4EVWA

Crystal structure of the nucleoside-diphosphate-sugar pyrophosphorylase from vibrio cholerae rc9. northeast structural genomics consortium (nesg) target vcr193.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
244
structure length
244
Chain Sequence
MIVIPMAGMSSRFFKAGYTQPKYMLEAHGQTLFEHSVNSFAAYFASTPFLFIVRNVYDTAVFVREKATQLGIKQFYIAELHTETRGQAETVTLGLEELAKQGVDYQGSITVFNIDTFRPNFVFPDISQHSDGYLEVFQGGGDNWSFAKPEHAGSTKVIQTAEKNPISDLCSTGLYHFNRKEDYLEAYREYVARPSQEWERGELYIAPLYNELIQKGLNIHYHLIARHEVIFCGVPDEYTDFLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside-diphosphate-sugar pyrophosphorylase
publication title Crystal Structure of the nucleoside-diphosphate-sugar pyrophosphorylase from Vibrio cholerae RC9.
rcsb
source organism Vibrio cholerae
total genus 72
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4evwA00
2Z87A 1TW1A 1V82A 4D11A 2OI6A 4FRLA 2RJ5A 2PGYA 3SXBA 3V8YA 1QGSA 3E26A 2XWMA 3Q4SA 4FRHA 3CU0A 2BO6A 2YCMA 3DK5A 2WEEA 1S4NA 5CMHA 3SPTA 4ECMA 1GA8A 3FWWA 2PGVA 1H7EA 2FYCB 4JISA 5AJNA 4D11C 2AE7A 2OEGA 3OGZA 4HCQA 2VFZA 1XHBA 1LL2A 1ON6A 4KPZA 5CMJA 5C1HA 3V91A 5JQQA 1G8OA 4ASYA 4YS8A 5C1LA 3PNNA 3OAMA 1SS9A 2OI7A 2Q4JA 2X5ZA 1H5RA 1H7FA 1YP4A 4B2WA 1VGZA 4Y7FA 1PZYB 3I0IX 4FQWA 4AAWA 3V0LA 4J18A 4M28A 5EJZA 1R7VA 4B42A 4EE3A 3QVBA 1ZDGA 1G93A 2JCOA 5C4CA 2X60A 4Y6UA 3GUEA 2V0HA 4MNDA 2Y4KA 3IOHA 1ON8A 4B4GA 1W57A 3CKJA 1FXOA 4KQLA 2DPWA 1JVDA 1ZCTA 4M2AA 1H5TA 1R81A 4AC3A 2FYDB 1HM8A 2AM3A 3PKQA 2W0VA 5C49A 2WGZA 1R7UA 5L6SA 3U2VA 2O1FA 1R82A 2V0KA 2O1HA 3POLA 1NF5B 5CMIA 4HO0A 3BCVA 2ICYA 4UEGA 3OH4A 2I5EA 3SX5A 1YP3A 1H7QA 4Y7TA 5CMFX 4HO3A 4CVHA 2OI5A 2YQSA 1O7QA 1WT1A 2Y6PA 5FUHA 1MP3A 2AM5A 2JCLA 1ZJ0A 1JV1A 2BO7A 3U2UA 3V0NA 1ZDFA 2YC5A 1VGWA 4K6RA 1NKHB 2E8BA 4Y7GA 1H4DA 3V0MA 3Q80A 2YC3A 1GX4A 3HL3A 4KRVA 3SXGA 3V0QA 3LW6A 2JCKA 4M2BA 3OH0A 2VXMA 2GGQA 3NGWA 1G95A 2QKXA 4JD0A 4EEAA 1O23B 2ZU9A 4CJBA 4D0ZA 3IOJA 4CJCA 2X65A 2RJ0A 2WVLA 1G97A 2GGOA 1VZTA 2JCJA 2RJ7A 2RJ9A 2AECA 2WE9A 4KPXA 3RMWA 3R3IA 1R7YA 4KT7A 2OEFA 1KWSA 4HOCA 4B5BA 1FG5N 3CKVA 4EEMA 5I1FA 5C4DA 1H7LA 2AGDA 1S4PA 5IDSA 2YQHA 2RITA 1INIA 1GQ9A 4NALA 4G87A 1OMXA 3I0EA 4Y64A 3SX8A 2O1GA 4HG6A 2BO8A 4P02A 4NANA 5C3AA 4Y9XA 1QGQA 5CQOA 1IIMA 1R7TA 3OH1A 1TW5A 3OH3A 2VS4A 4XWIA 1H5SB 1TZFA 1NMMB 2W0WA 3TQDA 5IFYA 3JUJA 1NQIB 3F1YA 4Y62A 4KXOA 4FRMA 1VICA 2FYBA 2Y4MA 2RIZA 3ZLLA 3D98A 2FFVA 5FV9A 3V0OA 2FFUA 1IINA 2V0IA 3SX7A 3ZGFA 5FU8A 2UX8A 5DDTA 3OC9A 1V83A 2FY7A 2FYAA 2D7IA 4R7PA 3EE5A 1H7HA 5AJPA 3IOIA 1YP2A 2APCA 2P72A 3CGXA 4KNRA 1G2VA 2VSHA 1NWGB 3U0YA 2Y7AA 5C3DA 1G9RA 1R80A 1ZCVA 1G3LA 4HO6A 4D48A 3Q7UA 4ASJA 5BXCA 3OH2A 4EVWA 1E5KA 3N9WA 1W77A 4FRDA 1MP5A 3I0LA 3T7OA 3ZGGA 3BRKX 4HO9A 2PA4A 3DUVA 2AM4A 4FRBA 4FRPA 1INJA 3I0FA 2D7RA 1LVWA 1LL0A 5HS2A 2YQJA 3JUKA 3U0XA 1ZJPA 1WT0A 4B3UA 4LW6A 4Y6NA 5IDTA 5FTSA 1H3MA 1LZ7A 1ZIZA 1PZTA 1VZUA 4ZDQA 1ZJ3A 4EE5A 1WSZA 2QGIA 4NAKA 1GX0A 1H5RB 3R2WA 1LZ0A 4G3PA 4AYLA 3K8DA 2Z86A 1H7TA 1NHEB 4ARWA 3TZTA 1ZJOA 1WT2A 2V0LA 3JTJA 4D0TA 1HJJA 4IRQA 2VD4A 4CJ8A 1JYLA 1VGTA 1FO9A 1HM0A 1TVYA 1V84A 2ZU7A 4B4BA 5C36A 3KIAA 3K8EA 1HM9A 1H5TB 2VS5A 5FYEA 3I0KA 3I0GA 1GQCA 4EE4A 1YROB 2P6WA 2RIXA 2VXLA 4P00A 1FZWA 1FGGA 3SX3A 5C8RA 4FCUA 2BO4A 1ZI5A 1ZI1A 1O0RA 2XWNA 3U2TA 1G0RA 2E3DA 5C48A 4B4MA 1JYKA 4Y63A 1WT3A 4Y7UA 5J49A 2RIYA 1VM8A 1VH1A 3O3PA 5CQLX 1OQMB 2D0JA 2A8WA 2RJ8A 1GWWA 2WVMA 1G23A 4FRQA 1EYRA 4FRAA 1FGXA 1VPAA 1H4CA 1OMZA 2ZU8A 1LL3A 3FOQA 3RSBA 4DECA 4DE7A 1QG8A 4FCEA 3V0PA 4Y7VA 2CU2A 3PKPA 4MYBA 5CQPA 2VSIA 