3U0XA

Crystal structure of the b-specific-1,3-galactosyltransferase (gtb) in complex with compound 382
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
290
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histo-blood group ABO system transferase
publication title A novel compound from a molecular fragment library screen inhibits glycosyltransferases by displacing the metal ion and interfering with substrate binding
rcsb
source organism Homo sapiens
total genus 96
structure length 290
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u0xA00
1G2VA 3ZGFA 1FR9A 3TZTA 2I5KA 4Y6UA 1LVWA 2Z86A 4B42A 1QG8A 3CKQA 4D0TA 1NHEB 5CQLX 2WGZA 4BMAA 4EVWA 1MP5A 1R80A 3SX7A 3U2XA 4HO5A 5C3AA 4G3PA 4Y64A 5FV9A 4MNDA 4EEMA 3V0MA 3U0YA 2FYAA 2FY7A 1GQCA 4YS8A 4FRQA 4FQWA 1PZTA 2OEFA 4HO0A 4KPXA 4HG6A 2WEEA 2OI7A 1JV3A 4FCEA 1H4EA 1ZI3A 4Y62A 2RIYA 1LZJA 1G95A 3RMVA 2GGOA 1E5KA 2ICYA 4FRHA 2VSHA 1H5TB 1R81A 3OKRA 4HO8A 2AGDA 4Y7TA 1XHBA 2RJ1A 1WT1A 1PZYB 1O23B 3CKNA 2JCJA 5CMJA 3ZLKA 1H7EA 2A8UA 3OH4A 4FRBA 1VH3A 2AE7A 3OGZA 4EEGA 2W0WA 5C36A 4P00A 2VFZA 4JISA 4B3UA 2AECA 1R7XA 4EE4A 3E26A 1S4NA 3FWWA 3RMWA 3I0LA 2YESA 1OMXA 2FFUA 2X60A 2PX7A 1ZJOA 1ZJ2A 4KT7A 1VGTA 5CQMX 1FGXA 2ZU9A 3F1CA 3OC9A 2VS5A 4Y63A 1KWSA 5C38A 4Y7UA 1MC3A 3F1YA 4DECA 1ZJ0A 2WE9A 3POLA 1JVGA 2Z87A 2V0HA 3D8VA 1ZCTA 3SXEA 2JCOA 4M4KA 4Y7FA 2W0VA 2RIZA 4BQHA 1H5SC 4AYJA 5EJZA 1QWJA 2AM4A 3FOQA 1JYKA 1GX0A 4EEOA 5EIYA 1H7QA 3CKVA 1H7LA 2VD4A 5IDSA 3RSBA 4K6RA 2UX8A 4XWIA 4B4MA 5JQQA 4G87A 1FGGA 3I0KA 4HO3A 2YC5A 5CQPA 5C4CA 1ZI4A 4IRPA 2WVKA 5C4EA 1ZDFA 2E8BA 3D98A 4Y9XA 4D0ZA 2RJ7A 1HM9A 2RIXA 3V90A 1LL0A 2Q4JA 1HM0A 1WVCA 1ZJPA 2D7IA 3BRKX 4CJCA 5I1FA 3SXBA 3K8DA 1GA8A 2YQJA 3SXCA 3T7MA 1ZCVA 3ST8A 4D48A 1TVYA 1ZJ3A 3R2WA 3USQA 3T7NA 1VPAA 1LL3A 1G93A 2PGVA 3IOIA 1H5SA 5L6VA 1EZIA 1H7FA 4M2AA 3U0XA 2RJ6A 4B2WA 3EE5A 4HO2A 1VICA 3JUJA 3V0PA 1TW1A 4G3QA 1JYLA 3USRA 1ON6A 4KXOA 4ZDQA 5C4DA 4FREA 3I0JA 4AC3A 1GWWA 1O7QA 4P02A 2O1HA 4KQLA 2WVLA 5FTVA 3V0OA 5L6SA 1G97A 4HO9A 1WT0A 3CKOA 3QVBA 5J49A 5AJOA 5C1LA 1FZWA 4Y6NA 2I7BA 2WVMA 3I0DA 5AJPA 3BCVA 5C1GA 3PKQA 4NAKA 4KC2A 3V0NA 4M28A 1LL2A 1HJJA 4EE3A 4CJBA 4ARWA 2MZBA 3OH0A 1W57A 4NANA 3JUKA 5C1HA 3DUVA 2VSIA 4KNXA 2Y4JA 4B2XA 1LZIA 1ON8A 1VGZA 1G0RA 2JCKA 2I5EA 1NMMB 1VGUA 4ASJA 2VS3A 3V8ZA 1ZCUA 1EYRA 3HL3A 1VM8A 2WAWA 3SX3A 3N9WA 2RITA 2XMHA 2NXVA 3CKJA 4B4BA 3OH1A 2DPWA 4KC1A 3U2WA 1JVDA 1K4VA 1LZ0A 2AESA 2VS4A 1H5TA 5CMFX 3SX5A 