4EVWA

Crystal structure of the nucleoside-diphosphate-sugar pyrophosphorylase from vibrio cholerae rc9. northeast structural genomics consortium (nesg) target vcr193.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
244
structure length
244
Chain Sequence
MIVIPMAGMSSRFFKAGYTQPKYMLEAHGQTLFEHSVNSFAAYFASTPFLFIVRNVYDTAVFVREKATQLGIKQFYIAELHTETRGQAETVTLGLEELAKQGVDYQGSITVFNIDTFRPNFVFPDISQHSDGYLEVFQGGGDNWSFAKPEHAGSTKVIQTAEKNPISDLCSTGLYHFNRKEDYLEAYREYVARPSQEWERGELYIAPLYNELIQKGLNIHYHLIARHEVIFCGVPDEYTDFLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside-diphosphate-sugar pyrophosphorylase
publication title Crystal Structure of the nucleoside-diphosphate-sugar pyrophosphorylase from Vibrio cholerae RC9.
rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 72
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4evwA00
4FRMA 5JQQA 3LW6A 4FRAA 1H5TB 4D11A 2XWMA 3NGWA 1G93A 3CKVA 3SX7A 1ZI3A 3I0LA 1ZDGA 3USRA 2W0WA 1FZWA 5C49A 1WVCA 2JCOA 3I0EA 2Q4JA 3Q80A 5CQOA 3SX8A 2BO8A 2QH5A 3V8ZA 4B4MA 1FGGA 1HV9A 2RJ7A 2ZU9A 1EYRA 4Y7UA 4M28A 3CGXA 3SXAA 4D48A 4AYJA 1YP2A 3OAMA 5EJ1A 1INJA 5J49A 1ZCYA 2VXLA 4Y7TA 1G95A 1H3MA 5CQNX 4KC1A 1H7TA 2AE7A 2Y4LA 3PNNA 5C4DA 4ASYA 4D0TA 3OKRA 1HJJA 2V0JA 2ICXA 4ARWA 1YP3A 3F1YA 3O3PA 2O1HA 4M2BA 4G3PA 1K4VA 3V0MA 1HM0A 4EVWA 1W57A 4MNDA 1H7LA 1H5RA 1O23B 3BRKX 4Y9XA 1VZUA 2A8UA 1W55A 4FRQA 4DE7A 5L6SA 2AESA 1VGWA 3PKQA 3SXBA 3RSBA 4ECMA 1LZIA 3ZGGA 4EEAA 4G3QA 2RJ6A 1H4DA 2CU2A 1OMXA 5FUHA 1H5SC 5HS2A 5C48A 5IFYA 2OI6A 2VSIA 4KPXA 5CMHA 3I0CA 4FROA 3U2TA 2VS5A 2VS4A 1V82A 3ST8A 4Y63A 5C4CA 1YROB 3OC9A 4BQHA 1JV3A 1R7XA 2OEGA 3I0DA 3OH2A 1VGTA 5DDTA 5FU0A 1VZTA 3V91A 3SXGA 3JTJA 4NALA 1NKHB 3CKNA 5DDVA 3DJ4A 4ZDQA 1R81A 1W77A 5C3AA 1HJLA 2FYBA 4EEOA 1R80A 4Y7VA 3V0QA 4ASJA 5EIYA 4FCUA 3V8YA 3ZF8A 2XMHA 5CQMX 2RIZA 5C38A 1ZI5A 3U2UA 4HO0A 4L41C 5FU8A 2AM3A 4UEGA 1VH1A 3ZLLA 4FREA 2V0IA 1VGZA 5C1LA 2P72A 1S4OA 4Y64A 1MP5A 1QGQA 1H4CA 4Y7GA 1JYKA 1VPAA 2YC3A 1GX4A 1WT3A 5C1HA 3CKOA 1H5TA 1TW1A 2D7RA 2YESA 3R3IA 4HO3A 4R7PA 4P02A 1LZ0A 1LVWA 1GQCA 3JUKA 2RJ8A 4NANA 4HO5A 2X5ZA 4KXOA 2JCLA 4B4BA 2Z86A 2NXVA 2AM5A 2VS3A 5AJPA 1ZJ3A 3CKQA 1ZIZA 4KPZA 1H5SB 1INIA 4HO8A 4D0ZA 1OQMB 2JCJA 4HOCA 1GWVA 4HO2A 2V0HA 5C8RA 3IOHA 1VICA 1GX0A 1G97A 2QGIA 2RJ5A 2AGDA 1H7GA 1FXJA 1NHEB 4Y6UA 3T7NA 1TVYA 4KC4A 3V0LA 4FRHA 5CQLX 1PZYB 1MP3A 1WT2A 2BO7A 1R7UA 4Y7FA 2PX7A 2QKXA 3ZGFA 5EJZA 4KT7A 2XMEA 4AAWA 4HO6A 2V0KA 4CJBA 3SX3A 1VGUA 4KQLA 2VSHA 4D11C 1QGSA 2RJ0A 2PA4A 1ZJOA 2P6WA 4B2XA 2FYCB 2YQSA 3OH0A 5CQPA 1G9RA 1H5RB 5CMFX 2E3DA 1HM9A 3KIAA 4MYBA 2W0VA 3SXEA 5C4EA 1ON6A 5C4BA 2BO6A 5FYEA 3USQA 1NQIB 4EE3A 1R7TA 1VH3A 1H7FA 4LW3A 3OH3A 1ZI4A 1ZCVA 3RMVA 4KNXA 1G3LA 1G23A 1LZJA 1FXOA 1ZJPA 4P00A 5AJNA 1ZJ0A 5L6VA 2Y7AA 2VXMA 3U2WA 1VM8A 3DUVA 2PGVA 4FQWA 2FFUA 1ZDFA 1VZXA 1HM8A 3D8VA 5IDSA 3ZLKA 3E26A 1FWYA 1IIMA 1NMMB 1FOAA 5FTSA 1H7EA 5CMGX 1FRWA 2RIXA 5FV9A 4FRDA 1H7HA 1QG8A 2PGYA 1O7QA 3SXCA 2D7IA 1GA8A 4DDZA 1Z90A 4FRBA 2XWLA 4EEGA 2YQJA 4NAKA 2VFZA 2JCKA 1FR9A 5C1GA 1MP4A 1LL2A 3I0KA 2MZBA 5BXCA 3CU0A 1ZHJA 3Q4SA 3OH4A 1S4PA 3SXDA 5I1FA 2AECA 2X60A 3I0IX 1H4EA 4K6RA 1ZJ2A 3FWWA 2RIYA 2RITA 4M2AA 5C36A 5AJOA 1OMZA 4B2WA 2FYAA 3FOQA 2ZU8A 3K8EA 3SX5A 2E8BA 3EE5A 2V0LA 3D5NA 1WT1A 3I0FA 4JD0A 4G3SA 1O7OA 5C3DA 4EEMA 1YP4A 2AM4A 4DECA 2FY7A 2RJ9A 2I5EA 4BMAA 1LL0A 4AYLA 4E1KA 2YQCA 4JISA 2OI5A 4CJCA 1NWGB 3V90A 1G0RA 1TW5A 1H5SA 4B5BA 4NAIA 1R82A 3PKPA 3TZTA 1ZCUA 4B4GA 3I0JA 1WT0A 1WSZA 1TZFA 3V0NA 2FFVA 4B3UA 3N9WA 1KWSA 2UX8A 1XZ6A 