4GBPA 3SXEA 2A8UA 5C4EA 3SXDA 1VH3A 3ZLKA 4EEGA 5C4BA 1EZIA 4FREA 1G1LA 4LW3A 1H7GA 3OKRA 3DJ4A 2RJ1A 1FWYA 4KC2A 1I52A 2WAWA 2PX7A 5CMGX 2YESA 2VS3A 4IRPA 5L6VA 5C47A 2V0JA 1ZCYA 1FR8A 1ZJ2A 3CKNA 2X5SA 1H4EA 1FXJA 1Z90A 1LZIA 3I0HA 2XMEA 1W55A 4L41C 1QWJA 2ICXA 2AESA 4M4KA 5DDVA 3USRA 3T7NA 4AYJA 3D8VA 2Y4LA 2NXVA 1JV3A 3V8ZA 3U2WA 2MZBA 2XMHA 3CKOA 1ZCUA 4B2XA 2I5KA 3T7MA 1XZ6A 4KNXA 1HJLA 3E25A 5FU0A 2QH5A 1HV9A 2AH9A 1ZI4A 2RJ4A 2P73A 3D5NA 4NAIA 4FROA 2I7BA 4G3QA 5CQMX 4KC1A 2YQCA 3I0DA 5CQNX 1VGUA 1WVCA 1ZJ1A 3V90A 4DDZA 1S4OA 1K4VA 1VZXA 4HO4A 3ST8A 4BQHA 5EJ1A 5C3BA 2Y4JA 4KC4A 5C38A 3RMVA 1R7XA 4G3SA 1FR9A 2RJ6A 2WVKA 4HO2A 1H5SA 5AJOA 1FO8A 3I0JA 4HO5A 3F1CA 3ZF8A 5FTVA 4BMAA 3SXAA 1GWVA 3USQA 4E1KA 1LZJA 2XWLA 3CKQA 1H5SD 5EIYA 4HO8A 1FOAA 1O7OA 1ZI3A 1FRWA 5C4FA 5C1GA 4C2SA 3U2XA 1H5SC 3I0CA 4EEOA 3SXCA 1MC3A 1MP4A 1ZHJA 1JVGA
chains in the Genus database with same CATH superfamily
2Z87A 1TW1A 1V82A 4D11A 2OI6A 4FRLA 2RJ5A 2PGYA 3SXBA 3V8YA 1QGSA 3E26A 2XWMA 3Q4SA 4FRHA 3CU0A 2BO6A 2YCMA 3DK5A 2WEEA 1S4NA 5CMHA 3SPTA 4ECMA 1GA8A 3FWWA 2PGVA 1H7EA 2FYCB 4JISA 5AJNA 4D11C 2AE7A 2OEGA 3OGZA 4HCQA 2VFZA 1XHBA 1LL2A 1ON6A 4KPZA 5CMJA 5C1HA 3V91A 5JQQA 1G8OA 4ASYA 4YS8A 5C1LA 3PNNA 3OAMA 1SS9A 2OI7A 2Q4JA 2X5ZA 1H5RA 1H7FA 1YP4A 4B2WA 1VGZA 4Y7FA 1PZYB 3I0IX 4FQWA 4AAWA 3V0LA 4J18A 4M28A 5EJZA 1R7VA 4B42A 4EE3A 3QVBA 1ZDGA 1G93A 2JCOA 5C4CA 2X60A 4Y6UA 3GUEA 2V0HA 4MNDA 2Y4KA 3IOHA 1ON8A 4B4GA 1W57A 3CKJA 1FXOA 4KQLA 2DPWA 1JVDA 1ZCTA 4M2AA 1H5TA 1R81A 4AC3A 2FYDB 1HM8A 2AM3A 3PKQA 2W0VA 5C49A 2WGZA 1R7UA 5L6SA 3U2VA 2O1FA 1R82A 2V0KA 2O1HA 3POLA 1NF5B 5CMIA 4HO0A 3BCVA 2ICYA 4UEGA 3OH4A 2I5EA 3SX5A 1YP3A 1H7QA 4Y7TA 5CMFX 4HO3A 4CVHA 2OI5A 2YQSA 1O7QA 1WT1A 2Y6PA 5FUHA 1MP3A 2AM5A 2JCLA 1ZJ0A 1JV1A 2BO7A 3U2UA 3V0NA 1ZDFA 2YC5A 1VGWA 4K6RA 1NKHB 2E8BA 4Y7GA 1H4DA 3V0MA 3Q80A 2YC3A 1GX4A 3HL3A 4KRVA 3SXGA 3V0QA 3LW6A 2JCKA 4M2BA 3OH0A 2VXMA 2GGQA 3NGWA 1G95A 2QKXA 4JD0A 4EEAA 1O23B 2ZU9A 4CJBA 4D0ZA 3IOJA 4CJCA 2X65A 2RJ0A 2WVLA 1G97A 2GGOA 1VZTA 2JCJA 2C0NA 5D92A 2RJ7A 2RJ9A 2AECA 2WE9A 4KPXA 3RMWA 3R3IA 1R7YA 4KT7A 2OEFA 1KWSA 4HOCA 4B5BA 1FG5N 3CKVA 4EEMA 5I1FA 5C4DA 1H7LA 2AGDA 1S4PA 5IDSA 2YQHA 2RITA 1INIA 1GQ9A 4NALA 4G87A 1OMXA 3I0EA 4Y64A 3SX8A 2O1GA 4HG6A 2BO8A 4P02A 4NANA 5C3AA 4Y9XA 1QGQA 5CQOA 1IIMA 1R7TA 3OH1A 1TW5A 3OH3A 2VS4A 4XWIA 1H5SB 1TZFA 1NMMB 2W0WA 3TQDA 5IFYA 3JUJA 1NQIB 4FIYA 3F1YA 5D91A 4Y62A 4KXOA 4FRMA 1VICA 2FYBA 2Y4MA 2RIZA 3ZLLA 3D98A 2FFVA 5FV9A 3V0OA 2FFUA 1IINA 2V0IA 3SX7A 3ZGFA 5FU8A 2UX8A 5DDTA 3OC9A 1V83A 2FY7A 2FYAA 2D7IA 4R7PA 3EE5A 1H7HA 4Q7CA 5AJPA 3IOIA 1YP2A 2APCA 2P72A 3CGXA 4KNRA 1G2VA 2VSHA 1NWGB 3U0YA 2Y7AA 5C3DA 4O6NA 1G9RA 1R80A 1ZCVA 1G3LA 4HO6A 4D48A 3Q7UA 4ASJA 5BXCA 3OH2A 4EVWA 1E5KA 3N9WA 1W77A 4FRDA 1MP5A 3I0LA 3T7OA 3ZGGA 3BRKX 4HO9A 2PA4A 3DUVA 2AM4A 4FRBA 4FRPA 1INJA 3I0FA 2D7RA 1LVWA 1LL0A 5HS2A 2YQJA 3JUKA 3U0XA 1ZJPA 1WT0A 4B3UA 4LW6A 4Y6NA 5IDTA 5FTSA 1H3MA 1LZ7A 1ZIZA 1PZTA 1VZUA 4ZDQA 1ZJ3A 4EE5A 1WSZA 2QGIA 4NAKA 1GX0A 1H5RB 3R2WA 1LZ0A 4G3PA 4AYLA 3K8DA 2Z86A 1H7TA 1NHEB 4ARWA 3TZTA 1ZJOA 1WT2A 2V0LA 3JTJA 4D0TA 1HJJA 4IRQA 2VD4A 4O6MA 4CJ8A 1JYLA 1VGTA 1FO9A 1HM0A 1TVYA 1V84A 2ZU7A 4B4BA 5C36A 3KIAA 3K8EA 1HM9A 1H5TB 2VS5A 5FYEA 3I0KA 3I0GA 1GQCA 4EE4A 1YROB 2P6WA 2RIXA 2VXLA 4P00A 1FZWA 1FGGA 3SX3A 5C8RA 4FCUA 2BO4A 1ZI5A 1ZI1A 1O0RA 2XWNA 3U2TA 1G0RA 2E3DA 5C48A 4B4MA 1JYKA 4Y63A 1WT3A 4Y7UA 5J49A 2RIYA 1VM8A 1VH1A 3O3PA 5CQLX 1OQMB 2D0JA 2A8WA 2RJ8A 1GWWA 2WVMA 1G23A 2VK9A 