2P72A 1GX4A 4EE5A 1MP3A 1G23A 1H5RB 1W55A 3NGWA 5AJNA 3I0FA 2E3DA 4C2SA 2PGYA 2V0KA 3SXAA 1ZIZA 1NQIB 1YP4A 3SPTA 3E25A 2YQSA 4FCUA 2A8WA 5C3BA 2QH5A 3OH2A 1FXOA 2FYBA 1OQMB 1NWGB 2XMEA 4B5BA 3SXDA 1S4OA 1SS9A 1FRWA 4B4GA 5EJ1A 1NKHB 5CQNX 4FRDA 2RJ4A 3I0GA 1O7OA 1V82A 3ZLLA 2RJ9A 4FRAA 2RJ0A 3V8YA 1HJLA 5CMGX 1ZI1A 5FU8A 3Q7UA 4KPZA 1W77A 5DDVA 2JCLA 1H5RA 5C8RA 4KC4A 5C48A 1G3LA 2BO6A 5C3DA 2FFVA 3U2UA 3SXGA 2ZU7A 1FO9A 5C49A 1YP2A 3GUEA 1HM8A 5FUHA 2V0JA 3V91A 3IOHA 2APCA 2ICXA 3OH3A 4LW6A 1TZFA 1R7TA 4NAIA 1XZ6A 2XWMA 2FYCB 1GQ9A 2AM3A 1FWYA 1G9RA 2Y7AA 1G1LA 4Y7VA 4KNRA 1ZI5A 1Z90A 2FYDB 4FROA 5HS2A 2OI6A 5CMHA 3PKPA 4E1KA 1ZJ1A 2BO7A 2AM5A 4G3SA 2Y4KA 1YROB 1YP3A 2V0LA 5FYEA 5FU0A 4GBPA 1WSZA 4CJ8A 2Y6PA 4DE7A 1R7VA 5IDTA 1GWVA 2Y4MA 2O1FA 4LW3A 1IIMA 3SX8A 1R7YA 2YQHA 1H4CA 3DK5A 2YCMA 1VGWA 5FTSA 5C47A 4ECMA 4DDZA 4IRQA 2PA4A 1VH1A 1JV1A 3V0LA 3O3PA 4UEGA 3K8EA 3TQDA 2AH9A 3Q80A 1H7HA 4D11C 1H5SD 1INJA 1INIA 1H7TA 3D5NA 3JTJA 4KRVA 2VXLA 5IFYA 1I52A 1ZDGA 3I0CA 4FRPA 1G8OA 2OEGA 2XWNA 1NF5B 1QGSA 1ZHJA 1WT2A 1WT3A 3U2TA 2ZU8A 1H3MA 2BO4A 2OI5A 3I0HA 2QGIA 4FRLA 5CMIA 4HOCA 2V0IA 1H4DA 1R82A 5CQOA 5BXCA 1FO8A 4Y7GA 1HV9A 3I0EA 2RJ5A 2BO8A 4ASYA 3DJ4A 2VXMA 4HO6A 1ZCYA 2Y4LA 4R7PA 2D7RA 1FXJA 5C4BA 1MP4A 2YC3A 1LZ7A 1VZXA 2X65A 1OMZA 3KIAA 4EEAA 2XWLA 1FR8A 3R3IA 3T7OA 2X5SA 4D11A 2O1GA 3V0QA 4L41C 4AAWA 2QKXA 1IINA 3ZF8A 1VZUA 4MYBA 4M2BA 4CVHA 5DDTA 4AYLA 1H5SB 2X5ZA 1VZTA 3IOJA 2CU2A 3OAMA 3Q4SA 1H7GA 4NALA 2GGQA 1FOAA 3CU0A 3I0IX 1FG5N 1V83A 3U2VA 4HCQA 1R7UA 1TW5A 1QGQA 4HO4A 3ZGGA 1O0RA 4JD0A 2P73A 1S4PA 2RJ8A 2YQCA 1V84A 3PNNA 2D0JA 3LW6A 5C4FA 2P6WA 4J18A 4FRMA 3CGXA
chains in the Genus database with same CATH superfamily
1G2VA 3ZGFA 1FR9A 3TZTA 2I5KA 4Y6UA 1LVWA 2Z86A 4B42A 1QG8A 3CKQA 4D0TA 1NHEB 5CQLX 2WGZA 4BMAA 4EVWA 1MP5A 1R80A 3SX7A 3U2XA 4HO5A 5D92A 5C3AA 4G3PA 4Y64A 5FV9A 4MNDA 4EEMA 3V0MA 3U0YA 2FYAA 2FY7A 1GQCA 4YS8A 4FRQA 4FQWA 1PZTA 2OEFA 4HO0A 4KPXA 4HG6A 2WEEA 2OI7A 1JV3A 4FCEA 1H4EA 1ZI3A 4Y62A 2RIYA 1LZJA 1G95A 3RMVA 2GGOA 1E5KA 2ICYA 4FRHA 2VSHA 1H5TB 1R81A 3OKRA 4HO8A 2AGDA 4Y7TA 1XHBA 2RJ1A 1WT1A 1PZYB 1O23B 3CKNA 2JCJA 5CMJA 3ZLKA 1H7EA 2A8UA 3OH4A 4FRBA 1VH3A 2AE7A 3OGZA 4EEGA 2W0WA 5C36A 4P00A 2VFZA 4JISA 4B3UA 2AECA 1R7XA 4EE4A 3E26A 1S4NA 3FWWA 5D91A 3RMWA 3I0LA 2YESA 1OMXA 2FFUA 2X60A 2PX7A 1ZJOA 1ZJ2A 4KT7A 1VGTA 5CQMX 1FGXA 2ZU9A 3F1CA 3OC9A 2VS5A 4Y63A 1KWSA 5C38A 4Y7UA 1MC3A 3F1YA 4DECA 1ZJ0A 2WE9A 