2I5KA 2O1FA 2FYDB 1G2VA 1SS9A 3R2WA 2Y4KA 1PZTA 2Y4MA 4C2SA 1GWWA 2GGQA 2O1GA 2AH9A 2WVMA 3QVBA 1EZIA 3CKJA 4M4KA 4Y62A 4EE5A 4FRLA 2WGZA 2P73A 3U0YA 1G8OA 3U0XA 1QWJA 1ZI1A 1FR8A 2WE9A 3V0OA 1G1LA 1H7QA 3IOJA 1R7VA 3POLA 1S4NA 1V83A 2Y4JA 2ZU7A 4CVHA 3U2XA 1FGXA 5C47A 4IRQA 2WAWA 3V0PA 3JUJA 2YCMA 3OGZA 2RJ1A 4IRPA 4KRVA 4XWIA 1O0RA 1ZJ1A 2D0JA 4G87A 1JYLA 4HG6A 2Z87A 1JVGA 4HO4A 2X5SA 4KNRA 2WVKA 5IDTA 1FO9A 3K8DA 5CMIA 3DK5A 4CJ8A 4HCQA 1E5KA 1ZCTA 5C4FA 3SPTA 1LZ7A 3BCVA 2XWNA 4J18A 1JVDA 3F1CA 3RMWA 4LW6A 2RJ4A 1LL3A 3OH1A 5C3BA 2YQHA 2A8WA 4EE4A 2WVLA 5FTVA 3HL3A 1R7YA 2OEFA 1FG5N 2APCA 5CMJA 1V84A 4YS8A 4KC2A 2DPWA 2ICYA 4AC3A 3Q7UA 1FO8A 4FRPA 1MC3A 3I0GA 2Y6PA 2YC5A 3IOIA 3TQDA 1IINA 1GQ9A 1H5SD 1ON8A 1XHBA 2GGOA 3E25A 2WEEA 4B42A 4Y6NA 2I7BA 4HO9A 3I0HA 2OI7A 2BO4A 1JV1A 1NF5B 3D98A 1I52A 2X65A 4GBPA 3T7OA 3T7MA 2VD4A 3GUEA 4FCEA 3U2VA
chains in the Genus database with same CATH superfamily
4FRMA 5JQQA 3LW6A 4FRAA 1H5TB 4D11A 2XWMA 3NGWA 1G93A 3CKVA 3SX7A 1ZI3A 3I0LA 1ZDGA 3USRA 2W0WA 1FZWA 5D91A 1WVCA 5C49A 2JCOA 3I0EA 2Q4JA 3Q80A 5CQOA 2C0NA 3SX8A 2BO8A 2QH5A 3V8ZA 4B4MA 1FGGA 1HV9A 2RJ7A 2ZU9A 1EYRA 4Y7UA 4M28A 3CGXA 3SXAA 4D48A 4AYJA 1YP2A 3OAMA 5EJ1A 1INJA 5J49A 1ZCYA 2VXLA 4Y7TA 1G95A 1H3MA 5CQNX 4KC1A 1H7TA 2AE7A 2Y4LA 3PNNA 5C4DA 4ASYA 4D0TA 3OKRA 1HJJA 2V0JA 2ICXA 4ARWA 1YP3A 3F1YA 3O3PA 2O1HA 4M2BA 4G3PA 1K4VA 3V0MA 1HM0A 4EVWA 1W57A 4MNDA 1H7LA 1H5RA 1O23B 3BRKX 4Y9XA 1VZUA 2A8UA 1W55A 4FRQA 4DE7A 5L6SA 2AESA 1VGWA 3PKQA 3SXBA 3RSBA 4ECMA 1LZIA 3ZGGA 4EEAA 4G3QA 2RJ6A 1H4DA 2CU2A 1OMXA 5FUHA 1H5SC 5HS2A 5C48A 5IFYA 2OI6A 2VSIA 4KPXA 5CMHA 3I0CA 4FROA 3U2TA 2VS5A 2VS4A 1V82A 3ST8A 4Y63A 5C4CA 1YROB 3OC9A 4BQHA 1JV3A 1R7XA 2OEGA 3I0DA 3OH2A 1VGTA 5DDTA 5FU0A 1VZTA 3V91A 3SXGA 3JTJA 4NALA 1NKHB 3CKNA 5DDVA 3DJ4A 4ZDQA 1R81A 1W77A 5C3AA 1HJLA 2FYBA 4EEOA 1R80A 4Y7VA 3V0QA 4ASJA 5EIYA 4FCUA 3V8YA 3ZF8A 2XMHA 5CQMX 2RIZA 5C38A 4Q7CA 1ZI5A 3U2UA 4HO0A 4L41C 5FU8A 2VK9A 2AM3A 5D92A 4UEGA 1VH1A 3ZLLA 4FIYA 4FREA 2J0AA 2V0IA 1VGZA 5C1LA 2P72A 1S4OA 4Y64A 4FIXA 1MP5A 1QGQA 1H4CA 4Y7GA 1JYKA 1VPAA 2YC3A 1GX4A 1WT3A 5C1HA 3CKOA 1H5TA 1TW1A 2D7RA 2YESA 3R3IA 4HO3A 4R7PA 4P02A 1LZ0A 1LVWA 1GQCA 3JUKA 2RJ8A 4NANA 4HO5A 2X5ZA 4KXOA 2JCLA 4B4BA 2Z86A 2NXVA 2AM5A 2VS3A 5AJPA 1ZJ3A 3CKQA 1ZIZA 4KPZA 1H5SB 1INIA 4HO8A 4D0ZA 1OQMB 2JCJA 4HOCA 1GWVA 4HO2A 2V0HA 5C8RA 3IOHA 1VICA 1GX0A 1G97A 2QGIA 2RJ5A 2AGDA 1H7GA 1FXJA 1NHEB 4Y6UA 3T7NA 1TVYA 4KC4A 3V0LA 4FRHA 5CQLX 1PZYB 1MP3A 1WT2A 2BO7A 2J0BA 4O6NA 1R7UA 4Y7FA 2PX7A 2QKXA 3ZGFA 5EJZA 4KT7A 2XMEA 4AAWA 4HO6A 2V0KA 4CJBA 3SX3A 1VGUA 4KQLA 2VSHA 4D11C 1QGSA 2RJ0A 2PA4A 1ZJOA 2P6WA 4B2XA 2FYCB 2YQSA 3OH0A 5CQPA 1G9RA 1H5RB 5CMFX 2E3DA 1HM9A 3KIAA 4MYBA 2W0VA 3SXEA 5C4EA 1ON6A 5C4BA 2BO6A 5FYEA 3USQA 1NQIB 4EE3A 1R7TA 1VH3A 1H7FA 4LW3A 3OH3A 1ZI4A 1ZCVA 3RMVA 4KNXA 1G3LA 1G23A 1LZJA 1FXOA 1ZJPA 4O6MA 4P00A 5AJNA 1ZJ0A 5L6VA 2Y7AA 2VXMA 3U2WA 1VM8A 3DUVA 2PGVA 4FQWA 2FFUA 1ZDFA 1VZXA 1HM8A 3D8VA 5IDSA 3ZLKA 3E26A 1FWYA 1IIMA 1NMMB 1FOAA 5FTSA 1H7EA 5CMGX 1FRWA 2RIXA 5FV9A 4FRDA 1H7HA 1QG8A 2PGYA 1O7QA 3SXCA 2D7IA 1GA8A 4DDZA 1Z90A 4FRBA 2XWLA 4EEGA 2YQJA 4NAKA 2VFZA 2JCKA 1FR9A 5C1GA 1MP4A 1LL2A 3I0KA 2MZBA 5BXCA 3CU0A 1ZHJA 3Q4SA 3OH4A 1S4PA 3SXDA 5I1FA 2AECA 2X60A 3I0IX 1H4EA 4K6RA 1ZJ2A 3FWWA 2RIYA 2RITA 4M2AA 5C36A 5AJOA 1OMZA 4B2WA 2FYAA 3FOQA 2ZU8A 3K8EA 3SX5A 2E8BA 3EE5A 2V0LA 3D5NA 1WT1A 3I0FA 4JD0A 4G3SA 1O7OA 5C3DA 4EEMA 1YP4A 2AM4A 4DECA 2FY7A 2RJ9A 2I5EA 4BMAA 1LL0A 4AYLA 4E1KA 2YQCA 4JISA 