4FRQA 1EYRA 4FRAA 1FGXA 1VPAA 1H4CA 1OMZA 2ZU8A 1LL3A 3FOQA 3RSBA 4DECA 4DE7A 1QG8A 4FCEA 3V0PA 4Y7VA 2CU2A 3PKPA 4MYBA 5CQPA 2VSIA 4GBPA 3SXEA 2A8UA 5C4EA 3SXDA 1VH3A 3ZLKA 4EEGA 5C4BA 1EZIA 4FREA 1G1LA 4LW3A 1H7GA 3OKRA 3DJ4A 2RJ1A 1FWYA 4KC2A 1I52A 2WAWA 2PX7A 5CMGX 2YESA 2VS3A 4IRPA 5L6VA 5C47A 2V0JA 1ZCYA 1FR8A 1ZJ2A 3CKNA 2J0AA 2X5SA 1H4EA 1FXJA 1Z90A 1LZIA 3I0HA 2XMEA 1W55A 4L41C 1QWJA 2ICXA 2AESA 4M4KA 5DDVA 3USRA 3T7NA 2J0BA 4AYJA 3D8VA 2Y4LA 2NXVA 1JV3A 3V8ZA 3U2WA 2MZBA 2XMHA 4MIXA 3CKOA 1ZCUA 4B2XA 2I5KA 3T7MA 1XZ6A 4KNXA 1HJLA 3E25A 5FU0A 2QH5A 1HV9A 2AH9A 1ZI4A 2RJ4A 2P73A 3D5NA 4NAIA 4FROA 2I7BA 4G3QA 5CQMX 4KC1A 2YQCA 3I0DA 5CQNX 1VGUA 1WVCA 1ZJ1A 3V90A 4DDZA 1S4OA 1K4VA 1VZXA 4HO4A 3ST8A 4BQHA 5EJ1A 5C3BA 2Y4JA 4KC4A 5C38A 3RMVA 1R7XA 4G3SA 1FR9A 2RJ6A 2WVKA 4HO2A 1H5SA 5AJOA 1FO8A 3I0JA 4HO5A 3F1CA 3ZF8A 5FTVA 4BMAA 3SXAA 1GWVA 3USQA 4E1KA 1LZJA 2XWLA 3CKQA 1H5SD 5EIYA 4HO8A 1FOAA 1O7OA 1ZI3A 1FRWA 5C4FA 5C1GA 4C2SA 3U2XA 1H5SC 4FIXA 3I0CA 4EEOA 3SXCA 1MC3A 1MP4A 1ZHJA 1JVGA
chains in the Genus database with same CATH topology
2Z87A 1TW1A 1V82A 4D11A 2OI6A 4FRLA 2RJ5A 2PGYA 3SXBA 3V8YA 1QGSA 3E26A 2XWMA 3Q4SA 4FRHA 3CU0A 2BO6A 2YCMA 3DK5A 2WEEA 1S4NA 5CMHA 3SPTA 4ECMA 1GA8A 3FWWA 2PGVA 1H7EA 2FYCB 4JISA 5AJNA 4D11C 2AE7A 2OEGA 3OGZA 4HCQA 2VFZA 1XHBA 1LL2A 1ON6A 4KPZA 5CMJA 5C1HA 3V91A 5JQQA 1G8OA 4ASYA 4YS8A 5C1LA 3PNNA 3OAMA 1SS9A 2OI7A 2Q4JA 2X5ZA 1H5RA 1H7FA 1YP4A 4B2WA 1VGZA 4Y7FA 1PZYB 3I0IX 4FQWA 4AAWA 3V0LA 4J18A 4M28A 5EJZA 1R7VA 4B42A 4EE3A 3QVBA 1ZDGA 1G93A 2JCOA 5C4CA 2X60A 4Y6UA 3GUEA 2V0HA 4MNDA 2Y4KA 3IOHA 1ON8A 4B4GA 1W57A 3CKJA 1FXOA 4KQLA 2DPWA 1JVDA 1ZCTA 4M2AA 1H5TA 1R81A 4AC3A 2FYDB 1HM8A 2AM3A 3PKQA 2W0VA 5C49A 2WGZA 1R7UA 5L6SA 3U2VA 2O1FA 1R82A 2V0KA 2O1HA 3POLA 1NF5B 5CMIA 4HO0A 3BCVA 2ICYA 4UEGA 3OH4A 2I5EA 3SX5A 1YP3A 1H7QA 4Y7TA 5CMFX 4HO3A 4CVHA 2OI5A 2YQSA 1O7QA 1WT1A 2Y6PA 5FUHA 1MP3A 2AM5A 2JCLA 1ZJ0A 1JV1A 2BO7A 3U2UA 3V0NA 1ZDFA 2YC5A 1VGWA 4K6RA 1NKHB 2E8BA 4Y7GA 1H4DA 3V0MA 3Q80A 2YC3A 1GX4A 3HL3A 4KRVA 3SXGA 3V0QA 3LW6A 2JCKA 4M2BA 3OH0A 2VXMA 2GGQA 3NGWA 1G95A 2QKXA 4JD0A 4EEAA 1O23B 2ZU9A 4CJBA 4D0ZA 3IOJA 4CJCA 2X65A 2RJ0A 2WVLA 1G97A 2GGOA 1VZTA 2JCJA 2C0NA 5D92A 2RJ7A 2RJ9A 2AECA 2WE9A 4KPXA 3RMWA 3R3IA 1R7YA 4KT7A 2OEFA 1KWSA 4HOCA 4B5BA 1FG5N 3CKVA 4EEMA 5I1FA 5C4DA 1H7LA 2AGDA 1S4PA 5IDSA 2YQHA 2RITA 1INIA 1GQ9A 4NALA 4G87A 1OMXA 3I0EA 4Y64A 3SX8A 2O1GA 4HG6A 2BO8A 4P02A 4NANA 5C3AA 4Y9XA 1QGQA 5CQOA 1IIMA 1R7TA 3OH1A 1TW5A 3OH3A 2VS4A 4XWIA 1H5SB 1TZFA 1NMMB 2W0WA 3TQDA 5IFYA 3JUJA 1NQIB 4FIYA 3F1YA 5D91A 4Y62A 4KXOA 4FRMA 1VICA 2FYBA 2Y4MA 2RIZA 3ZLLA 3D98A 2FFVA 5FV9A 3V0OA 2FFUA 1IINA 2V0IA 3SX7A 3ZGFA 5FU8A 2UX8A 5DDTA 3OC9A 1V83A 2FY7A 2FYAA 2D7IA 4R7PA 3EE5A 1H7HA 4Q7CA 5AJPA 3IOIA 1YP2A 2APCA 2P72A 3CGXA 4KNRA 1G2VA 2VSHA 1NWGB 3U0YA 2Y7AA 5C3DA 4O6NA 1G9RA 1R80A 1ZCVA 1G3LA 4HO6A 4D48A 3Q7UA 4ASJA 5BXCA 3OH2A 4EVWA 1E5KA 3N9WA 1W77A 4FRDA 1MP5A 3I0LA 3T7OA 3ZGGA 3BRKX 4HO9A 2PA4A 3DUVA 2AM4A 4FRBA 4FRPA 1INJA 3I0FA 2D7RA 1LVWA 1LL0A 5HS2A 2YQJA 3JUKA 3U0XA 1ZJPA 1WT0A 4B3UA 4LW6A 4Y6NA 5IDTA 5FTSA 1H3MA 1LZ7A 1ZIZA 1PZTA 1VZUA 4ZDQA 1ZJ3A 4EE5A 1WSZA 2QGIA 4NAKA 1GX0A 1H5RB 3R2WA 1LZ0A 4G3PA 4AYLA 3K8DA 2Z86A 1H7TA 1NHEB 4ARWA 3TZTA 1ZJOA 1WT2A 2V0LA 3JTJA 4D0TA 1HJJA 4IRQA 2VD4A 4O6MA 4CJ8A 1JYLA 1VGTA 1FO9A 1HM0A 1TVYA 1V84A 2ZU7A 4B4BA 5C36A 3KIAA 3K8EA 1HM9A 1H5TB 2VS5A 5FYEA 3I0KA 3I0GA 1GQCA 4EE4A 1YROB 2P6WA 2RIXA 2VXLA 4P00A 1FZWA 1FGGA 3SX3A 5C8RA 4FCUA 2BO4A 1ZI5A 1ZI1A 