3POLA 1JVGA 2Z87A 2V0HA 3D8VA 1ZCTA 3SXEA 2JCOA 4M4KA 4Y7FA 2W0VA 2RIZA 4BQHA 1H5SC 4AYJA 5EJZA 1QWJA 2AM4A 3FOQA 1JYKA 1GX0A 4EEOA 5EIYA 1H7QA 3CKVA 1H7LA 2VD4A 5IDSA 3RSBA 4K6RA 2UX8A 4XWIA 4B4MA 5JQQA 4G87A 1FGGA 3I0KA 4HO3A 2YC5A 5CQPA 5C4CA 1ZI4A 4IRPA 2WVKA 5C4EA 1ZDFA 2E8BA 3D98A 4Y9XA 4D0ZA 2RJ7A 1HM9A 4MIXA 2RIXA 3V90A 1LL0A 4O6NA 2Q4JA 1HM0A 1WVCA 1ZJPA 2D7IA 3BRKX 4CJCA 5I1FA 3SXBA 3K8DA 1GA8A 2YQJA 3SXCA 3T7MA 1ZCVA 3ST8A 4D48A 1TVYA 1ZJ3A 3R2WA 3USQA 3T7NA 1VPAA 1LL3A 1G93A 2PGVA 3IOIA 1H5SA 5L6VA 1EZIA 1H7FA 4M2AA 3U0XA 2RJ6A 4B2WA 2J0BA 3EE5A 4HO2A 1VICA 3JUJA 3V0PA 1TW1A 4G3QA 1JYLA 3USRA 1ON6A 4KXOA 4ZDQA 5C4DA 4FREA 3I0JA 4AC3A 1GWWA 1O7QA 4P02A 2O1HA 4KQLA 2WVLA 5FTVA 3V0OA 4FIYA 5L6SA 2VK9A 1G97A 4HO9A 1WT0A 3CKOA 3QVBA 5J49A 5AJOA 5C1LA 1FZWA 4Y6NA 2I7BA 2WVMA 3I0DA 5AJPA 3BCVA 5C1GA 3PKQA 4NAKA 4KC2A 3V0NA 4M28A 1LL2A 1HJJA 4EE3A 4CJBA 4ARWA 2MZBA 3OH0A 1W57A 4NANA 3JUKA 5C1HA 3DUVA 2VSIA 4KNXA 2Y4JA 4B2XA 1LZIA 1ON8A 1VGZA 1G0RA 2JCKA 2I5EA 1NMMB 1VGUA 4ASJA 2VS3A 3V8ZA 1ZCUA 1EYRA 3HL3A 1VM8A 2WAWA 3SX3A 3N9WA 2RITA 2XMHA 2NXVA 3CKJA 4B4BA 3OH1A 2DPWA 4KC1A 3U2WA 1JVDA 1K4VA 1LZ0A 2AESA 2VS4A 1H5TA 5CMFX 3SX5A 2P72A 1GX4A 4EE5A 1MP3A 1G23A 1H5RB 1W55A 3NGWA 5AJNA 3I0FA 2E3DA 4C2SA 2PGYA 2V0KA 3SXAA 1ZIZA 1NQIB 1YP4A 3SPTA 3E25A 2YQSA 4FCUA 2A8WA 5C3BA 2QH5A 3OH2A 1FXOA 2FYBA 4FIXA 1OQMB 1NWGB 2J0AA 2XMEA 4B5BA 3SXDA 1S4OA 1SS9A 1FRWA 4B4GA 5EJ1A 1NKHB 5CQNX 4FRDA 2RJ4A 3I0GA 1O7OA 1V82A 3ZLLA 2RJ9A 4FRAA 2RJ0A 3V8YA 1HJLA 5CMGX 1ZI1A 5FU8A 3Q7UA 4KPZA 1W77A 5DDVA 2JCLA 1H5RA 5C8RA 4KC4A 5C48A 1G3LA 2BO6A 5C3DA 2FFVA 3U2UA 3SXGA 2ZU7A 1FO9A 5C49A 4Q7CA 1YP2A 3GUEA 1HM8A 5FUHA 2V0JA 3V91A 3IOHA 2APCA 2ICXA 3OH3A 4LW6A 1TZFA 1R7TA 4NAIA 1XZ6A 2XWMA 2FYCB 1GQ9A 2AM3A 1FWYA 1G9RA 2C0NA 2Y7AA 1G1LA 4Y7VA 4KNRA 1ZI5A 1Z90A 2FYDB 4FROA 5HS2A 2OI6A 5CMHA 3PKPA 4E1KA 1ZJ1A 2BO7A 2AM5A 4G3SA 2Y4KA 1YROB 1YP3A 2V0LA 5FYEA 5FU0A 4GBPA 1WSZA 4CJ8A 2Y6PA 4DE7A 1R7VA 5IDTA 1GWVA 2Y4MA 2O1FA 4LW3A 1IIMA 3SX8A 1R7YA 4O6MA 2YQHA 1H4CA 3DK5A 2YCMA 1VGWA 5FTSA 5C47A 4ECMA 4DDZA 4IRQA 2PA4A 1VH1A 1JV1A 3V0LA 3O3PA 4UEGA 3K8EA 3TQDA 2AH9A 3Q80A 1H7HA 4D11C 1H5SD 1INJA 1INIA 1H7TA 3D5NA 3JTJA 4KRVA 2VXLA 5IFYA 1I52A 1ZDGA 3I0CA 4FRPA 1G8OA 2OEGA 2XWNA 1NF5B 1QGSA 1ZHJA 1WT2A 1WT3A 3U2TA 2ZU8A 1H3MA 2BO4A 2OI5A 3I0HA 2QGIA 4FRLA 5CMIA 4HOCA 2V0IA 1H4DA 1R82A 5CQOA 5BXCA 1FO8A 4Y7GA 1HV9A 3I0EA 2RJ5A 2BO8A 4ASYA 3DJ4A 2VXMA 4HO6A 1ZCYA 2Y4LA 4R7PA 