2OI5A 4CJCA 1NWGB 3V90A 1G0RA 1TW5A 1H5SA 4B5BA 4NAIA 1R82A 3PKPA 3TZTA 1ZCUA 4B4GA 3I0JA 1WT0A 1WSZA 1TZFA 3V0NA 2FFVA 4B3UA 3N9WA 1KWSA 2UX8A 1XZ6A 2I5KA 2O1FA 2FYDB 1G2VA 1SS9A 3R2WA 2Y4KA 1PZTA 2Y4MA 4C2SA 1GWWA 2GGQA 2O1GA 2AH9A 2WVMA 3QVBA 1EZIA 3CKJA 4M4KA 4Y62A 4EE5A 4FRLA 2WGZA 2P73A 3U0YA 1G8OA 3U0XA 1QWJA 1ZI1A 1FR8A 2WE9A 3V0OA 1G1LA 1H7QA 3IOJA 1R7VA 3POLA 1S4NA 1V83A 2Y4JA 2ZU7A 4CVHA 3U2XA 1FGXA 5C47A 4IRQA 2WAWA 3V0PA 3JUJA 2YCMA 3OGZA 2RJ1A 4IRPA 4KRVA 4XWIA 1O0RA 1ZJ1A 2D0JA 4G87A 1JYLA 4HG6A 2Z87A 1JVGA 4HO4A 2X5SA 4KNRA 2WVKA 5IDTA 1FO9A 3K8DA 5CMIA 3DK5A 4CJ8A 4HCQA 1E5KA 1ZCTA 5C4FA 3SPTA 1LZ7A 3BCVA 2XWNA 4J18A 1JVDA 3F1CA 3RMWA 4LW6A 2RJ4A 1LL3A 3OH1A 5C3BA 2YQHA 2A8WA 4EE4A 2WVLA 5FTVA 3HL3A 1R7YA 2OEFA 1FG5N 2APCA 5CMJA 1V84A 4YS8A 4KC2A 2DPWA 2ICYA 4AC3A 3Q7UA 1FO8A 4FRPA 1MC3A 3I0GA 4MIXA 2Y6PA 2YC5A 3IOIA 3TQDA 1IINA 1GQ9A 1H5SD 1ON8A 1XHBA 2GGOA 3E25A 2WEEA 4B42A 4Y6NA 2I7BA 4HO9A 3I0HA 2OI7A 2BO4A 1JV1A 1NF5B 3D98A 1I52A 2X65A 4GBPA 3T7OA 3T7MA 2VD4A 3GUEA 4FCEA 3U2VA
chains in the Genus database with same CATH topology
4FRMA 5JQQA 3LW6A 4FRAA 1H5TB 4D11A 2XWMA 3NGWA 1G93A 3CKVA 3SX7A 1ZI3A 3I0LA 1ZDGA 3USRA 2W0WA 1FZWA 5D91A 1WVCA 5C49A 2JCOA 3I0EA 2Q4JA 3Q80A 5CQOA 2C0NA 3SX8A 2BO8A 2QH5A 3V8ZA 4B4MA 1FGGA 1HV9A 2RJ7A 2ZU9A 1EYRA 4Y7UA 4M28A 3CGXA 3SXAA 4D48A 4AYJA 1YP2A 3OAMA 5EJ1A 1INJA 5J49A 1ZCYA 2VXLA 4Y7TA 1G95A 1H3MA 5CQNX 4KC1A 1H7TA 2AE7A 2Y4LA 3PNNA 5C4DA 4ASYA 4D0TA 3OKRA 1HJJA 2V0JA 2ICXA 4ARWA 1YP3A 3F1YA 3O3PA 2O1HA 4M2BA 4G3PA 1K4VA 3V0MA 1HM0A 4EVWA 1W57A 4MNDA 1H7LA 1H5RA 1O23B 3BRKX 4Y9XA 1VZUA 2A8UA 1W55A 4FRQA 4DE7A 5L6SA 2AESA 1VGWA 3PKQA 3SXBA 3RSBA 4ECMA 1LZIA 3ZGGA 4EEAA 4G3QA 2RJ6A 1H4DA 2CU2A 1OMXA 5FUHA 1H5SC 5HS2A 5C48A 5IFYA 2OI6A 2VSIA 4KPXA 5CMHA 3I0CA 4FROA 3U2TA 2VS5A 2VS4A 1V82A 3ST8A 4Y63A 5C4CA 1YROB 3OC9A 4BQHA 1JV3A 1R7XA 2OEGA 3I0DA 3OH2A 1VGTA 5DDTA 5FU0A 1VZTA 3V91A 3SXGA 3JTJA 4NALA 1NKHB 3CKNA 5DDVA 3DJ4A 4ZDQA 1R81A 1W77A 5C3AA 1HJLA 2FYBA 4EEOA 1R80A 4Y7VA 3V0QA 4ASJA 5EIYA 4FCUA 3V8YA 3ZF8A 2XMHA 5CQMX 2RIZA 5C38A 4Q7CA 1ZI5A 3U2UA 4HO0A 4L41C 5FU8A 2VK9A 2AM3A 5D92A 4UEGA 1VH1A 3ZLLA 4FIYA 4FREA 2J0AA 2V0IA 1VGZA 5C1LA 2P72A 1S4OA 4Y64A 4FIXA 1MP5A 1QGQA 1H4CA 4Y7GA 1JYKA 1VPAA 2YC3A 1GX4A 1WT3A 5C1HA 3CKOA 1H5TA 1TW1A 2D7RA 2YESA 3R3IA 4HO3A 4R7PA 4P02A 1LZ0A 1LVWA 1GQCA 3JUKA 2RJ8A 4NANA 4HO5A 2X5ZA 4KXOA 2JCLA 4B4BA 2Z86A 2NXVA 2AM5A 2VS3A 5AJPA 1ZJ3A 3CKQA 1ZIZA 4KPZA 1H5SB 1INIA 4HO8A 4D0ZA 1OQMB 2JCJA 4HOCA 1GWVA 4HO2A 2V0HA 5C8RA 3IOHA 1VICA 1GX0A 1G97A 2QGIA 2RJ5A 2AGDA 1H7GA 1FXJA 1NHEB 4Y6UA 3T7NA 1TVYA 4KC4A 3V0LA 4FRHA 5CQLX 1PZYB 1MP3A 1WT2A 2BO7A 2J0BA 4O6NA 1R7UA 4Y7FA 2PX7A 2QKXA 3ZGFA 5EJZA 4KT7A 2XMEA 4AAWA 4HO6A 2V0KA 4CJBA 3SX3A 1VGUA 4KQLA 2VSHA 4D11C 1QGSA 2RJ0A 2PA4A 1ZJOA 2P6WA 4B2XA 2FYCB 2YQSA 3OH0A 5CQPA 1G9RA 1H5RB 5CMFX 2E3DA 1HM9A 3KIAA 4MYBA 2W0VA 3SXEA 5C4EA 1ON6A 5C4BA 2BO6A 5FYEA 3USQA 1NQIB 4EE3A 1R7TA 1VH3A 1H7FA 4LW3A 3OH3A 1ZI4A 1ZCVA 3RMVA 4KNXA 1G3LA 1G23A 1LZJA 1FXOA 1ZJPA 4O6MA 4P00A 5AJNA 1ZJ0A 5L6VA 2Y7AA 2VXMA 3U2WA 1VM8A 3DUVA 2PGVA 4FQWA 2FFUA 1ZDFA 1VZXA 1HM8A 3D8VA 5IDSA 3ZLKA 3E26A 1FWYA 1IIMA 1NMMB 1FOAA 5FTSA 1H7EA 5CMGX 1FRWA 2RIXA 5FV9A 4FRDA 1H7HA 1QG8A 2PGYA 1O7QA 3SXCA 2D7IA 1GA8A 4DDZA 1Z90A 4FRBA 2XWLA 4EEGA 2YQJA 4NAKA 2VFZA 2JCKA 1FR9A 5C1GA 1MP4A 1LL2A 3I0KA 2MZBA 5BXCA 3CU0A 1ZHJA 3Q4SA 3OH4A 1S4PA 3SXDA 5I1FA 2AECA 2X60A 3I0IX 1H4EA 4K6RA 1ZJ2A 3FWWA 2RIYA 2RITA 4M2AA 5C36A 5AJOA 1OMZA 4B2WA 2FYAA 3FOQA 2ZU8A 3K8EA 3SX5A 2E8BA 3EE5A 2V0LA 3D5NA 1WT1A 3I0FA 4JD0A 4G3SA 1O7OA 5C3DA 4EEMA 1YP4A 2AM4A 4DECA 2FY7A 2RJ9A 2I5EA 4BMAA 1LL0A 4AYLA 4E1KA 2YQCA 4JISA 2OI5A 4CJCA 1NWGB 3V90A 1G0RA 1TW5A 1H5SA 4B5BA 4NAIA 1R82A 3PKPA 3TZTA 1ZCUA 4B4GA 3I0JA 1WT0A 1WSZA 1TZFA 3V0NA 2FFVA 4B3UA 3N9WA 1KWSA 2UX8A 1XZ6A 2I5KA 2O1FA 2FYDB 1G2VA 1SS9A 3R2WA 2Y4KA 1PZTA 2Y4MA 4C2SA 1GWWA 2GGQA 2O1GA 2AH9A 2WVMA 3QVBA 1EZIA 3CKJA 4M4KA 4Y62A 4EE5A 4FRLA 2WGZA 2P73A 3U0YA 1G8OA 3U0XA 1QWJA 1ZI1A 1FR8A 2WE9A 3V0OA 1G1LA 1H7QA 3IOJA 1R7VA 3POLA 1S4NA 1V83A 2Y4JA 2ZU7A 4CVHA 3U2XA 1FGXA 5C47A 4IRQA 2WAWA 3V0PA 3JUJA 2YCMA 3OGZA 2RJ1A 4IRPA 4KRVA 4XWIA 1O0RA 1ZJ1A 2D0JA 4G87A 1JYLA 4HG6A 2Z87A 1JVGA 4HO4A 2X5SA 4KNRA 2WVKA 5IDTA 1FO9A 3K8DA 5CMIA 3DK5A 4CJ8A 4HCQA 1E5KA 1ZCTA 5C4FA 3SPTA 1LZ7A 3BCVA 2XWNA 4J18A 1JVDA 3F1CA 3RMWA 4LW6A 2RJ4A 1LL3A 3OH1A 5C3BA 2YQHA 2A8WA 4EE4A 2WVLA 5FTVA 3HL3A 1R7YA 2OEFA 1FG5N 2APCA 5CMJA 1V84A 4YS8A 4KC2A 2DPWA 2ICYA 4AC3A 3Q7UA 1FO8A 4FRPA 1MC3A 3I0GA 4MIXA 2Y6PA 2YC5A 3IOIA 3TQDA 1IINA 1GQ9A 1H5SD 1ON8A 1XHBA 2GGOA 3E25A 2WEEA 4B42A 4Y6NA 2I7BA 4HO9A 3I0HA 2OI7A 2BO4A 1JV1A 1NF5B 3D98A 1I52A 2X65A 4GBPA 3T7OA 3T7MA 2VD4A 3GUEA 4FCEA 3U2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRM A;  5JQQ A;  3LW6 A;  4FRA A;  1H5T B;  4D11 A;  2XWM A;  3NGW A;  1G93 A;  3CKV A;  3SX7 A;  1ZI3 A;  3I0L A;  1ZDG A;  3USR A;  2W0W A;  1FZW A;  5C49 A;  1WVC A;  2JCO A;  3I0E A;  2Q4J A;  3Q80 A;  5CQO A;  3SX8 A;  2BO8 A;  2QH5 A;  3V8Z A;  4B4M A;  1FGG A;  1HV9 A;  2RJ7 A;  2ZU9 A;  1EYR A;  4Y7U A;  4M28 A;  3CGX A;  3SXA A;  4D48 A;  4AYJ A;  1YP2 A;  3OAM A;  5EJ1 A;  1INJ A;  5J49 A;  1ZCY A;  2VXL A;  4Y7T A;  1G95 A;  1H3M A;  5CQN X;  4KC1 A;  1H7T A;  2AE7 A;  2Y4L A;  3PNN A;  5C4D A;  4ASY A;  4D0T A;  3OKR A;  1HJJ A;  2V0J A;  2ICX A;  4ARW A;  1YP3 A;  3F1Y A;  3O3P A;  2O1H A;  4M2B A;  4G3P A;  1K4V A;  3V0M A;  1HM0 A;  4EVW A;  1W57 A;  4MND A;  1H7L A;  1H5R A;  1O23 B;  3BRK X;  4Y9X A;  1VZU A;  2A8U A;  1W55 A;  4FRQ A;  4DE7 A;  5L6S A;  2AES A;  1VGW A;  3PKQ A;  3SXB A;  3RSB A;  4ECM A;  1LZI A;  3ZGG A;  4EEA A;  4G3Q A;  2RJ6 A;  1H4D A;  2CU2 A;  1OMX A;  5FUH A;  1H5S C;  5HS2 A;  5C48 A;  5IFY A;  2OI6 A;  2VSI A;  4KPX A;  5CMH A;  3I0C A;  4FRO A;  3U2T A;  2VS5 A;  2VS4 A;  1V82 A;  3ST8 A;  4Y63 A;  5C4C A;  1YRO B;  3OC9 A;  4BQH A;  1JV3 A;  1R7X A;  2OEG A;  3I0D A;  3OH2 A;  1VGT A;  5DDT A;  5FU0 A;  1VZT A;  3V91 A;  3SXG A;  3JTJ A;  4NAL A;  1NKH B;  3CKN A;  5DDV A;  3DJ4 A;  4ZDQ A;  1R81 A;  1W77 A;  5C3A A;  1HJL A;  2FYB A;  4EEO A;  1R80 A;  4Y7V A;  3V0Q A;  4ASJ A;  5EIY A;  4FCU A;  3V8Y A;  3ZF8 A;  2XMH A;  5CQM X;  2RIZ A;  5C38 A;  1ZI5 A;  3U2U A;  4HO0 A;  4L41 C;  5FU8 A;  2AM3 A;  4UEG A;  1VH1 A;  3ZLL A;  4FRE A;  2V0I A;  1VGZ A;  5C1L A;  2P72 A;  1S4O A;  4Y64 A;  1MP5 A;  1QGQ A;  1H4C A;  4Y7G A;  1JYK A;  1VPA A;  2YC3 A;  1GX4 A;  1WT3 A;  5C1H A;  3CKO A;  1H5T A;  1TW1 A;  2D7R A;  2YES A;  3R3I A;  4HO3 A;  4R7P A;  4P02 A;  1LZ0 A;  1LVW A;  1GQC A;  3JUK A;  2RJ8 A;  4NAN A;  4HO5 A;  2X5Z A;  4KXO A;  2JCL A;  4B4B A;  2Z86 A;  2NXV A;  2AM5 A;  2VS3 A;  5AJP A;  1ZJ3 A;  3CKQ A;  1ZIZ A;  4KPZ A;  1H5S B;  1INI A;  4HO8 A;  4D0Z A;  1OQM B;  2JCJ A;  4HOC A;  1GWV A;  4HO2 A;  2V0H A;  5C8R A;  3IOH A;  1VIC A;  1GX0 A;  1G97 A;  2QGI A;  2RJ5 A;  2AGD A;  1H7G A;  1FXJ A;  1NHE B;  4Y6U A;  3T7N A;  1TVY A;  4KC4 A;  3V0L A;  4FRH A;  5CQL X;  1PZY B;  1MP3 A;  1WT2 A;  2BO7 