1O0RA 2XWNA 3U2TA 1G0RA 2E3DA 5C48A 4B4MA 1JYKA 4Y63A 1WT3A 4Y7UA 5J49A 2RIYA 1VM8A 1VH1A 3O3PA 5CQLX 1OQMB 2D0JA 2A8WA 2RJ8A 1GWWA 2WVMA 1G23A 2VK9A 4FRQA 1EYRA 4FRAA 1FGXA 1VPAA 1H4CA 1OMZA 2ZU8A 1LL3A 3FOQA 3RSBA 4DECA 4DE7A 1QG8A 4FCEA 3V0PA 4Y7VA 2CU2A 3PKPA 4MYBA 5CQPA 2VSIA 4GBPA 3SXEA 2A8UA 5C4EA 3SXDA 1VH3A 3ZLKA 4EEGA 5C4BA 1EZIA 4FREA 1G1LA 4LW3A 1H7GA 3OKRA 3DJ4A 2RJ1A 1FWYA 4KC2A 1I52A 2WAWA 2PX7A 5CMGX 2YESA 2VS3A 4IRPA 5L6VA 5C47A 2V0JA 1ZCYA 1FR8A 1ZJ2A 3CKNA 2J0AA 2X5SA 1H4EA 1FXJA 1Z90A 1LZIA 3I0HA 2XMEA 1W55A 4L41C 1QWJA 2ICXA 2AESA 4M4KA 5DDVA 3USRA 3T7NA 2J0BA 4AYJA 3D8VA 2Y4LA 2NXVA 1JV3A 3V8ZA 3U2WA 2MZBA 2XMHA 4MIXA 3CKOA 1ZCUA 4B2XA 2I5KA 3T7MA 1XZ6A 4KNXA 1HJLA 3E25A 5FU0A 2QH5A 1HV9A 2AH9A 1ZI4A 2RJ4A 2P73A 3D5NA 4NAIA 4FROA 2I7BA 4G3QA 5CQMX 4KC1A 2YQCA 3I0DA 5CQNX 1VGUA 1WVCA 1ZJ1A 3V90A 4DDZA 1S4OA 1K4VA 1VZXA 4HO4A 3ST8A 4BQHA 5EJ1A 5C3BA 2Y4JA 4KC4A 5C38A 3RMVA 1R7XA 4G3SA 1FR9A 2RJ6A 2WVKA 4HO2A 1H5SA 5AJOA 1FO8A 3I0JA 4HO5A 3F1CA 3ZF8A 5FTVA 4BMAA 3SXAA 1GWVA 3USQA 4E1KA 1LZJA 2XWLA 3CKQA 1H5SD 5EIYA 4HO8A 1FOAA 1O7OA 1ZI3A 1FRWA 5C4FA 5C1GA 4C2SA 3U2XA 1H5SC 4FIXA 3I0CA 4EEOA 3SXCA 1MC3A 1MP4A 1ZHJA 1JVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z87 A;  1TW1 A;  1V82 A;  4D11 A;  2OI6 A;  4FRL A;  2RJ5 A;  2PGY A;  3SXB A;  3V8Y A;  1QGS A;  3E26 A;  2XWM A;  3Q4S A;  4FRH A;  3CU0 A;  2BO6 A;  2YCM A;  3DK5 A;  2WEE A;  1S4N A;  5CMH A;  3SPT A;  4ECM A;  1GA8 A;  3FWW A;  2PGV A;  1H7E A;  2FYC B;  4JIS A;  5AJN A;  4D11 C;  2AE7 A;  2OEG A;  3OGZ A;  4HCQ A;  2VFZ A;  1XHB A;  1LL2 A;  1ON6 A;  4KPZ A;  5CMJ A;  5C1H A;  3V91 A;  5JQQ A;  1G8O A;  4ASY A;  4YS8 A;  5C1L A;  3PNN A;  3OAM A;  1SS9 A;  2OI7 A;  2Q4J A;  2X5Z A;  1H5R A;  1H7F A;  1YP4 A;  4B2W A;  1VGZ A;  4Y7F A;  1PZY B;  3I0I X;  4FQW A;  4AAW A;  3V0L A;  4J18 A;  4M28 A;  5EJZ A;  1R7V A;  4B42 A;  4EE3 A;  3QVB A;  1ZDG A;  1G93 A;  2JCO A;  5C4C A;  2X60 A;  4Y6U A;  3GUE A;  2V0H A;  4MND A;  2Y4K A;  3IOH A;  1ON8 A;  4B4G A;  1W57 A;  3CKJ A;  1FXO A;  4KQL A;  2DPW A;  1JVD A;  1ZCT A;  4M2A A;  1H5T A;  1R81 A;  4AC3 A;  2FYD B;  1HM8 A;  2AM3 A;  3PKQ A;  2W0V A;  5C49 A;  2WGZ A;  1R7U A;  5L6S A;  3U2V A;  2O1F A;  1R82 A;  2V0K A;  2O1H A;  3POL A;  1NF5 B;  5CMI A;  4HO0 A;  3BCV A;  2ICY A;  4UEG A;  3OH4 A;  2I5E A;  3SX5 A;  1YP3 A;  1H7Q A;  4Y7T A;  5CMF X;  4HO3 A;  4CVH A;  2OI5 A;  2YQS A;  1O7Q A;  1WT1 A;  2Y6P A;  5FUH A;  1MP3 A;  2AM5 A;  2JCL A;  1ZJ0 A;  1JV1 A;  2BO7 A;  3U2U A;  3V0N A;  1ZDF A;  2YC5 A;  1VGW A;  4K6R A;  1NKH B;  2E8B A;  4Y7G A;  1H4D A;  3V0M A;  3Q80 A;  2YC3 A;  1GX4 A;  3HL3 A;  4KRV A;  3SXG A;  3V0Q A;  3LW6 A;  2JCK A;  4M2B A;  3OH0 A;  2VXM A;  2GGQ A;  3NGW A;  1G95 A;  2QKX A;  4JD0 A;  4EEA A;  1O23 B;  2ZU9 A;  4CJB A;  4D0Z A;  3IOJ A;  4CJC A;  2X65 A;  2RJ0 A;  2WVL A;  1G97 A;  2GGO A;  1VZT A;  2JCJ A;  2RJ7 A;  2RJ9 A;  2AEC A;  2WE9 A;  4KPX A;  3RMW A;  3R3I A;  1R7Y A;  4KT7 A;  2OEF A;  1KWS A;  4HOC A;  4B5B A;  1FG5 N;  3CKV A;  4EEM A;  5I1F A;  5C4D A;  1H7L A;  2AGD A;  1S4P A;  5IDS A;  2YQH A;  2RIT A;  1INI A;  1GQ9 A;  4NAL A;  4G87 A;  1OMX A;  3I0E A;  4Y64 A;  3SX8 A;  2O1G A;  4HG6 A;  2BO8 A;  4P02 A;  4NAN A;  5C3A A;  4Y9X A;  1QGQ A;  5CQO A;  1IIM A;  1R7T A;  3OH1 A;  1TW5 A;  3OH3 A;  2VS4 A;  4XWI A;  1H5S B;  1TZF A;  1NMM B;  2W0W A;  3TQD A;  5IFY A;  3JUJ A;  1NQI B;  3F1Y A;  4Y62 A;  4KXO A;  4FRM A;  1VIC A;  2FYB A;  2Y4M A;  2RIZ A;  3ZLL A;  3D98 A;  2FFV A;  5FV9 A;  3V0O A;  2FFU A;  1IIN A;  2V0I A;  3SX7 A;  3ZGF A;  5FU8 A;  2UX8 A;  5DDT A;  3OC9 A;  1V83 A;  2FY7 A;  2FYA A;  2D7I A;  4R7P A;  3EE5 A;  1H7H A;  5AJP A;  3IOI A;  1YP2 A;  2APC A;  2P72 A;  3CGX A;  4KNR A;  1G2V A;  2VSH A;  1NWG B;  3U0Y A;  2Y7A A;  5C3D A;  1G9R A;  1R80 A;  1ZCV A;  1G3L A;  4HO6 A;  4D48 A;  3Q7U A;  4ASJ A;  5BXC A;  3OH2 A;  4EVW A;  1E5K A;  3N9W A;  1W77 A;  4FRD A;  1MP5 A;  3I0L A;  3T7O A;  3ZGG A;  3BRK X;  4HO9 A;  2PA4 A;  3DUV A;  2AM4 A;  4FRB A;  4FRP A;  1INJ A;  3I0F A;  2D7R A;  1LVW A;  1LL0 A;  5HS2 A;  2YQJ A;  3JUK A;  3U0X A;  1ZJP A;  1WT0 A;  4B3U A;  4LW6 A;  4Y6N A;  5IDT A;  5FTS A;  1H3M A;  1LZ7 A;  1ZIZ A;  1PZT A;  1VZU A;  4ZDQ A;  1ZJ3 A;  4EE5 A;  1WSZ A;  2QGI A;  4NAK A;  1GX0 A;  1H5R B;  3R2W A;  1LZ0 A;  4G3P A;  4AYL A;  3K8D A;  2Z86 A;  1H7T A;  1NHE B;  4ARW A;  3TZT A;  1ZJO A;  1WT2 A;  2V0L A;  3JTJ A;  4D0T A;  1HJJ A;  4IRQ A;  2VD4 A;  4CJ8 A;  1JYL A;  1VGT A;  1FO9 A;  1HM0 A;  1TVY A;  1V84 A;  2ZU7 A;  4B4B A;  5C36 A;  3KIA A;  3K8E A;  1HM9 A;  1H5T B;  2VS5 A;  5FYE A;  3I0K A;  3I0G A;  1GQC A;  4EE4 A;  1YRO B;  2P6W A;  2RIX A;  2VXL A;  4P00 A;  1FZW A;  1FGG A;  3SX3 A;  5C8R A;  4FCU A;  2BO4 A;  1ZI5 A;  1ZI1 A;  1O0R A;  2XWN A;  3U2T A;  1G0R A;  2E3D A;  5C48 A;  4B4M A;  1JYK A;  4Y63 A;  1WT3 A;  4Y7U A;  5J49 A;  2RIY A;  1VM8 A;  1VH1 A;  3O3P A;  5CQL X;  1OQM B;  2D0J A;  2A8W A;  2RJ8 A;  1GWW A;  2WVM A;  1G23 A;  4FRQ A;  1EYR A;  4FRA A;  1FGX A;  1VPA A;  1H4C A;  1OMZ A;  2ZU8 A;  1LL3 A;  3FOQ A;  3RSB A;  4DEC A;  4DE7 A;  1QG8 A;  4FCE A;  3V0P A;  4Y7V A;  2CU2 A;  3PKP A;  4MYB A;  5CQP A;  2VSI A;  4GBP A;  3SXE A;  2A8U A;  5C4E A;  3SXD A;  1VH3 A;  3ZLK A;  4EEG A;  5C4B A;  1EZI A;  4FRE A;  1G1L A;  4LW3 A;  1H7G A;  3OKR A;  3DJ4 A;  2RJ1 A;  1FWY A;  4KC2 A;  1I52 A;  2WAW A;  2PX7 A;  5CMG X;  2YES A;  2VS3 A;  4IRP A;  5L6V A;  5C47 A;  2V0J A;  1ZCY A;  1FR8 A;  1ZJ2 A;  3CKN A;  2X5S A;  1H4E A;  1FXJ A;  1Z90 A;  1LZI A;  3I0H A;  2XME A;  1W55 A;  4L41 C;  1QWJ A;  2ICX A;  2AES A;  4M4K A;  5DDV A;  3USR A;  3T7N A;  4AYJ A;  3D8V A;  2Y4L A;  2NXV A;  1JV3 A;  3V8Z A;  3U2W A;  2MZB A;  2XMH A;  3CKO A;  1ZCU A;  4B2X A;  2I5K A;  3T7M A;  1XZ6 A;  4KNX A;  1HJL A;  3E25 A;  5FU0 A;  2QH5 A;  1HV9 A;  2AH9 A;  1ZI4 A;  2RJ4 A;  2P73 A;  3D5N A;  4NAI A;  4FRO A;  2I7B A;  4G3Q A;  5CQM X;  4KC1 A;  2YQC A;  3I0D A;  5CQN X;  1VGU A;  1WVC A;  1ZJ1 A;  3V90 A;  4DDZ A;  1S4O A;  1K4V A;  1VZX A;  4HO4 A;  3ST8 A;  4BQH A;  5EJ1 A;  5C3B A;  2Y4J A;  4KC4 A;  5C38 A;  3RMV A;  1R7X A;  4G3S A;  1FR9 A;  2RJ6 A;  2WVK A;  4HO2 A;  1H5S A;  5AJO A;  1FO8 A;  3I0J A;  4HO5 A;  3F1C A;  3ZF8 A;  5FTV A;  4BMA A;  3SXA A;  1GWV A;  3USQ A;  4E1K A;  1LZJ A;  2XWL A;  3CKQ A;  1H5S D;  5EIY A;  4HO8 A;  1FOA A;  1O7O A;  1ZI3 A;  1FRW A;  5C4F A;  5C1G A;  4C2S A;  3U2X A;  1H5S C;  3I0C A;  4EEO A;  3SXC A;  1MC3 A;  1MP4 A;  1ZHJ A;  1JVG A; 
#chains in the Genus database with same CATH topology
