJ5 A;  3RSB A;  3JUJ A;  4D0Z A;  1XZ6 A;  2OI7 A;  1VGU A;  1ZJ0 A;  1WVC A;  1FGX A;  3V0L A;  3GUE A;  1OMX A;  3CGX A;  4FRL A;  4NAL A;  4FRA A;  2AH9 A;  1FO9 A;  1ZJO A;  3I0J A;  3U2T A;  1GQ9 A;  1H5T B;  2FYD B;  3POL A;  4HO8 A;  3OH4 A;  2A8W A;  5FU0 A;  5C38 A;  1INJ A;  4D11 A;  4KC4 A;  1JVG A;  3RMV A;  4Y7F A;  2V0L A;  1R82 A;  4BMA A;  1QWJ A;  3Q80 A;  1NHE B;  5IDT A;  4NAI A;  2X65 A;  4FRH A;  2PX7 A;  2E3D A;  1V84 A;  4R7P A;  3ZGF A;  4G87 A;  4AYJ A;  1NF5 B;  2AGD A;  1LL3 A;  2ICY A;  1H7L A;  1LZ0 A;  5FTS A;  5C1H A;  3JUK A;  4KPX A;  3DK5 A;  1IIN A;  1MP3 A;  2P72 A;  2XWL A;  2YES A;  1G8O A;  3CKO A;  1I52 A;  2UX8 A;  3IOJ A;  1PZT A;  1ZDG A;  5L6S A;  2VS5 A;  2RIT A;  2QKX A;  1YP2 A;  2JCL A;  3I0D A;  1VIC A;  2X5Z A;  4FCE A;  4HOC A;  1JV1 A;  3IOH A;  4KPZ A;  5J49 A;  4JIS A;  4DDZ A;  3SX5 A;  1WSZ A;  2Y6P A;  5AJO A;  1H5S D;  3ZLL A;  2QGI A;  2YC3 A;  3SXG A;  3LW6 A;  3T7M A;  1ZI4 A;  2QH5 A;  2AE7 A;  1EZI A;  2Y7A A;  2PA4 A;  4FRP A;  4D0T A;  4Y6N A;  2FY7 A;  5CQM X;  3PKP A;  3E25 A;  4JD0 A;  5I1F A;  2Z87 A;  1FG5 N;  5C36 A;  2FYA A;  3RMW A;  2JCO A;  1TZF A;  3V0M A;  4AAW A;  5C4E A;  1G0R A;  4G3Q A;  5C1G A;  1HM9 A;  1S4O A;  2X5S A;  4Y63 A;  4B42 A;  3PNN A;  2XME A;  2CU2 A;  4M28 A;  4B4B A;  1GX0 A;  1V83 A;  5C48 A;  2V0J A;  3SXA A;  1H7Q A;  2Q4J A;  1H4E A;  1MP5 A;  1ZI5 A;  1FXJ A;  2VXM A;  4B2W A;  1GWW A;  4ARW A;  3CKN A;  1O7O A;  2WVM A;  5CQO A;  4BQH A;  1OMZ A;  3FWW A;  2RIZ A;  5HS2 A;  3F1C A;  3BCV A;  2BO7 A;  1TW5 A;  4IRP A;  1ZCT A;  3I0L A;  4CJC A;  4EE4 A;  4HO4 A;  1XHB A;  1H5T A;  3DUV A;  4Y7G A;  2VS4 A;  2BO4 A;  4L41 C;  2WAW A;  1VH1 A;  1W55 A;  4ECM A;  2V0H A;  4NAN A;  3U2X A;  1HV9 A;  4UEG A;  1G9R A;  1NQI B;  1QG8 A;  1FR9 A;  1G3L A;  2I7B A;  4FQW A;  3IOI A;  2D7I A;  4CVH A;  2P6W A;  3N9W A;  2APC A;  3HL3 A;  3SX7 A;  3DJ4 A;  1FZW A;  4Y64 A;  4ZDQ A;  3K8D A;  5L6V A;  1JYK A;  1VZX A;  2OI5 A;  3U2V A;  3V8Z A;  1ZDF A;  4DE7 A;  2XWN A;  3T7O A;  4M4K A;  1VM8 A;  2WVK A;  4FRM A; 
#chains in the Genus database with same CATH topology
 1FXO A;  1FGG A;  3I0E A;  5CMF X;  2Y4L A;  1H5R B;  1JVD A;  3EE5 A;  1VZU A;  4LW3 A;  3QVB A;  3V0Q A;  2Y4K A;  1HM8 A;  1FWY A;  2RJ7 A;  5C47 A;  1HJL A;  2VD4 A;  5AJP A;  1G93 A;  2E8B A;  3CKQ A;  4KRV A;  4HO5 A;  1PZY B;  3OC9 A;  4Y9X A;  2BO6 A;  2XWM A;  2VXL A;  2FFU A;  2AM4 A;  1HM0 A;  1E5K A;  2YQH A;  1VZT A;  2AES A;  2O1F A;  1G23 A;  1ZIZ A;  3CKV A;  1W77 A;  4Y7V A;  2I5K A;  2W0V A;  4O6N A;  3SXE A;  1H7E A;  5FU8 A;  4Y7T A;  3R3I A;  5CMI A;  2I5E A;  3U2W A;  3E26 A;  1KWS A;  4FRE A;  3USR A;  5C3B A;  3V0O A;  4AYL A;  2RJ0 A;  2NXV A;  2Y4J A;  1FOA A;  4M2A A;  1H4D A;  2Y4M A;  3D5N A;  4EE3 A;  2P73 A;  2V0I A;  4FRO A;  2OEF A;  4MND A;  4P02 A;  2WGZ A;  3V90 A;  3ZF8 A;  4AC3 A;  1FRW A;  3D8V A;  2V0K A;  4HCQ A;  2YQS A;  1H5S B;  1VPA A;  3OH1 A;  1JV3 A;  4HO3 A;  4HG6 A;  4KC1 A;  5DDV A;  1MC3 A;  4B2X A;  3TQD A;  1R7U A;  3KIA A;  1INI A;  2PGV A;  4IRQ A;  2AM3 A;  4K6R A;  5C8R A;  2RJ9 A;  3SXD A;  5CMJ A;  3OH2 A;  1R7T A;  4B4G A;  3OAM A;  3ZLK A;  4E1K A;  1G95 A;  5IDS A;  2YCM A;  1H7G A;  1S4P A;  5IFY A;  5CQL X;  5C1L A;  5CQN X;  2JCJ A;  5C4D A;  5FYE A;  4KNR A;  1ON6 A;  1WT1 A;  1TW1 A;  4P00 A;  3SX3 A;  2XMH A;  2YC5 A;  3TZT A;  1TVY A;  2YQJ A;  4CJ8 A;  2X60 A;  2PGY A;  1H4C A;  1FR8 A;  1O7Q A;  1ZJ3 A;  4KNX A;  3I0F A;  3U0Y A;  2WVL A;  2ZU7 A;  5EJZ A;  1GWV A;  1ZI1 A;  4NAK A;  4HO6 A;  2O1H A;  4B3U A;  3NGW A;  4KQL A;  1H5R A;  3I0K A;  2JCK A;  2OEG A;  3V8Y A;  1VH3 A;  2OI6 A;  2DPW A;  1ZCV A;  1NMM B;  4EVW A;  4D48 A;  4Y7U A;  1VGT A;  3D98 A;  2FYB A;  3SPT A;  1VGW A;  2WE9 A;  3CKJ A;  4G3P A;  3CU0 A;  1NKH B;  4G3S A;  2RJ1 A;  1LZ7 A;  1OQM B;  1R81 A;  3JTJ A;  2VSI A;  3V0N A;  1WT2 A;  2MZB A;  3U2U A;  2BO8 A;  1SS9 A;  1S4N A;  4EEA A;  4FCU A;  1ZJ2 A;  4GBP A;  5C4B A;  4MYB A;  1MP4 A;  3SX8 A;  5EJ1 A;  4EEO A;  2D0J A;  4LW6 A;  2D7R A;  4DEC A;  2Z86 A;  3USQ A;  1V82 A;  1Z90 A;  1LL2 A;  4KXO A;  1R7V A;  4MIX A;  4M2B A;  3SXC A;  2RJ8 A;  5C3D A;  1H5S C;  2ZU9 A;  4KT7 A;  1WT0 A;  5C4C A;  5JQQ A;  1H3M A;  4Y62 A;  1LL0 A;  4KC2 A;  2O1G A;  4EEM A;  5C3A A;  1G2V A;  3O3P A;  4FRB A;  4EE5 A;  3V0P