2D7RA 1FXJA 5C4BA 1MP4A 2YC3A 1LZ7A 1VZXA 2X65A 1OMZA 3KIAA 4EEAA 2XWLA 1FR8A 3R3IA 3T7OA 2X5SA 4D11A 2O1GA 3V0QA 4L41C 4AAWA 2QKXA 1IINA 3ZF8A 1VZUA 4MYBA 4M2BA 4CVHA 5DDTA 4AYLA 1H5SB 2X5ZA 1VZTA 3IOJA 2CU2A 3OAMA 3Q4SA 1H7GA 4NALA 2GGQA 1FOAA 3CU0A 3I0IX 1FG5N 1V83A 3U2VA 4HCQA 1R7UA 1TW5A 1QGQA 4HO4A 3ZGGA 1O0RA 4JD0A 2P73A 1S4PA 2RJ8A 2YQCA 1V84A 3PNNA 2D0JA 3LW6A 5C4FA 2P6WA 4J18A 4FRMA 3CGXA
chains in the Genus database with same CATH topology
1G2VA 3ZGFA 1FR9A 3TZTA 2I5KA 4Y6UA 1LVWA 2Z86A 4B42A 1QG8A 3CKQA 4D0TA 1NHEB 5CQLX 2WGZA 4BMAA 4EVWA 1MP5A 1R80A 3SX7A 3U2XA 4HO5A 5D92A 5C3AA 4G3PA 4Y64A 5FV9A 4MNDA 4EEMA 3V0MA 3U0YA 2FYAA 2FY7A 1GQCA 4YS8A 4FRQA 4FQWA 1PZTA 2OEFA 4HO0A 4KPXA 4HG6A 2WEEA 2OI7A 1JV3A 4FCEA 1H4EA 1ZI3A 4Y62A 2RIYA 1LZJA 1G95A 3RMVA 2GGOA 1E5KA 2ICYA 4FRHA 2VSHA 1H5TB 1R81A 3OKRA 4HO8A 2AGDA 4Y7TA 1XHBA 2RJ1A 1WT1A 1PZYB 1O23B 3CKNA 2JCJA 5CMJA 3ZLKA 1H7EA 2A8UA 3OH4A 4FRBA 1VH3A 2AE7A 3OGZA 4EEGA 2W0WA 5C36A 4P00A 2VFZA 4JISA 4B3UA 2AECA 1R7XA 4EE4A 3E26A 1S4NA 3FWWA 5D91A 3RMWA 3I0LA 2YESA 1OMXA 2FFUA 2X60A 2PX7A 1ZJOA 1ZJ2A 4KT7A 1VGTA 5CQMX 1FGXA 2ZU9A 3F1CA 3OC9A 2VS5A 4Y63A 1KWSA 5C38A 4Y7UA 1MC3A 3F1YA 4DECA 1ZJ0A 2WE9A 3POLA 1JVGA 2Z87A 2V0HA 3D8VA 1ZCTA 3SXEA 2JCOA 4M4KA 4Y7FA 2W0VA 2RIZA 4BQHA 1H5SC 4AYJA 5EJZA 1QWJA 2AM4A 3FOQA 1JYKA 1GX0A 4EEOA 5EIYA 1H7QA 3CKVA 1H7LA 2VD4A 5IDSA 3RSBA 4K6RA 2UX8A 4XWIA 4B4MA 5JQQA 4G87A 1FGGA 3I0KA 4HO3A 2YC5A 5CQPA 5C4CA 1ZI4A 4IRPA 2WVKA 5C4EA 1ZDFA 2E8BA 3D98A 4Y9XA 4D0ZA 2RJ7A 1HM9A 4MIXA 2RIXA 3V90A 1LL0A 4O6NA 2Q4JA 1HM0A 1WVCA 1ZJPA 2D7IA 3BRKX 4CJCA 5I1FA 3SXBA 3K8DA 1GA8A 2YQJA 3SXCA 3T7MA 1ZCVA 3ST8A 4D48A 1TVYA 1ZJ3A 3R2WA 3USQA 3T7NA 1VPAA 1LL3A 1G93A 2PGVA 3IOIA 1H5SA 5L6VA 1EZIA 1H7FA 4M2AA 3U0XA 2RJ6A 4B2WA 2J0BA 3EE5A 4HO2A 1VICA 3JUJA 3V0PA 1TW1A 4G3QA 1JYLA 3USRA 1ON6A 4KXOA 4ZDQA 5C4DA 4FREA 3I0JA 4AC3A 1GWWA 1O7QA 4P02A 2O1HA 4KQLA 2WVLA 5FTVA 3V0OA 4FIYA 5L6SA 2VK9A 1G97A 4HO9A 1WT0A 3CKOA 3QVBA 5J49A 5AJOA 5C1LA 1FZWA 4Y6NA 2I7BA 2WVMA 3I0DA 5AJPA 3BCVA 5C1GA 3PKQA 4NAKA 4KC2A 3V0NA 4M28A 1LL2A 1HJJA 4EE3A 4CJBA 4ARWA 2MZBA 3OH0A 1W57A 4NANA 3JUKA 5C1HA 3DUVA 2VSIA 4KNXA 2Y4JA 4B2XA 1LZIA 1ON8A 1VGZA 1G0RA 2JCKA 2I5EA 1NMMB 1VGUA 4ASJA 2VS3A 3V8ZA 1ZCUA 1EYRA 3HL3A 1VM8A 2WAWA 3SX3A 3N9WA 2RITA 2XMHA 2NXVA 3CKJA 4B4BA 3OH1A 2DPWA 4KC1A 3U2WA 1JVDA 1K4VA 1LZ0A 2AESA 2VS4A 1H5TA 5CMFX 3SX5A 2P72A 1GX4A 4EE5A 1MP3A 1G23A 1H5RB 1W55A 3NGWA 5AJNA 3I0FA 