A;  1R7U A;  4Y7F A;  2PX7 A;  2QKX A;  3ZGF A;  5EJZ A;  4KT7 A;  2XME A;  4AAW A;  4HO6 A;  2V0K A;  4CJB A;  3SX3 A;  1VGU A;  4KQL A;  2VSH A;  4D11 C;  1QGS A;  2RJ0 A;  2PA4 A;  1ZJO A;  2P6W A;  4B2X A;  2FYC B;  2YQS A;  3OH0 A;  5CQP A;  1G9R A;  1H5R B;  5CMF X;  2E3D A;  1HM9 A;  3KIA A;  4MYB A;  2W0V A;  3SXE A;  5C4E A;  1ON6 A;  5C4B A;  2BO6 A;  5FYE A;  3USQ A;  1NQI B;  4EE3 A;  1R7T A;  1VH3 A;  1H7F A;  4LW3 A;  3OH3 A;  1ZI4 A;  1ZCV A;  3RMV A;  4KNX A;  1G3L A;  1G23 A;  1LZJ A;  1FXO A;  1ZJP A;  4P00 A;  5AJN A;  1ZJ0 A;  5L6V A;  2Y7A A;  2VXM A;  3U2W A;  1VM8 A;  3DUV A;  2PGV A;  4FQW A;  2FFU A;  1ZDF A;  1VZX A;  1HM8 A;  3D8V A;  5IDS A;  3ZLK A;  3E26 A;  1FWY A;  1IIM A;  1NMM B;  1FOA A;  5FTS A;  1H7E A;  5CMG X;  1FRW A;  2RIX A;  5FV9 A;  4FRD A;  1H7H A;  1QG8 A;  2PGY A;  1O7Q A;  3SXC A;  2D7I A;  1GA8 A;  4DDZ A;  1Z90 A;  4FRB A;  2XWL A;  4EEG A;  2YQJ A;  4NAK A;  2VFZ A;  2JCK A;  1FR9 A;  5C1G A;  1MP4 A;  1LL2 A;  3I0K A;  2MZB A;  5BXC A;  3CU0 A;  1ZHJ A;  3Q4S A;  3OH4 A;  1S4P A;  3SXD A;  5I1F A;  2AEC A;  2X60 A;  3I0I X;  1H4E A;  4K6R A;  1ZJ2 A;  3FWW A;  2RIY A;  2RIT A;  4M2A A;  5C36 A;  5AJO A;  1OMZ A;  4B2W A;  2FYA A;  3FOQ A;  2ZU8 A;  3K8E A;  3SX5 A;  2E8B A;  3EE5 A;  2V0L A;  3D5N A;  1WT1 A;  3I0F A;  4JD0 A;  4G3S A;  1O7O A;  5C3D A;  4EEM A;  1YP4 A;  2AM4 A;  4DEC A;  2FY7 A;  2RJ9 A;  2I5E A;  4BMA A;  1LL0 A;  4AYL A;  4E1K A;  2YQC A;  4JIS A;  2OI5 A;  4CJC A;  1NWG B;  3V90 A;  1G0R A;  1TW5 A;  1H5S A;  4B5B A;  4NAI A;  1R82 A;  3PKP A;  3TZT A;  1ZCU A;  4B4G A;  3I0J A;  1WT0 A;  1WSZ A;  1TZF A;  3V0N A;  2FFV A;  4B3U A;  3N9W A;  1KWS A;  2UX8 A;  1XZ6 A;  2I5K A;  2O1F A;  2FYD B;  1G2V A;  1SS9 A;  3R2W A;  2Y4K A;  1PZT A;  2Y4M A;  4C2S A;  1GWW A;  2GGQ A;  2O1G A;  2AH9 A;  2WVM A;  3QVB A;  1EZI A;  3CKJ A;  4M4K A;  4Y62 A;  4EE5 A;  4FRL A;  2WGZ A;  2P73 A;  3U0Y A;  1G8O A;  3U0X A;  1QWJ A;  1ZI1 A;  1FR8 A;  2WE9 A;  3V0O A;  1G1L A;  1H7Q A;  3IOJ A;  1R7V A;  3POL A;  1S4N A;  1V83 A;  2Y4J A;  2ZU7 A;  4CVH A;  3U2X A;  1FGX A;  5C47 A;  4IRQ A;  2WAW A;  3V0P A;  3JUJ A;  2YCM A;  3OGZ A;  2RJ1 A;  4IRP A;  4KRV A;  4XWI A;  1O0R A;  1ZJ1 A;  2D0J A;  4G87 A;  1JYL A;  4HG6 A;  2Z87 A;  1JVG A;  4HO4 A;  2X5S A;  4KNR A;  2WVK A;  5IDT A;  1FO9 A;  3K8D A;  5CMI A;  3DK5 A;  4CJ8 A;  4HCQ A;  1E5K A;  1ZCT A;  5C4F A;  3SPT A;  1LZ7 A;  3BCV A;  2XWN A;  4J18 A;  1JVD A;  3F1C A;  3RMW A;  4LW6 A;  2RJ4 A;  1LL3 A;  3OH1 A;  5C3B A;  2YQH A;  2A8W A;  4EE4 A;  2WVL A;  5FTV A;  3HL3 A;  1R7Y A;  2OEF A;  1FG5 N;  2APC A;  5CMJ A;  1V84 A;  4YS8 A;  4KC2 A;  2DPW A;  2ICY A;  4AC3 A;  3Q7U A;  1FO8 A;  4FRP A;  1MC3 A;  3I0G A;  2Y6P A;  2YC5 A;  3IOI A;  3TQD A;  1IIN A;  1GQ9 A;  1H5S D;  1ON8 A;  1XHB A;  2GGO A;  3E25 A;  2WEE A;  4B42 A;  4Y6N A;  2I7B A;  4HO9 A;  3I0H A;  2OI7 A;  2BO4 A;  1JV1 A;  1NF5 B;  3D98 A;  1I52 A;  2X65 A;  4GBP A;  3T7O A;  3T7M A;  2VD4 A;  3GUE A;  4FCE A;  3U2V A; 
#chains in the Genus database with same CATH topology