A;  2RJ4 A;  5FV9 A;  1O0R A;  5C49 A;  3T7N A;  1G1L A;  5DDT A;  1H7T A;  1LVW A;  1H5S A;  2GGO A;  3ST8 A;  4Y6U A;  1H7H A;  4ASJ A;  1FO8 A;  1QGS A;  2RIX A;  1O23 B;  3OH3 A;  1G97 A;  5BXC A;  4YS8 A;  4B4M A;  1W57 A;  1YP4 A;  2J0B A;  1ZJP A;  2W0W A;  2YQC A;  5FUH A;  1GA8 A;  2VFZ A;  3PKQ A;  1YRO B;  5D91 A;  1K4V A;  4FRQ A;  1VGZ A;  1GX4 A;  1YP3 A;  3OH0 A;  3R2W A;  3U0X A;  3Q7U A;  4XWI A;  4B5B A;  1ZCY A;  3K8E A;  4ASY A;  5C4F A;  2RIY A;  1GQC A;  1ON8 A;  2A8U A;  2AM5 A;  1ZJ1 A;  1LZI A;  1LZJ A;  1ZI3 A;  3Q4S A;  1ZCU A;  2WEE A;  4HO9 A;  2FFV A;  1H7F A;  2ZU8 A;  5CQP A;  5CMG X;  5AJN A;  4J18 A;  3OGZ A;  2ICX A;  3I0G A;  3I0C A;  1WT3 A;  1IIM A;  3OKR A;  3SXB A;  4FRD A;  4C2S A;  4EEG A;  3F1Y A;  1R7Y A;  2VSH A;  1HJJ A;  1R80 A;  5EIY A;  1JYL A;  3BRK X;  3I0H A;  4HO2 A;  4HO0 A;  3ZGG A;  4CJB A;  5FTV A;  1ZHJ A;  2J0A A;  5CMH A;  2FYC B;  1NWG B;  2GGQ A;  2AEC A;  3FOQ A;  4D11 C;  1QGQ A;  2VS3 A;  3I0I X;  1R7X A;  2RJ6 A;  3V91 A;  1EYR A;  2RJ5 A;  3RSB A;  3JUJ A;  4D0Z A;  1XZ6 A;  2OI7 A;  1VGU A;  1ZJ0 A;  1WVC A;  1FGX A;  3V0L A;  3GUE A;  1OMX A;  3CGX A;  4FRL A;  4NAL A;  4FRA A;  2AH9 A;  1FO9 A;  1ZJO A;  3I0J A;  3U2T A;  1GQ9 A;  1H5T B;  2FYD B;  3POL A;  4HO8 A;  3OH4 A;  2A8W A;  5FU0 A;  5C38 A;  1INJ A;  4D11 A;  4KC4 A;  1JVG A;  3RMV A;  4Y7F A;  2V0L A;  1R82 A;  4BMA A;  1QWJ A;  3Q80 A;  1NHE B;  5IDT A;  4NAI A;  2X65 A;  4FRH A;  2PX7 A;  2E3D A;  1V84 A;  4R7P A;  3ZGF A;  4G87 A;  4AYJ A;  1NF5 B;  2AGD A;  1LL3 A;  2ICY A;  1H7L A;  1LZ0 A;  5FTS A;  5C1H A;  4Q7C A;  3JUK A;  4KPX A;  3DK5 A;  1IIN A;  1MP3 A;  2P72 A;  2VK9 A;  2XWL A;  2YES A;  1G8O A;  3CKO A;  1I52 A;  2UX8 A;  3IOJ A;  1PZT A;  1ZDG A;  5L6S A;  2VS5 A;  2RIT A;  2QKX A;  1YP2 A;  2JCL A;  3I0D A;  1VIC A;  2X5Z A;  4FCE A;  4HOC A;  1JV1 A;  3IOH A;  4KPZ A;  5J49 A;  4JIS A;  4DDZ A;  3SX5 A;  1WSZ A;  2Y6P A;  5AJO A;  1H5S D;  3ZLL A;  2QGI A;  2YC3 A;  3SXG A;  3LW6 A;  3T7M A;  1ZI4 A;  2QH5 A;  2AE7 A;  1EZI A;  2Y7A A;  2PA4 A;  4FRP A;  4D0T A;  4Y6N A;  2FY7 A;  5CQM X;  2C0N A;  3PKP A;  3E25 A;  4JD0 A;  5I1F A;  2Z87 