2E3DA 4C2SA 2PGYA 2V0KA 3SXAA 1ZIZA 1NQIB 1YP4A 3SPTA 3E25A 2YQSA 4FCUA 2A8WA 5C3BA 2QH5A 3OH2A 1FXOA 2FYBA 4FIXA 1OQMB 1NWGB 2J0AA 2XMEA 4B5BA 3SXDA 1S4OA 1SS9A 1FRWA 4B4GA 5EJ1A 1NKHB 5CQNX 4FRDA 2RJ4A 3I0GA 1O7OA 1V82A 3ZLLA 2RJ9A 4FRAA 2RJ0A 3V8YA 1HJLA 5CMGX 1ZI1A 5FU8A 3Q7UA 4KPZA 1W77A 5DDVA 2JCLA 1H5RA 5C8RA 4KC4A 5C48A 1G3LA 2BO6A 5C3DA 2FFVA 3U2UA 3SXGA 2ZU7A 1FO9A 5C49A 4Q7CA 1YP2A 3GUEA 1HM8A 5FUHA 2V0JA 3V91A 3IOHA 2APCA 2ICXA 3OH3A 4LW6A 1TZFA 1R7TA 4NAIA 1XZ6A 2XWMA 2FYCB 1GQ9A 2AM3A 1FWYA 1G9RA 2C0NA 2Y7AA 1G1LA 4Y7VA 4KNRA 1ZI5A 1Z90A 2FYDB 4FROA 5HS2A 2OI6A 5CMHA 3PKPA 4E1KA 1ZJ1A 2BO7A 2AM5A 4G3SA 2Y4KA 1YROB 1YP3A 2V0LA 5FYEA 5FU0A 4GBPA 1WSZA 4CJ8A 2Y6PA 4DE7A 1R7VA 5IDTA 1GWVA 2Y4MA 2O1FA 4LW3A 1IIMA 3SX8A 1R7YA 4O6MA 2YQHA 1H4CA 3DK5A 2YCMA 1VGWA 5FTSA 5C47A 4ECMA 4DDZA 4IRQA 2PA4A 1VH1A 1JV1A 3V0LA 3O3PA 4UEGA 3K8EA 3TQDA 2AH9A 3Q80A 1H7HA 4D11C 1H5SD 1INJA 1INIA 1H7TA 3D5NA 3JTJA 4KRVA 2VXLA 5IFYA 1I52A 1ZDGA 3I0CA 4FRPA 1G8OA 2OEGA 2XWNA 1NF5B 1QGSA 1ZHJA 1WT2A 1WT3A 3U2TA 2ZU8A 1H3MA 2BO4A 2OI5A 3I0HA 2QGIA 4FRLA 5CMIA 4HOCA 2V0IA 1H4DA 1R82A 5CQOA 5BXCA 1FO8A 4Y7GA 1HV9A 3I0EA 2RJ5A 2BO8A 4ASYA 3DJ4A 2VXMA 4HO6A 1ZCYA 2Y4LA 4R7PA 2D7RA 1FXJA 5C4BA 1MP4A 2YC3A 1LZ7A 1VZXA 2X65A 1OMZA 3KIAA 4EEAA 2XWLA 1FR8A 3R3IA 3T7OA 2X5SA 4D11A 2O1GA 3V0QA 4L41C 4AAWA 2QKXA 1IINA 3ZF8A 1VZUA 4MYBA 4M2BA 4CVHA 5DDTA 4AYLA 1H5SB 2X5ZA 1VZTA 3IOJA 2CU2A 3OAMA 3Q4SA 1H7GA 4NALA 2GGQA 1FOAA 3CU0A 3I0IX 1FG5N 1V83A 3U2VA 4HCQA 1R7UA 1TW5A 1QGQA 4HO4A 3ZGGA 1O0RA 4JD0A 2P73A 1S4PA 2RJ8A 2YQCA 1V84A 3PNNA 2D0JA 3LW6A 5C4FA 2P6WA 4J18A 4FRMA 3CGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2V A;  3ZGF A;  1FR9 A;  3TZT A;  2I5K A;  4Y6U A;  1LVW A;  2Z86 A;  4B42 A;  1QG8 A;  3CKQ A;  4D0T A;  1NHE B;  5CQL X;  2WGZ A;  4BMA A;  4EVW A;  1MP5 A;  1R80 A;  3SX7 A;  3U2X A;  4HO5 A;  5C3A A;  4G3P A;  4Y64 A;  5FV9 A;  4MND A;  4EEM A;  3V0M A;  3U0Y A;  2FYA A;  2FY7 A;  1GQC A;  4YS8 A;  4FRQ A;  4FQW A;  1PZT A;  2OEF A;  4HO0 A;  4KPX A;  4HG6 A;  2WEE A;  2OI7 A;  1JV3 A;  4FCE A;  1H4E A;  1ZI3 A;  4Y62 A;  2RIY A;  1LZJ A;  1G95 A;  3RMV A;  2GGO A;  1E5K A;  2ICY A;  4FRH A;  2VSH A;  1H5T B;  1R81 A;  3OKR A;  4HO8 A;  2AGD A;  4Y7T A;  1XHB A;  2RJ1 A;  1WT1 A;  1PZY B;  1O23 B;  3CKN A;  2JCJ A;  5CMJ A;  3ZLK A;  1H7E A;  2A8U A;  3OH4 A;  4FRB A;  1VH3 A;  2AE7 A;  3OGZ A;  4EEG A;  2W0W A;  5C36 A;  4P00 A;  2VFZ A;  