 4FRM A;  5JQQ A;  3LW6 A;  4FRA A;  1H5T B;  4D11 A;  2XWM A;  3NGW A;  1G93 A;  3CKV A;  3SX7 A;  1ZI3 A;  3I0L A;  1ZDG A;  3USR A;  2W0W A;  1FZW A;  5D91 A;  1WVC A;  5C49 A;  2JCO A;  3I0E A;  2Q4J A;  3Q80 A;  5CQO A;  2C0N A;  3SX8 A;  2BO8 A;  2QH5 A;  3V8Z A;  4B4M A;  1FGG A;  1HV9 A;  2RJ7 A;  2ZU9 A;  1EYR A;  4Y7U A;  4M28 A;  3CGX A;  3SXA A;  4D48 A;  4AYJ A;  1YP2 A;  3OAM A;  5EJ1 A;  1INJ A;  5J49 A;  1ZCY A;  2VXL A;  4Y7T A;  1G95 A;  1H3M A;  5CQN X;  4KC1 A;  1H7T A;  2AE7 A;  2Y4L A;  3PNN A;  5C4D A;  4ASY A;  4D0T A;  3OKR A;  1HJJ A;  2V0J A;  2ICX A;  4ARW A;  1YP3 A;  3F1Y A;  3O3P A;  2O1H A;  4M2B A;  4G3P A;  1K4V A;  3V0M A;  1HM0 A;  4EVW A;  1W57 A;  4MND A;  1H7L A;  1H5R A;  1O23 B;  3BRK X;  4Y9X A;  1VZU A;  2A8U A;  1W55 A;  4FRQ A;  4DE7 A;  5L6S A;  2AES A;  1VGW A;  3PKQ A;  3SXB A;  3RSB A;  4ECM A;  1LZI A;  3ZGG A;  4EEA A;  4G3Q A;  2RJ6 A;  1H4D A;  2CU2 A;  1OMX A;  5FUH A;  1H5S C;  5HS2 A;  5C48 A;  5IFY A;  2OI6 A;  2VSI A;  4KPX A;  5CMH A;  3I0C A;  4FRO A;  3U2T A;  2VS5 A;  2VS4 A;  1V82 A;  3ST8 A;  4Y63 A;  5C4C A;  1YRO B;  3OC9 A;  4BQH A;  1JV3 A;  1R7X A;  2OEG A;  3I0D A;  3OH2 A;  1VGT A;  5DDT A;  5FU0 A;  1VZT A;  3V91 A;  3SXG A;  3JTJ A;  4NAL A;  1NKH B;  3CKN A;  5DDV A;  3DJ4 A;  4ZDQ A;  1R81 A;  1W77 A;  5C3A A;  1HJL A;  2FYB A;  4EEO A;  1R80 A;  4Y7V A;  3V0Q A;  4ASJ A;  5EIY A;  4FCU A;  3V8Y A;  3ZF8 A;  2XMH A;  5CQM X;  2RIZ A;  5C38 A;  4Q7C A;  1ZI5 A;  3U2U A;  4HO0 A;  4L41 C;  5FU8 A;  2VK9 A;  2AM3 A;  5D92 A;  4UEG A;  1VH1 A;  3ZLL A;  4FIY A;  4FRE A;  2J0A A;  2V0I A;  1VGZ A;  5C1L A;  2P72 A;  1S4O A;  4Y64 A;  4FIX A;  1MP5 A;  1QGQ A;  1H4C A;  4Y7G A;  1JYK A;  1VPA A;  2YC3 A;  1GX4 A;  1WT3 A;  5C1H A;  3CKO A;  1H5T A;  1TW1 A;  2D7R A;  2YES A;  3R3I A;  4HO3 A;  4R7P A;  4P02 A;  1LZ0 A;  1LVW A;  1GQC A;  3JUK A;  2RJ8 A;  4NAN A;  4HO5 A;  2X5Z A;  4KXO A;  2JCL A;  4B4B A;  2Z86 A;  2NXV A;  2AM5 A;  2VS3 A;  5AJP A;  1ZJ3 A;  3CKQ A;  1ZIZ A;  4KPZ A;  1H5S B;  1INI A;  4HO8 A;  4D0Z A;  1OQM B;  2JCJ A;  4HOC A;  1GWV A;  4HO2 A;  2V0H A;  5C8R A;  3IOH A;  1VIC A;  1GX0 A;  1G97 A;  2QGI A;  2RJ5 A;  2AGD A;  1H7G A;  1FXJ A;  1NHE B;  4Y6U A;  3T7N A;  1TVY A;  4KC4 A;  3V0L A;  4FRH A;  5CQL X;  1PZY B;  1MP3 A;  1WT2 A;  2BO7 A;  2J0B A;  4O6N A;  1R7U A;  4Y7F A;  2PX7 A;  2QKX A;  3ZGF A;  5EJZ A;  4KT7 A;  2XME A;  4AAW A;  4HO6 A;  2V0K A;  4CJB A;  3SX3 A;  1VGU A;  4KQL A;  2VSH A;  4D11 C;  1QGS A;  2RJ0 A;  2PA4 A;  1ZJO A;  2P6W A;  4B2X A;  2FYC B;  2YQS A;  3OH0 A;  5CQP A;  1G9R A;  1H5R B;  5CMF X;  2E3D A;  1HM9 A;  3KIA A;  4MYB A;  2W0V A;  3SXE A;  5C4E A;  1ON6 A;  5C4B A;  2BO6 A;  5FYE A;  3USQ A;  1NQI B;  4EE3 A;  1R7T A;  1VH3 A;  1H7F A;  4LW3 A;  3OH3 A;  1ZI4 A;  1ZCV A;  3RMV A;  4KNX A;  1G3L A;  1G23 A;  1LZJ A;  1FXO A;  1ZJP A;  4O6M A;  4P00 A;  5AJN A;  1ZJ0 A;  5L6V A;  2Y7A A;  2VXM A;  3U2W A;  1VM8 A;  3DUV A;  2PGV A;  4FQW A;  2FFU A;  1ZDF A;  1VZX A;  1HM8 A;  3D8V A;  5IDS A;  3ZLK A;  3E26 A;  1FWY A;  1IIM A;  1NMM B;  1FOA A;  5FTS A;  1H7E A;  5CMG X;  1FRW A;  2RIX A;  5FV9 A;  4FRD A;  1H7H A;  1QG8 A;  2PGY A;  1O7Q A;  3SXC A;  2D7I A;  1GA8 A;  4DDZ A;  1Z90 A;  4FRB A;  2XWL A;  4EEG A;  2YQJ A;  4NAK A;  2VFZ A;  2JCK A;  1FR9 A;  5C1G A;  1MP4 A;  1LL2 A;  3I0K A;  2MZB A;  5BXC A;  3CU0 A;  1ZHJ A;  3Q4S A;  3OH4 A;  1S4P A;  3SXD A;  5I1F A;  2AEC A;  2X60 A;  3I0I X;  1H4E A;  4K6R A;  1ZJ2 A;  3FWW A;  2RIY A;  2RIT A;  4M2A A;  5C36 A;  5AJO A;  1OMZ A;  4B2W A;  2FYA A;  3FOQ A;  2ZU8 A;  3K8E A;  3SX5 A;  2E8B A;  3EE5 A;  2V0L A;  3D5N A;  1WT1 A;  3I0F A;  4JD0 A;  4G3S A;  1O7O A;  5C3D A;  4EEM A;  1YP4 A;  2AM4 A;  4DEC A;  2FY7 A;  2RJ9 A;  2I5E A;  4BMA A;  1LL0 A;  4AYL A;  4E1K A;  2YQC A;  4JIS A;  2OI5 A;  4CJC A;  1NWG B;  3V90 A;  1G0R A;  1TW5 A;  1H5S A;  4B5B