A;  1FG5 N;  5C36 A;  2FYA A;  3RMW A;  2JCO A;  1TZF A;  3V0M A;  4AAW A;  5C4E A;  1G0R A;  4G3Q A;  5C1G A;  1HM9 A;  1S4O A;  2X5S A;  4Y63 A;  4B42 A;  3PNN A;  2XME A;  2CU2 A;  4M28 A;  4B4B A;  1GX0 A;  1V83 A;  5C48 A;  2V0J A;  3SXA A;  1H7Q A;  2Q4J A;  1H4E A;  1MP5 A;  1ZI5 A;  1FXJ A;  2VXM A;  4B2W A;  1GWW A;  4ARW A;  3CKN A;  1O7O A;  2WVM A;  5CQO A;  4BQH A;  1OMZ A;  3FWW A;  2RIZ A;  5HS2 A;  3F1C A;  3BCV A;  2BO7 A;  1TW5 A;  4IRP A;  1ZCT A;  3I0L A;  4CJC A;  4EE4 A;  4HO4 A;  1XHB A;  1H5T A;  3DUV A;  4Y7G A;  2VS4 A;  2BO4 A;  4L41 C;  2WAW A;  1VH1 A;  1W55 A;  4ECM A;  2V0H A;  4NAN A;  5D92 A;  3U2X A;  1HV9 A;  4UEG A;  1G9R A;  1NQI B;  1QG8 A;  1FR9 A;  4FIY A;  1G3L A;  2I7B A;  4FQW A;  3IOI A;  2D7I A;  4CVH A;  2P6W A;  3N9W A;  4O6M A;  2APC A;  3HL3 A;  3SX7 A;  3DJ4 A;  1FZW A;  4Y64 A;  4ZDQ A;  3K8D A;  5L6V A;  1JYK A;  1VZX A;  2OI5 A;  3U2V A;  3V8Z A;  1ZDF A;  4DE7 A;  4FIX A;  2XWN A;  3T7O A;  4M4K A;  1VM8 A;  2WVK A;  4FRM A; 
#chains in the Genus database with same CATH homology
 1FXO A;  1FGG A;  3I0E A;  5CMF X;  2Y4L A;  1H5R B;  1JVD A;  3EE5 A;  1VZU A;  4LW3 A;  3QVB A;  3V0Q A;  2Y4K A;  1HM8 A;  1FWY A;  2RJ7 A;  5C47 A;  1HJL A;  2VD4 A;  5AJP A;  1G93 A;  2E8B A;  3CKQ A;  4KRV A;  4HO5 A;  1PZY B;  3OC9 A;  4Y9X A;  2BO6 A;  2XWM A;  2VXL A;  2FFU A;  2AM4 A;  1HM0 A;  1E5K A;  2YQH A;  1VZT A;  2AES A;  2O1F A;  1G23 A;  1ZIZ A;  3CKV A;  1W77 A;  4Y7V A;  2I5K A;  2W0V A;  4O6N A;  3SXE A;  1H7E A;  5FU8 A;  4Y7T A;  3R3I A;  5CMI A;  2I5E A;  3U2W A;  3E26 A;  1KWS A;  4FRE A;  3USR A;  5C3B A;  3V0O A;  4AYL A;  2RJ0 A;  2NXV A;  2Y4J A;  1FOA A;  4M2A A;  1H4D A;  2Y4M A;  3D5N A;  4EE3 A;  2P73 A;  2V0I A;  4FRO A;  2OEF A;  4MND A;  4P02 A;  2WGZ A;  3V90 A;  3ZF8 A;  4AC3 A;  1FRW A;  3D8V A;  2V0K A;  4HCQ A;  2YQS A;  1H5S B;  1VPA A;  3OH1 A;  1JV3 A;  4HO3 A;  4HG6 A;  4KC1 A;  5DDV A;  1MC3 A;  4B2X A;  3TQD A;  1R7U A;  3KIA A;  1INI A;  2PGV A;  4IRQ A;  2AM3 A;  4K6R A;  5C8R A;  2RJ9 A;  3SXD A;  5CMJ A;  3OH2 A;  1R7T A;  4B4G A;  3OAM A;  3ZLK A;  4E1K A;  1G95 A;  5IDS A;  2YCM A;  1H7G A;  1S4P A;  