4JIS A;  4B3U A;  2AEC A;  1R7X A;  4EE4 A;  3E26 A;  1S4N A;  3FWW A;  3RMW A;  3I0L A;  2YES A;  1OMX A;  2FFU A;  2X60 A;  2PX7 A;  1ZJO A;  1ZJ2 A;  4KT7 A;  1VGT A;  5CQM X;  1FGX A;  2ZU9 A;  3F1C A;  3OC9 A;  2VS5 A;  4Y63 A;  1KWS A;  5C38 A;  4Y7U A;  1MC3 A;  3F1Y A;  4DEC A;  1ZJ0 A;  2WE9 A;  3POL A;  1JVG A;  2Z87 A;  2V0H A;  3D8V A;  1ZCT A;  3SXE A;  2JCO A;  4M4K A;  4Y7F A;  2W0V A;  2RIZ A;  4BQH A;  1H5S C;  4AYJ A;  5EJZ A;  1QWJ A;  2AM4 A;  3FOQ A;  1JYK A;  1GX0 A;  4EEO A;  5EIY A;  1H7Q A;  3CKV A;  1H7L A;  2VD4 A;  5IDS A;  3RSB A;  4K6R A;  2UX8 A;  4XWI A;  4B4M A;  5JQQ A;  4G87 A;  1FGG A;  3I0K A;  4HO3 A;  2YC5 A;  5CQP A;  5C4C A;  1ZI4 A;  4IRP A;  2WVK A;  5C4E A;  1ZDF A;  2E8B A;  3D98 A;  4Y9X A;  4D0Z A;  2RJ7 A;  1HM9 A;  2RIX A;  3V90 A;  1LL0 A;  2Q4J A;  1HM0 A;  1WVC A;  1ZJP A;  2D7I A;  3BRK X;  4CJC A;  5I1F A;  3SXB A;  3K8D A;  1GA8 A;  2YQJ A;  3SXC A;  3T7M A;  1ZCV A;  3ST8 A;  4D48 A;  1TVY A;  1ZJ3 A;  3R2W A;  3USQ A;  3T7N A;  1VPA A;  1LL3 A;  1G93 A;  2PGV A;  3IOI A;  1H5S A;  5L6V A;  1EZI A;  1H7F A;  4M2A A;  3U0X A;  2RJ6 A;  4B2W A;  3EE5 A;  4HO2 A;  1VIC A;  3JUJ A;  3V0P A;  1TW1 A;  4G3Q A;  1JYL A;  3USR A;  1ON6 A;  4KXO A;  4ZDQ A;  5C4D A;  4FRE A;  3I0J A;  4AC3 A;  1GWW A;  1O7Q A;  4P02 A;  2O1H A;  4KQL A;  2WVL A;  5FTV A;  3V0O A;  5L6S A;  1G97 A;  4HO9 A;  1WT0 A;  3CKO A;  3QVB A;  5J49 A;  5AJO A;  5C1L A;  1FZW A;  4Y6N A;  2I7B A;  2WVM A;  3I0D A;  5AJP A;  3BCV A;  5C1G A;  3PKQ A;  4NAK A;  4KC2 A;  3V0N A;  4M28 A;  1LL2 A;  1HJJ A;  4EE3 A;  4CJB A;  4ARW A;  2MZB A;  3OH0 A;  1W57 A;  4NAN A;  3JUK A;  5C1H A;  3DUV A;  2VSI A;  4KNX A;  2Y4J A;  4B2X A;  1LZI A;  1ON8 A;  1VGZ A;  1G0R A;  2JCK A;  2I5E A;  1NMM B;  1VGU A;  4ASJ A;  2VS3 A;  3V8Z A;  1ZCU A;  1EYR A;  3HL3 A;  1VM8 A;  2WAW A;  3SX3 A;  3N9W A;  2RIT A;  2XMH A;  2NXV A;  3CKJ A;  4B4B A;  3OH1 A;  2DPW A;  4KC1 A;  3U2W A;  1JVD A;  1K4V A;  1LZ0 A;  2AES A;  2VS4 A;  1H5T A;  5CMF X;  3SX5 A;  2P72 A;  1GX4 A;  4EE5 A;  1MP3 A;  1G23 A;  1H5R B;  1W55 A;  3NGW A;  5AJN A;  3I0F A;  2E3D A;  4C2S A;  2PGY A;  2V0K A;  3SXA A;  1ZIZ A;  1NQI B;  1YP4 A;  3SPT A;  3E25 A;  2YQS A;  4FCU A;  2A8W A;  5C3B A;  2QH5 A;  3OH2 A;  1FXO A;  2FYB A;  1OQM B;  1NWG B;  2XME A;  4B5B A;  3SXD A;  1S4O A;  1SS9 A;  1FRW A;  4B4G A;  5EJ1 A;  1NKH B;  5CQN X;  4FRD A;  2RJ4 A;  3I0G A;  1O7O A;  1V82 