A;  4NAI A;  1R82 A;  3PKP A;  3TZT A;  1ZCU A;  4B4G A;  3I0J A;  1WT0 A;  1WSZ A;  1TZF A;  3V0N A;  2FFV A;  4B3U A;  3N9W A;  1KWS A;  2UX8 A;  1XZ6 A;  2I5K A;  2O1F A;  2FYD B;  1G2V A;  1SS9 A;  3R2W A;  2Y4K A;  1PZT A;  2Y4M A;  4C2S A;  1GWW A;  2GGQ A;  2O1G A;  2AH9 A;  2WVM A;  3QVB A;  1EZI A;  3CKJ A;  4M4K A;  4Y62 A;  4EE5 A;  4FRL A;  2WGZ A;  2P73 A;  3U0Y A;  1G8O A;  3U0X A;  1QWJ A;  1ZI1 A;  1FR8 A;  2WE9 A;  3V0O A;  1G1L A;  1H7Q A;  3IOJ A;  1R7V A;  3POL A;  1S4N A;  1V83 A;  2Y4J A;  2ZU7 A;  4CVH A;  3U2X A;  1FGX A;  5C47 A;  4IRQ A;  2WAW A;  3V0P A;  3JUJ A;  2YCM A;  3OGZ A;  2RJ1 A;  4IRP A;  4KRV A;  4XWI A;  1O0R A;  1ZJ1 A;  2D0J A;  4G87 A;  1JYL A;  4HG6 A;  2Z87 A;  1JVG A;  4HO4 A;  2X5S A;  4KNR A;  2WVK A;  5IDT A;  1FO9 A;  3K8D A;  5CMI A;  3DK5 A;  4CJ8 A;  4HCQ A;  1E5K A;  1ZCT A;  5C4F A;  3SPT A;  1LZ7 A;  3BCV A;  2XWN A;  4J18 A;  1JVD A;  3F1C A;  3RMW A;  4LW6 A;  2RJ4 A;  1LL3 A;  3OH1 A;  5C3B A;  2YQH A;  2A8W A;  4EE4 A;  2WVL A;  5FTV A;  3HL3 A;  1R7Y A;  2OEF A;  1FG5 N;  2APC A;  5CMJ A;  1V84 A;  4YS8 A;  4KC2 A;  2DPW A;  2ICY A;  4AC3 A;  3Q7U A;  1FO8 A;  4FRP A;  1MC3 A;  3I0G A;  4MIX A;  2Y6P A;  2YC5 A;  3IOI A;  3TQD A;  1IIN A;  1GQ9 A;  1H5S D;  1ON8 A;  1XHB A;  2GGO A;  3E25 A;  2WEE A;  4B42 A;  4Y6N A;  2I7B A;  4HO9 A;  3I0H A;  2OI7 A;  2BO4 A;  1JV1 A;  1NF5 B;  3D98 A;  1I52 A;  2X65 A;  4GBP A;  3T7O A;  3T7M A;  2VD4 A;  3GUE A;  4FCE A;  3U2V A; 
#chains in the Genus database with same CATH homology
 4FRM A;  5JQQ A;  3LW6 A;  4FRA A;  1H5T B;  4D11 A;  2XWM A;  3NGW A;  1G93 A;  3CKV A;  3SX7 A;  1ZI3 A;  3I0L A;  1ZDG A;  3USR A;  2W0W A;  1FZW A;  5D91 A;  1WVC A;  5C49 A;  2JCO A;  3I0E A;  2Q4J A;  3Q80 A;  5CQO A;  2C0N A;  3SX8 A;  2BO8 A;  2QH5 A;  3V8Z A;  4B4M A;  1FGG A;  1HV9 A;  2RJ7 A;  2ZU9 A;  1EYR A;  4Y7U A;  4M28 A;  3CGX A;  3SXA A;  4D48 A;  4AYJ A;  1YP2 A;  3OAM A;  5EJ1 A;  1INJ A;  5J49 A;  1ZCY A;  2VXL A;  4Y7T A;  1G95 A;  1H3M A;  5CQN X;  4KC1 A;  1H7T A;  2AE7 A;  2Y4L A;  3PNN A;  5C4D A;  4ASY A;  4D0T A;  3OKR A;  1HJJ A;  2V0J A;  2ICX A;  4ARW A;  1YP3 A;  3F1Y A;  3O3P A;  2O1H A;  4M2B A;  4G3P A;  1K4V A;  3V0M A;  1HM0 A;  4EVW A;  1W57 A;  4MND A;  1H7L A;  1H5R A;  1O23 B;  3BRK X;  4Y9X A;  1VZU A;  2A8U A;  1W55 A;  4FRQ A;  4DE7 A;  5L6S A;  2AES A;  1VGW A;  3PKQ A;  3SXB A;  3RSB A;  4ECM A;  1LZI A;  3ZGG A;  4EEA A;  4G3Q A;  2RJ6 A;  1H4D A;  2CU2 A;  1OMX A;  5FUH A;  1H5S C;  5HS2 A;  5C48 A;  5IFY A;  2OI6 A;  2VSI A;  4KPX A;  5CMH A;  3I0C A;  4FRO A;  3U2T A;  2VS5 A;  2VS4 A;  1V82 A;  3ST8 A;  4Y63 A;  5C4C A;  1YRO B;  3OC9 A;  4BQH A;  1JV3 A;  1R7X A;  2OEG A;  3I0D A;  3OH2 A;  1VGT A;  5DDT A;  5FU0 A;  1VZT A;  3V91 A;  3SXG A;  3JTJ A;  4NAL A;  1NKH B;  3CKN A;  5DDV A;  3DJ4 A;  4ZDQ A;  1R81 A;  1W77 A;  5C3A A;  1HJL A;  2FYB A;  4EEO A;  1R80 A;  4Y7V A;  3V0Q A;  4ASJ A;  5EIY A;  4FCU A;  3V8Y A;  3ZF8 A;  2XMH A;  5CQM X;  2RIZ A;  5C38 A;  4Q7C A;  1ZI5 A;  3U2U A;  4HO0 A;  4L41 C;  5FU8 A;  2VK9 A;  2AM3 A;  5D92 A;  4UEG A;  1VH1 A;  3ZLL A;  4FIY A;  4FRE A;  2J0A A;  2V0I A;  1VGZ A;  5C1L A;  2P72 A;  1S4O A;  4Y64 A;  4FIX A;  1MP5 A;  1QGQ A;  1H4C A;  4Y7G A;  1JYK A;  1VPA A;  2YC3 A;  1GX4 A;  1WT3 A;  5C1H A;  3CKO A;  1H5T A;  1TW1 A;  2D7R A;  2YES A;  3R3I A;  4HO3 A;  4R7P A;  4P02 A;  1LZ0 A;  1LVW A;  1GQC A;  3JUK A;  2RJ8 A;  4NAN A;  4HO5 A;  2X5Z A;  4KXO A;  2JCL A;  4B4B