 2Z87 A;  1TW1 A;  1V82 A;  4D11 A;  2OI6 A;  4FRL A;  2RJ5 A;  2PGY A;  3SXB A;  3V8Y A;  1QGS A;  3E26 A;  2XWM A;  3Q4S A;  4FRH A;  3CU0 A;  2BO6 A;  2YCM A;  3DK5 A;  2WEE A;  1S4N A;  5CMH A;  3SPT A;  4ECM A;  1GA8 A;  3FWW A;  2PGV A;  1H7E A;  2FYC B;  4JIS A;  5AJN A;  4D11 C;  2AE7 A;  2OEG A;  3OGZ A;  4HCQ A;  2VFZ A;  1XHB A;  1LL2 A;  1ON6 A;  4KPZ A;  5CMJ A;  5C1H A;  3V91 A;  5JQQ A;  1G8O A;  4ASY A;  4YS8 A;  5C1L A;  3PNN A;  3OAM A;  1SS9 A;  2OI7 A;  2Q4J A;  2X5Z A;  1H5R A;  1H7F A;  1YP4 A;  4B2W A;  1VGZ A;  4Y7F A;  1PZY B;  3I0I X;  4FQW A;  4AAW A;  3V0L A;  4J18 A;  4M28 A;  5EJZ A;  1R7V A;  4B42 A;  4EE3 A;  3QVB A;  1ZDG A;  1G93 A;  2JCO A;  5C4C A;  2X60 A;  4Y6U A;  3GUE A;  2V0H A;  4MND A;  2Y4K A;  3IOH A;  1ON8 A;  4B4G A;  1W57 A;  3CKJ A;  1FXO A;  4KQL A;  2DPW A;  1JVD A;  1ZCT A;  4M2A A;  1H5T A;  1R81 A;  4AC3 A;  2FYD B;  1HM8 A;  2AM3 A;  3PKQ A;  2W0V A;  5C49 A;  2WGZ A;  1R7U A;  5L6S A;  3U2V A;  2O1F A;  1R82 A;  2V0K A;  2O1H A;  3POL A;  1NF5 B;  5CMI A;  4HO0 A;  3BCV A;  2ICY A;  4UEG A;  3OH4 A;  2I5E A;  3SX5 A;  1YP3 A;  1H7Q A;  4Y7T A;  5CMF X;  4HO3 A;  4CVH A;  2OI5 A;  2YQS A;  1O7Q A;  1WT1 A;  2Y6P A;  5FUH A;  1MP3 A;  2AM5 A;  2JCL A;  1ZJ0 A;  1JV1 A;  2BO7 A;  3U2U A;  3V0N A;  1ZDF A;  2YC5 A;  1VGW A;  4K6R A;  1NKH B;  2E8B A;  4Y7G A;  1H4D A;  3V0M A;  3Q80 A;  2YC3 A;  1GX4 A;  3HL3 A;  4KRV A;  3SXG A;  3V0Q A;  3LW6 A;  2JCK A;  4M2B A;  3OH0 A;  2VXM A;  2GGQ A;  3NGW A;  1G95 A;  2QKX A;  4JD0 A;  4EEA A;  1O23 B;  2ZU9 A;  4CJB A;  4D0Z A;  3IOJ A;  4CJC A;  2X65 A;  2RJ0 A;  2WVL A;  1G97 A;  2GGO A;  1VZT A;  2JCJ A;  2C0N A;  5D92 A;  2RJ7 A;  2RJ9 A;  2AEC A;  2WE9 A;  4KPX A;  3RMW A;  3R3I A;  1R7Y A;  4KT7 A;  2OEF A;  1KWS A;  4HOC A;  4B5B A;  1FG5 N;  3CKV A;  4EEM A;  5I1F A;  5C4D A;  1H7L A;  2AGD A;  1S4P A;  5IDS A;  2YQH A;  2RIT A;  1INI A;  1GQ9 A;  4NAL A;  4G87 A;  1OMX A;  3I0E A;  4Y64 A;  3SX8 A;  2O1G A;  4HG6 A;  2BO8 A;  4P02 A;  4NAN A;  5C3A A;  4Y9X A;  1QGQ A;  5CQO A;  1IIM A;  1R7T A;  3OH1 A;  1TW5 A;  3OH3 A;  2VS4 A;  4XWI A;  1H5S B;  1TZF A;  1NMM B;  2W0W A;  3TQD A;  5IFY A;  3JUJ A;  1NQI B;  4FIY A;  3F1Y A;  5D91 A;  4Y62 A;  4KXO A;  4FRM A;  1VIC A;  2FYB A;  2Y4M A;  2RIZ A;  3ZLL A;  3D98 A;  2FFV A;  5FV9 A;  3V0O A;  2FFU A;  1IIN A;  2V0I A;  3SX7 A;  3ZGF A;  5FU8 A;  2UX8 A;  5DDT A;  3OC9 A;  1V83 A;  2FY7 A;  2FYA A;  2D7I A;  4R7P A;  3EE5 A;  1H7H A;  4Q7C A;  5AJP A;  3IOI A;  1YP2 A;  2APC A;  2P72 A;  3CGX A;  4KNR A;  1G2V A;  2VSH A;  1NWG B;  3U0Y A;  2Y7A A;  5C3D A;  4O6N A;  1G9R A;  1R80 A;  1ZCV A;  1G3L A;  4HO6 A;  4D48 A;  3Q7U A;  4ASJ A;  5BXC A;  3OH2 A;  4EVW A;  1E5K A;  3N9W A;  1W77 A;  4FRD A;  1MP5 A;  3I0L A;  3T7O A;  3ZGG A;  3BRK X;  4HO9 A;  2PA4 A;  3DUV A;  2AM4 A;  4FRB A;  4FRP A;  1INJ A;  3I0F A;  2D7R A;  1LVW A;  1LL0 A;  5HS2 A;  2YQJ A;  3JUK A;  3U0X A;  1ZJP A;  1WT0 A;  4B3U A;  4LW6 A;  4Y6N A;  5IDT A;  5FTS A;  1H3M A;  1LZ7 A;  1ZIZ A;  1PZT A;  1VZU A;  4ZDQ A;  1ZJ3 A;  4EE5 A;  1WSZ A;  2QGI A;  4NAK A;  1GX0 A;  1H5R B;  3R2W A;  1LZ0 A;  4G3P A;  4AYL A;  3K8D A;  2Z86 A;  1H7T A;  1NHE B;  4ARW A;  3TZT A;  1ZJO A;  1WT2 A;  2V0L A;  3JTJ A;  4D0T A;  1HJJ A;  4IRQ A;  2VD4 A;  4O6M A;  4CJ8 A;  1JYL A;  1VGT A;  1FO9 A;  1HM0 A;  1TVY A;  1V84 A;  2ZU7 A;  4B4B A;  5C36 A;  3KIA A;  3K8E A;  1HM9 A;  1H5T B;  2VS5 A;  5FYE A;  3I0K A;  3I0G A;  1GQC A;  4EE4 A;  1YRO B;  2P6W A;  2RIX A;  2VXL A;  4P00 A;  1FZW A;  1FGG A;  3SX3 A;  5C8R A;  4FCU A;  2BO4 A;  1ZI5 A;  1ZI1 A;  1O0R A;  2XWN A;  3U2T A;  1G0R A;  2E3D A;  5C48 A;  4B4M A;  1JYK A;  4Y63 A;  1WT3 A;  4Y7U A;  5J49 A;  2RIY A;  1VM8 A;  1VH1 A;  3O3P A;  5CQL X;  1OQM B;  2D0J A;  2A8W A;  2RJ8 A;  1GWW A;  2WVM A;  1G23 A;  2VK9 A;  4FRQ A;  1EYR A;  4FRA A;  1FGX A;  1VPA A;  1H4C A;  1OMZ A;  2ZU8 A;  1LL3 A;  3FOQ A;  3RSB A;  4DEC A;  4DE7 A;  1QG8 A;  4FCE A;  3V0P A;  4Y7V A;  2CU2 A;  3PKP A;  4MYB A;  5CQP A;  2VSI A;  4GBP A;  3SXE A;  2A8U A;  5C4E A;  3SXD A;  1VH3 A;  3ZLK A;  4EEG A;  5C4B A;  1EZI A;  4FRE A;  1G1L A;  4LW3 A;  1H7G A;  3OKR A;  3DJ4 A;  2RJ1 A;  1FWY A;  4KC2 A;  1I52 A;  2WAW A;  2PX7 A;  5CMG X;  2YES A;  2VS3 A;  4IRP A;  5L6V A;  5C47 A;  2V0J A;  1ZCY A;  1FR8 A;  1ZJ2 A;  3CKN A;  2J0A A;  2X5S A;  1H4E A;  1FXJ A;  1Z90 A;  1LZI A;  3I0H A;  2XME A;  1W55 A;  4L41 C;  1QWJ A;  2ICX A;  2AES A;  4M4K A;  5DDV A;  3USR A;  3T7N A;  2J0B A;  4AYJ A;  3D8V A;  2Y4L A;  2NXV A;  1JV3 A;  3V8Z A;  3U2W A;  2MZB A;  2XMH A;  4MIX A;  3CKO A;  1ZCU A;  4B2X A;  2I5K A;  3T7M A;  1XZ6 A;  4KNX A;  1HJL A;  3E25 A;  5FU0 A;  2QH5 A;  1HV9 A;  2AH9 A;  1ZI4 A;  2RJ4 A;  2P73 A;  3D5N A;  4NAI A;  4FRO A;  2I7B A;  4G3Q A;  5CQM X;  4KC1 A;  2YQC A;  3I0D A;  5CQN X;  1VGU A;  1WVC A;  1ZJ1 A;  3V90 A;  4DDZ A;  1S4O A;  1K4V A;  1VZX A;  4HO4 A;  3ST8 A;  4BQH A;  5EJ1 A;  5C3B A;  2Y4J A;  4KC4 A;  5C38 A;  3RMV A;  1R7X A;  4G3S A;  1FR9 A;  2RJ6 A;  2WVK A;  4HO2 A;  1H5S A;  5AJO A;  1FO8 A;  3I0J A;  4HO5 A;  3F1C A;  3ZF8 A;  5FTV A;  4BMA A;  3SXA A;  1GWV A;  3USQ A;  4E1K A;  1LZJ A;  2XWL A;  3CKQ A;  1H5S D;  5EIY A;  4HO8 A;  1FOA A;  1O7O A;  1ZI3 A;  1FRW A;  5C4F A;  5C1G A;  4C2S A;  3U2X A;  1H5S C;  4FIX A;  3I0C A;  4EEO A;  3SXC A;  1MC3 A;  1MP4 A;  1ZHJ A;  1JVG A; 
#chains in the Genus database with same CATH homology
 2Z87 A;  1TW1 A;  1V82 A;  4D11 A;  2OI6 A;  4FRL A;  2RJ5 A;  2PGY A;  3SXB A;  3V8Y A;  1QGS A;  3E26 A;  2XWM A;  3Q4S A;  4FRH A;  3CU0 A;  2BO6 A;  2YCM A;  3DK5 A;  2WEE A;  1S4N A;  5CMH A;  3SPT A;  4ECM A;  1GA8 A;  3FWW A;  2PGV A;  1H7E A;  2FYC B;  4JIS A;  5AJN A;  4D11 C;  2AE7 A;  2OEG A;  3OGZ A;  4HCQ A;  2VFZ A;  1XHB A;  1LL2 A;  1ON6 A;  4KPZ A;  5CMJ A;  5C1H A;  3V91 A;  5JQQ A;  1G8O A;  4ASY A;  4YS8 A;  5C1L A;  3PNN A;  3OAM A;  1SS9 A;  2OI7 A;  2Q4J A;  2X5Z A;  1H5R A;  1H7F A;  1YP4 A;  4B2W A;  1VGZ A;  4Y7F A;  1PZY B;  3I0I X;  4FQW A;  4AAW A;  3V0L A;  4J18 A;  4M28 A;  5EJZ A;  1R7V A;  4B42 A;  4EE3 A;  3QVB A;  1ZDG A;  1G93 A;  2JCO A;  5C4C A;  2X60 A;  4Y6U A;  3GUE A;  2V0H A;  4MND A;  2Y4K A;  3IOH A;  1ON8 A;  4B4G A;  1W57 A;  3CKJ A;  1FXO A;  4KQL A;  2DPW A;  1JVD A;  1ZCT A;  4M2A A;  1H5T A;  1R81 A;  4AC3 A;  2FYD B;  1HM8 A;  2AM3 A;  3PKQ A;  2W0V A;  5C49 A;  2WGZ A;  1R7U A;  5L6S A;  3U2V A;  2O1F A;  1R82 A;  2V0K A;  2O1H A;  3POL A;  1NF5 B;  5CMI A;  4HO0 A;  3BCV A;  2ICY A;  4UEG A;  3OH4 A;  2I5E A;  3SX5 A;  1YP3 A;  1H7Q A;  4Y7T A;  5CMF X;  4HO3 A;  4CVH A;  2OI5 A;  2YQS A;  1O7Q A;  1WT1 A;  2Y6P A;  5FUH A;  1MP3 A;  2AM5 A;  2JCL A;  1ZJ0 A;  1JV1 A;  2BO7 A;  3U2U A;  3V0N A;  1ZDF A;  2YC5 A;  1VGW A;  4K6R A;  1NKH B;  2E8B A;  4Y7G A;  1H4D A;  3V0M A;  3Q80 A;  2YC3 A;  1GX4 A;  3HL3 A;  4KRV A;  3SXG A;  3V0Q A;  3LW6 A;  2JCK A;  4M2B A;  3OH0 A;  2VXM A;  2GGQ A;  3NGW A;  1G95 A;  2QKX A;  4JD0 A;  4EEA A;  1O23 B;  2ZU9 A;  4CJB A;  4D0Z A;  3IOJ A;  4CJC A;  2X65 A;  2RJ0 A;  2WVL A;  1G97 A;  2GGO A;  1VZT A;  2JCJ A;  2C0N A;  5D92 A;  2RJ7 A;  2RJ9 A;  2AEC A;  2WE9 A;  4KPX A;  3RMW A;  3R3I A;  1R7Y A;  4KT7 A;  2OEF A;  1KWS A;  4HOC A;  4B5B A;  1FG5 N;  3CKV A;  4EEM A;  5I1F A;  5C4D A;  1H7L A;  2AGD A;  1S4P A;  5IDS A;  2YQH A;  2RIT A;  1INI A;  1GQ9 A;  4NAL A;  4G87 A;  1OMX