5IFY A;  5CQL X;  5C1L A;  5CQN X;  2JCJ A;  5C4D A;  5FYE A;  4KNR A;  1ON6 A;  1WT1 A;  1TW1 A;  4P00 A;  3SX3 A;  2XMH A;  2YC5 A;  3TZT A;  1TVY A;  2YQJ A;  4CJ8 A;  2X60 A;  2PGY A;  1H4C A;  1FR8 A;  1O7Q A;  1ZJ3 A;  4KNX A;  3I0F A;  3U0Y A;  2WVL A;  2ZU7 A;  5EJZ A;  1GWV A;  1ZI1 A;  4NAK A;  4HO6 A;  2O1H A;  4B3U A;  3NGW A;  4KQL A;  1H5R A;  3I0K A;  2JCK A;  2OEG A;  3V8Y A;  1VH3 A;  2OI6 A;  2DPW A;  1ZCV A;  1NMM B;  4EVW A;  4D48 A;  4Y7U A;  1VGT A;  3D98 A;  2FYB A;  3SPT A;  1VGW A;  2WE9 A;  3CKJ A;  4G3P A;  3CU0 A;  1NKH B;  4G3S A;  2RJ1 A;  1LZ7 A;  1OQM B;  1R81 A;  3JTJ A;  2VSI A;  3V0N A;  1WT2 A;  2MZB A;  3U2U A;  2BO8 A;  1SS9 A;  1S4N A;  4EEA A;  4FCU A;  1ZJ2 A;  4GBP A;  5C4B A;  4MYB A;  1MP4 A;  3SX8 A;  5EJ1 A;  4EEO A;  2D0J A;  4LW6 A;  2D7R A;  4DEC A;  2Z86 A;  3USQ A;  1V82 A;  1Z90 A;  1LL2 A;  4KXO A;  1R7V A;  4MIX A;  4M2B A;  3SXC A;  2RJ8 A;  5C3D A;  1H5S C;  2ZU9 A;  4KT7 A;  1WT0 A;  5C4C A;  5JQQ A;  1H3M A;  4Y62 A;  1LL0 A;  4KC2 A;  2O1G A;  4EEM A;  5C3A A;  1G2V A;  3O3P A;  4FRB A;  4EE5 A;  3V0P A;  2RJ4 A;  5FV9 A;  1O0R A;  5C49 A;  3T7N A;  1G1L A;  5DDT A;  1H7T A;  1LVW A;  1H5S A;  2GGO A;  3ST8 A;  4Y6U A;  1H7H A;  4ASJ A;  1FO8 A;  1QGS A;  2RIX A;  1O23 B;  3OH3 A;  1G97 A;  5BXC A;  4YS8 A;  4B4M A;  1W57 A;  1YP4 A;  2J0B A;  1ZJP A;  2W0W A;  2YQC A;  5FUH A;  1GA8 A;  2VFZ A;  3PKQ A;  1YRO B;  5D91 A;  1K4V A;  4FRQ A;  1VGZ A;  1GX4 A;  1YP3 A;  3OH0 A;  3R2W A;  3U0X A;  3Q7U A;  4XWI A;  4B5B A;  1ZCY A;  3K8E A;  4ASY A;  5C4F A;  2RIY A;  1GQC A;  1ON8 A;  2A8U A;  2AM5 A;  1ZJ1 A;  1LZI A;  1LZJ A;  1ZI3 A;  3Q4S A;  1ZCU A;  2WEE A;  4HO9 A;  2FFV A;  1H7F A;  2ZU8 A;  5CQP A;  5CMG X;  5AJN A;  4J18 A;  3OGZ A;  2ICX A;  3I0G A;  3I0C A;  1WT3 A;  1IIM A;  3OKR A;  3SXB A;  4FRD A;  4C2S A;  4EEG A;  3F1Y A;  1R7Y A;  2VSH A;  1HJJ A;  1R80 A;  5EIY A;  1JYL A;  3BRK X;  3I0H A;  4HO2 A;  4HO0 A;  3ZGG A;  4CJB A;  5FTV A;  1ZHJ A;  2J0A A;  5CMH A;  2FYC B;  1NWG B;  2GGQ A;  2AEC A;  3FOQ A;  4D11 C;  1QGQ A;  2VS3 A;  3I0I X;  1R7X A;  2RJ6 A;  3V91 A;  1EYR A;  2RJ5 A;  3RSB A;  3JUJ A;  4D0Z