A;  3ZLL A;  2RJ9 A;  4FRA A;  2RJ0 A;  3V8Y A;  1HJL A;  5CMG X;  1ZI1 A;  5FU8 A;  3Q7U A;  4KPZ A;  1W77 A;  5DDV A;  2JCL A;  1H5R A;  5C8R A;  4KC4 A;  5C48 A;  1G3L A;  2BO6 A;  5C3D A;  2FFV A;  3U2U A;  3SXG A;  2ZU7 A;  1FO9 A;  5C49 A;  1YP2 A;  3GUE A;  1HM8 A;  5FUH A;  2V0J A;  3V91 A;  3IOH A;  2APC A;  2ICX A;  3OH3 A;  4LW6 A;  1TZF A;  1R7T A;  4NAI A;  1XZ6 A;  2XWM A;  2FYC B;  1GQ9 A;  2AM3 A;  1FWY A;  1G9R A;  2Y7A A;  1G1L A;  4Y7V A;  4KNR A;  1ZI5 A;  1Z90 A;  2FYD B;  4FRO A;  5HS2 A;  2OI6 A;  5CMH A;  3PKP A;  4E1K A;  1ZJ1 A;  2BO7 A;  2AM5 A;  4G3S A;  2Y4K A;  1YRO B;  1YP3 A;  2V0L A;  5FYE A;  5FU0 A;  4GBP A;  1WSZ A;  4CJ8 A;  2Y6P A;  4DE7 A;  1R7V A;  5IDT A;  1GWV A;  2Y4M A;  2O1F A;  4LW3 A;  1IIM A;  3SX8 A;  1R7Y A;  2YQH A;  1H4C A;  3DK5 A;  2YCM A;  1VGW A;  5FTS A;  5C47 A;  4ECM A;  4DDZ A;  4IRQ A;  2PA4 A;  1VH1 A;  1JV1 A;  3V0L A;  3O3P A;  4UEG A;  3K8E A;  3TQD A;  2AH9 A;  3Q80 A;  1H7H A;  4D11 C;  1H5S D;  1INJ A;  1INI A;  1H7T A;  3D5N A;  3JTJ A;  4KRV A;  2VXL A;  5IFY A;  1I52 A;  1ZDG A;  3I0C A;  4FRP A;  1G8O A;  2OEG A;  2XWN A;  1NF5 B;  1QGS A;  1ZHJ A;  1WT2 A;  1WT3 A;  3U2T A;  2ZU8 A;  1H3M A;  2BO4 A;  2OI5 A;  3I0H A;  2QGI A;  4FRL A;  5CMI A;  4HOC A;  2V0I A;  1H4D A;  1R82 A;  5CQO A;  5BXC A;  1FO8 A;  4Y7G A;  1HV9 A;  3I0E A;  2RJ5 A;  2BO8 A;  4ASY A;  3DJ4 A;  2VXM A;  4HO6 A;  1ZCY A;  2Y4L A;  4R7P A;  2D7R A;  1FXJ A;  5C4B A;  1MP4 A;  2YC3 A;  1LZ7 A;  1VZX A;  2X65 A;  1OMZ A;  3KIA A;  4EEA A;  2XWL A;  1FR8 A;  3R3I A;  3T7O A;  2X5S A;  4D11 A;  2O1G A;  3V0Q A;  4L41 C;  4AAW A;  2QKX A;  1IIN A;  3ZF8 A;  1VZU A;  4MYB A;  4M2B A;  4CVH A;  5DDT A;  4AYL A;  1H5S B;  2X5Z A;  1VZT A;  3IOJ A;  2CU2 A;  3OAM A;  3Q4S A;  1H7G A;  4NAL A;  2GGQ A;  1FOA A;  3CU0 A;  3I0I X;  1FG5 N;  1V83 A;  3U2V A;  4HCQ A;  1R7U A;  1TW5 A;  1QGQ A;  4HO4 A;  3ZGG A;  1O0R A;  4JD0 A;  2P73 A;  1S4P A;  2RJ8 A;  2YQC A;  1V84 A;  3PNN A;  2D0J A;  3LW6 A;  5C4F A;  2P6W A;  4J18 A;  4FRM A;  3CGX A; 
#chains in the Genus database with same CATH topology