A;  3I0E A;  4Y64 A;  3SX8 A;  2O1G A;  4HG6 A;  2BO8 A;  4P02 A;  4NAN A;  5C3A A;  4Y9X A;  1QGQ A;  5CQO A;  1IIM A;  1R7T A;  3OH1 A;  1TW5 A;  3OH3 A;  2VS4 A;  4XWI A;  1H5S B;  1TZF A;  1NMM B;  2W0W A;  3TQD A;  5IFY A;  3JUJ A;  1NQI B;  4FIY A;  3F1Y A;  5D91 A;  4Y62 A;  4KXO A;  4FRM A;  1VIC A;  2FYB A;  2Y4M A;  2RIZ A;  3ZLL A;  3D98 A;  2FFV A;  5FV9 A;  3V0O A;  2FFU A;  1IIN A;  2V0I A;  3SX7 A;  3ZGF A;  5FU8 A;  2UX8 A;  5DDT A;  3OC9 A;  1V83 A;  2FY7 A;  2FYA A;  2D7I A;  4R7P A;  3EE5 A;  1H7H A;  4Q7C A;  5AJP A;  3IOI A;  1YP2 A;  2APC A;  2P72 A;  3CGX A;  4KNR A;  1G2V A;  2VSH A;  1NWG B;  3U0Y A;  2Y7A A;  5C3D A;  4O6N A;  1G9R A;  1R80 A;  1ZCV A;  1G3L A;  4HO6 A;  4D48 A;  3Q7U A;  4ASJ A;  5BXC A;  3OH2 A;  4EVW A;  1E5K A;  3N9W A;  1W77 A;  4FRD A;  1MP5 A;  3I0L A;  3T7O A;  3ZGG A;  3BRK X;  4HO9 A;  2PA4 A;  3DUV A;  2AM4 A;  4FRB A;  4FRP A;  1INJ A;  3I0F A;  2D7R A;  1LVW A;  1LL0 A;  5HS2 A;  2YQJ A;  3JUK A;  3U0X A;  1ZJP A;  1WT0 A;  4B3U A;  4LW6 A;  4Y6N A;  5IDT A;  5FTS A;  1H3M A;  1LZ7 A;  1ZIZ A;  1PZT A;  1VZU A;  4ZDQ A;  1ZJ3 A;  4EE5 A;  1WSZ A;  2QGI A;  4NAK A;  1GX0 A;  1H5R B;  3R2W A;  1LZ0 A;  4G3P A;  4AYL A;  3K8D A;  2Z86 A;  1H7T A;  1NHE B;  4ARW A;  3TZT A;  1ZJO A;  1WT2 A;  2V0L A;  3JTJ A;  4D0T A;  1HJJ A;  4IRQ A;  2VD4 A;  4O6M A;  4CJ8 A;  1JYL A;  1VGT A;  1FO9 A;  1HM0 A;  1TVY A;  1V84 A;  2ZU7 A;  4B4B A;  5C36 A;  3KIA A;  3K8E A;  1HM9 A;  1H5T B;  2VS5 A;  5FYE A;  3I0K A;  3I0G A;  1GQC A;  4EE4 A;  1YRO B;  2P6W A;  2RIX A;  2VXL A;  4P00 A;  1FZW A;  1FGG A;  3SX3 A;  5C8R A;  4FCU A;  2BO4 A;  1ZI5 A;  1ZI1 A;  1O0R A;  2XWN A;  3U2T A;  1G0R A;  2E3D A;  5C48 A;  4B4M A;  1JYK A;  4Y63 A;  1WT3 A;  4Y7U A;  5J49 A;  2RIY A;  1VM8 A;  1VH1 A;  3O3P A;  5CQL X;  1OQM B;  2D0J A;  2A8W A;  2RJ8 A;  1GWW A;  2WVM A;  1G23 A;  2VK9 A;  4FRQ A;  1EYR A;  4FRA A;  1FGX A;  1VPA A;  1H4C A;  1OMZ A;  2ZU8 A;  1LL3 A;  3FOQ A;  3RSB A;  4DEC A;  4DE7 A;  1QG8 A;  4FCE A;  3V0P A;  4Y7V A;  2CU2 A;  3PKP A;  4MYB A;  5CQP A;  2VSI A;  4GBP A;  3SXE A;  2A8U A;  5C4E A;  3SXD A;  1VH3 A;  3ZLK A;  4EEG A;  5C4B A;  1EZI A;  4FRE A;  1G1L A;  4LW3 A;  1H7G A;  3OKR A;  3DJ4 A;  2RJ1 A;  1FWY A;  4KC2 A;  1I52 A;  2WAW A;  2PX7 A;  5CMG X;  2YES A;  2VS3 A;  4IRP A;  5L6V A;  5C47 A;  2V0J A;  1ZCY A;  1FR8 A;  1ZJ2 A;  3CKN A;  2J0A A;  2X5S A;  1H4E A;  1FXJ A;  1Z90 A;  1LZI A;  3I0H A;  2XME A;  1W55 A;  4L41 C;  1QWJ A;  2ICX A;  2AES A;  4M4K A;  5DDV A;  3USR A;  3T7N A;  2J0B A;  4AYJ A;  3D8V A;  2Y4L A;  2NXV A;  1JV3 A;  3V8Z A;  3U2W A;  2MZB A;  2XMH A;  4MIX A;  3CKO A;  1ZCU A;  4B2X A;  2I5K A;  3T7M A;  1XZ6 A;  4KNX A;  1HJL A;  3E25 A;  5FU0 A;  2QH5 A;  1HV9 A;  2AH9 A;  1ZI4 A;  2RJ4 A;  2P73 A;  3D5N A;  4NAI A;  4FRO A;  2I7B A;  4G3Q A;  5CQM X;  4KC1 A;  2YQC A;  3I0D A;  5CQN X;  1VGU A;  1WVC A;  1ZJ1 A;  3V90 A;  4DDZ A;  1S4O A;  1K4V A;  1VZX A;  4HO4 A;  3ST8 A;  4BQH A;  5EJ1 A;  5C3B A;  2Y4J A;  4KC4 A;  5C38 A;  3RMV A;  1R7X A;  4G3S A;  1FR9 A;  2RJ6 A;  2WVK A;  4HO2 A;  1H5S A;  5AJO A;  1FO8 A;  3I0J A;  4HO5 A;  3F1C A;  3ZF8 A;  5FTV A;  4BMA A;  3SXA A;  1GWV A;  3USQ A;  4E1K A;  1LZJ A;  2XWL A;  3CKQ A;  1H5S D;  5EIY A;  4HO8 A;  1FOA A;  1O7O A;  1ZI3 A;  1FRW A;  5C4F A;  5C1G A;  4C2S A;  3U2X A;  1H5S C;  4FIX A;  3I0C A;  4EEO A;  3SXC A;  1MC3 A;  1MP4 A;  1ZHJ A;  1JVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...