A;  2Z86 A;  2NXV A;  2AM5 A;  2VS3 A;  5AJP A;  1ZJ3 A;  3CKQ A;  1ZIZ A;  4KPZ A;  1H5S B;  1INI A;  4HO8 A;  4D0Z A;  1OQM B;  2JCJ A;  4HOC A;  1GWV A;  4HO2 A;  2V0H A;  5C8R A;  3IOH A;  1VIC A;  1GX0 A;  1G97 A;  2QGI A;  2RJ5 A;  2AGD A;  1H7G A;  1FXJ A;  1NHE B;  4Y6U A;  3T7N A;  1TVY A;  4KC4 A;  3V0L A;  4FRH A;  5CQL X;  1PZY B;  1MP3 A;  1WT2 A;  2BO7 A;  2J0B A;  4O6N A;  1R7U A;  4Y7F A;  2PX7 A;  2QKX A;  3ZGF A;  5EJZ A;  4KT7 A;  2XME A;  4AAW A;  4HO6 A;  2V0K A;  4CJB A;  3SX3 A;  1VGU A;  4KQL A;  2VSH A;  4D11 C;  1QGS A;  2RJ0 A;  2PA4 A;  1ZJO A;  2P6W A;  4B2X A;  2FYC B;  2YQS A;  3OH0 A;  5CQP A;  1G9R A;  1H5R B;  5CMF X;  2E3D A;  1HM9 A;  3KIA A;  4MYB A;  2W0V A;  3SXE A;  5C4E A;  1ON6 A;  5C4B A;  2BO6 A;  5FYE A;  3USQ A;  1NQI B;  4EE3 A;  1R7T A;  1VH3 A;  1H7F A;  4LW3 A;  3OH3 A;  1ZI4 A;  1ZCV A;  3RMV A;  4KNX A;  1G3L A;  1G23 A;  1LZJ A;  1FXO A;  1ZJP A;  4O6M A;  4P00 A;  5AJN A;  1ZJ0 A;  5L6V A;  2Y7A A;  2VXM A;  3U2W A;  1VM8 A;  3DUV A;  2PGV A;  4FQW A;  2FFU A;  1ZDF A;  1VZX A;  1HM8 A;  3D8V A;  5IDS A;  3ZLK A;  3E26 A;  1FWY A;  1IIM A;  1NMM B;  1FOA A;  5FTS A;  1H7E A;  5CMG X;  1FRW A;  2RIX A;  5FV9 A;  4FRD A;  1H7H A;  1QG8 A;  2PGY A;  1O7Q A;  3SXC A;  2D7I A;  1GA8 A;  4DDZ A;  1Z90 A;  4FRB A;  2XWL A;  4EEG A;  2YQJ A;  4NAK A;  2VFZ A;  2JCK A;  1FR9 A;  5C1G A;  1MP4 A;  1LL2 A;  3I0K A;  2MZB A;  5BXC A;  3CU0 A;  1ZHJ A;  3Q4S A;  3OH4 A;  1S4P A;  3SXD A;  5I1F A;  2AEC A;  2X60 A;  3I0I X;  1H4E A;  4K6R A;  1ZJ2 A;  3FWW A;  2RIY A;  2RIT A;  4M2A A;  5C36 A;  5AJO A;  1OMZ A;  4B2W A;  2FYA A;  3FOQ A;  2ZU8 A;  3K8E A;  3SX5 A;  2E8B A;  3EE5 A;  2V0L A;  3D5N A;  1WT1 A;  3I0F A;  4JD0 A;  4G3S A;  1O7O A;  5C3D A;  4EEM A;  1YP4 A;  2AM4 A;  4DEC A;  2FY7 A;  2RJ9 A;  2I5E A;  4BMA A;  1LL0 A;  4AYL A;  4E1K A;  2YQC A;  4JIS A;  2OI5 A;  4CJC A;  1NWG B;  3V90 A;  1G0R A;  1TW5 A;  1H5S A;  4B5B A;  4NAI A;  1R82 A;  3PKP A;  3TZT A;  1ZCU A;  4B4G A;  3I0J A;  1WT0 A;  1WSZ A;  1TZF A;  3V0N A;  2FFV A;  4B3U A;  3N9W A;  1KWS A;  2UX8 A;  1XZ6 A;  2I5K A;  2O1F A;  2FYD B;  1G2V A;  1SS9 A;  3R2W A;  2Y4K A;  1PZT A;  2Y4M A;  4C2S A;  1GWW A;  2GGQ A;  2O1G A;  2AH9 A;  2WVM A;  3QVB A;  1EZI A;  3CKJ A;  4M4K A;  4Y62 A;  4EE5 A;  4FRL A;  2WGZ A;  2P73 A;  3U0Y A;  1G8O A;  3U0X A;  1QWJ A;  1ZI1 A;  1FR8 A;  2WE9 A;  3V0O A;  1G1L A;  1H7Q A;  3IOJ A;  1R7V A;  3POL A;  1S4N A;  1V83 A;  2Y4J A;  2ZU7 A;  4CVH A;  3U2X A;  1FGX A;  5C47 A;  4IRQ A;  2WAW A;  3V0P A;  3JUJ A;  2YCM A;  3OGZ A;  2RJ1 A;  4IRP A;  4KRV A;  4XWI A;  1O0R A;  1ZJ1 A;  2D0J A;  4G87 A;  1JYL A;  4HG6 A;  2Z87 A;  1JVG A;  4HO4 A;  2X5S A;  4KNR A;  2WVK A;  5IDT A;  1FO9 A;  3K8D A;  5CMI A;  3DK5 A;  4CJ8 A;  4HCQ A;  1E5K A;  1ZCT A;  5C4F A;  3SPT A;  1LZ7 A;  3BCV A;  2XWN A;  4J18 A;  1JVD A;  3F1C A;  3RMW A;  4LW6 A;  2RJ4 A;  1LL3 A;  3OH1 A;  5C3B A;  2YQH A;  2A8W A;  4EE4 A;  2WVL A;  5FTV A;  3HL3 A;  1R7Y A;  2OEF A;  1FG5 N;  2APC A;  5CMJ A;  1V84 A;  4YS8 A;  4KC2 A;  2DPW A;  2ICY A;  4AC3 A;  3Q7U A;  1FO8 A;  4FRP A;  1MC3 A;  3I0G A;  4MIX A;  2Y6P A;  2YC5 A;  3IOI A;  3TQD A;  1IIN A;  1GQ9 A;  1H5S D;  1ON8 A;  1XHB A;  2GGO A;  3E25 A;  2WEE A;  4B42 A;  4Y6N A;  2I7B A;  4HO9 A;  3I0H A;  2OI7 A;  2BO4 A;  1JV1 A;  1NF5 B;  3D98 A;  1I52 A;  2X65 A;  4GBP A;  3T7O A;  3T7M A;  2VD4 A;  3GUE A;  4FCE A;  3U2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...