A;  1XZ6 A;  2OI7 A;  1VGU A;  1ZJ0 A;  1WVC A;  1FGX A;  3V0L A;  3GUE A;  1OMX A;  3CGX A;  4FRL A;  4NAL A;  4FRA A;  2AH9 A;  1FO9 A;  1ZJO A;  3I0J A;  3U2T A;  1GQ9 A;  1H5T B;  2FYD B;  3POL A;  4HO8 A;  3OH4 A;  2A8W A;  5FU0 A;  5C38 A;  1INJ A;  4D11 A;  4KC4 A;  1JVG A;  3RMV A;  4Y7F A;  2V0L A;  1R82 A;  4BMA A;  1QWJ A;  3Q80 A;  1NHE B;  5IDT A;  4NAI A;  2X65 A;  4FRH A;  2PX7 A;  2E3D A;  1V84 A;  4R7P A;  3ZGF A;  4G87 A;  4AYJ A;  1NF5 B;  2AGD A;  1LL3 A;  2ICY A;  1H7L A;  1LZ0 A;  5FTS A;  5C1H A;  4Q7C A;  3JUK A;  4KPX A;  3DK5 A;  1IIN A;  1MP3 A;  2P72 A;  2VK9 A;  2XWL A;  2YES A;  1G8O A;  3CKO A;  1I52 A;  2UX8 A;  3IOJ A;  1PZT A;  1ZDG A;  5L6S A;  2VS5 A;  2RIT A;  2QKX A;  1YP2 A;  2JCL A;  3I0D A;  1VIC A;  2X5Z A;  4FCE A;  4HOC A;  1JV1 A;  3IOH A;  4KPZ A;  5J49 A;  4JIS A;  4DDZ A;  3SX5 A;  1WSZ A;  2Y6P A;  5AJO A;  1H5S D;  3ZLL A;  2QGI A;  2YC3 A;  3SXG A;  3LW6 A;  3T7M A;  1ZI4 A;  2QH5 A;  2AE7 A;  1EZI A;  2Y7A A;  2PA4 A;  4FRP A;  4D0T A;  4Y6N A;  2FY7 A;  5CQM X;  2C0N A;  3PKP A;  3E25 A;  4JD0 A;  5I1F A;  2Z87 A;  1FG5 N;  5C36 A;  2FYA A;  3RMW A;  2JCO A;  1TZF A;  3V0M A;  4AAW A;  5C4E A;  1G0R A;  4G3Q A;  5C1G A;  1HM9 A;  1S4O A;  2X5S A;  4Y63 A;  4B42 A;  3PNN A;  2XME A;  2CU2 A;  4M28 A;  4B4B A;  1GX0 A;  1V83 A;  5C48 A;  2V0J A;  3SXA A;  1H7Q A;  2Q4J A;  1H4E A;  1MP5 A;  1ZI5 A;  1FXJ A;  2VXM A;  4B2W A;  1GWW A;  4ARW A;  3CKN A;  1O7O A;  2WVM A;  5CQO A;  4BQH A;  1OMZ A;  3FWW A;  2RIZ A;  5HS2 A;  3F1C A;  3BCV A;  2BO7 A;  1TW5 A;  4IRP A;  1ZCT A;  3I0L A;  4CJC A;  4EE4 A;  4HO4 A;  1XHB A;  1H5T A;  3DUV A;  4Y7G A;  2VS4 A;  2BO4 A;  4L41 C;  2WAW A;  1VH1 A;  1W55 A;  4ECM A;  2V0H A;  4NAN A;  5D92 A;  3U2X A;  1HV9 A;  4UEG A;  1G9R A;  1NQI B;  1QG8 A;  1FR9 A;  4FIY A;  1G3L A;  2I7B A;  4FQW A;  3IOI A;  2D7I A;  4CVH A;  2P6W A;  3N9W A;  4O6M A;  2APC A;  3HL3 A;  3SX7 A;  3DJ4 A;  1FZW A;  4Y64 A;  4ZDQ A;  3K8D A;  5L6V A;  1JYK A;  1VZX A;  2OI5 A;  3U2V A;  3V8Z A;  1ZDF A;  4DE7 A;  4FIX A;  2XWN A;  3T7O A;  4M4K A;  1VM8 A;  2WVK A;  4FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...