 1G2V A;  3ZGF A;  1FR9 A;  3TZT A;  2I5K A;  4Y6U A;  1LVW A;  2Z86 A;  4B42 A;  1QG8 A;  3CKQ A;  4D0T A;  1NHE B;  5CQL X;  2WGZ A;  4BMA A;  4EVW A;  1MP5 A;  1R80 A;  3SX7 A;  3U2X A;  4HO5 A;  5D92 A;  5C3A A;  4G3P A;  4Y64 A;  5FV9 A;  4MND A;  4EEM A;  3V0M A;  3U0Y A;  2FYA A;  2FY7 A;  1GQC A;  4YS8 A;  4FRQ A;  4FQW A;  1PZT A;  2OEF A;  4HO0 A;  4KPX A;  4HG6 A;  2WEE A;  2OI7 A;  1JV3 A;  4FCE A;  1H4E A;  1ZI3 A;  4Y62 A;  2RIY A;  1LZJ A;  1G95 A;  3RMV A;  2GGO A;  1E5K A;  2ICY A;  4FRH A;  2VSH A;  1H5T B;  1R81 A;  3OKR A;  4HO8 A;  2AGD A;  4Y7T A;  1XHB A;  2RJ1 A;  1WT1 A;  1PZY B;  1O23 B;  3CKN A;  2JCJ A;  5CMJ A;  3ZLK A;  1H7E A;  2A8U A;  3OH4 A;  4FRB A;  1VH3 A;  2AE7 A;  3OGZ A;  4EEG A;  2W0W A;  5C36 A;  4P00 A;  2VFZ A;  4JIS A;  4B3U A;  2AEC A;  1R7X A;  4EE4 A;  3E26 A;  1S4N A;  3FWW A;  5D91 A;  3RMW A;  3I0L A;  2YES A;  1OMX A;  2FFU A;  2X60 A;  2PX7 A;  1ZJO A;  1ZJ2 A;  4KT7 A;  1VGT A;  5CQM X;  1FGX A;  2ZU9 A;  3F1C A;  3OC9 A;  2VS5 A;  4Y63 A;  1KWS A;  5C38 A;  4Y7U A;  1MC3 A;  3F1Y A;  4DEC A;  1ZJ0 A;  2WE9 A;  3POL A;  1JVG A;  2Z87 A;  2V0H A;  3D8V A;  1ZCT A;  3SXE A;  2JCO A;  4M4K A;  4Y7F A;  2W0V A;  2RIZ A;  4BQH A;  1H5S C;  4AYJ A;  5EJZ A;  1QWJ A;  2AM4 A;  3FOQ A;  1JYK A;  1GX0 A;  4EEO A;  5EIY A;  1H7Q A;  3CKV A;  1H7L A;  2VD4 A;  5IDS A;  3RSB A;  4K6R A;  2UX8 A;  4XWI A;  4B4M A;  5JQQ A;  4G87 A;  1FGG A;  3I0K A;  4HO3 A;  2YC5 A;  5CQP A;  5C4C A;  1ZI4 A;  4IRP A;  2WVK A;  5C4E A;  1ZDF A;  2E8B A;  3D98 A;  4Y9X A;  4D0Z A;  2RJ7 A;  1HM9 A;  4MIX A;  2RIX A;  3V90 A;  1LL0 A;  4O6N A;  2Q4J A;  1HM0 A;  1WVC A;  1ZJP A;  2D7I A;  3BRK X;  4CJC A;  5I1F A;  3SXB A;  3K8D A;  1GA8 A;  2YQJ A;  3SXC A;  3T7M A;  1ZCV A;  3ST8 A;  4D48 A;  1TVY A;  1ZJ3 A;  3R2W A;  3USQ A;  3T7N A;  1VPA A;  1LL3 A;  1G93 A;  2PGV A;  3IOI A;  1H5S A;  5L6V A;  1EZI A;  1H7F A;  4M2A A;  3U0X A;  2RJ6 A;  4B2W A;  2J0B A;  3EE5 A;  4HO2 A;  1VIC A;  3JUJ A;  3V0P A;  1TW1 A;  4G3Q A;  1JYL A;  3USR A;  1ON6 A;  4KXO A;  4ZDQ A;  5C4D A;  4FRE A;  3I0J A;  4AC3 A;  1GWW A;  1O7Q A;  4P02 A;  2O1H A;  4KQL A;  2WVL A;  5FTV A;  3V0O A;  4FIY A;  5L6S A;  2VK9 A;  1G97 A;  4HO9 A;  1WT0 A;  3CKO A;  3QVB A;  5J49 A;  5AJO A;  5C1L A;  1FZW A;  4Y6N A;  2I7B A;  2WVM A;  3I0D A;  5AJP A;  3BCV A;  5C1G A;  3PKQ A;  4NAK A;  4KC2 A;  3V0N A;  4M28 A;  1LL2 A;  1HJJ A;  4EE3 A;  4CJB A;  4ARW A;  2MZB A;  3OH0 A;  1W57 A;  4NAN A;  3JUK A;  5C1H A;  3DUV A;  2VSI A;  4KNX A;  2Y4J A;  4B2X A;  1LZI A;  1ON8 A;  1VGZ A;  1G0R A;  2JCK A;  2I5E A;  1NMM B;  1VGU A;  4ASJ A;  2VS3 A;  3V8Z A;  1ZCU A;  1EYR A;  3HL3 A;  1VM8 A;  2WAW A;  3SX3 A;  3N9W A;  2RIT A;  2XMH A;  2NXV A;  3CKJ A;  4B4B A;  3OH1 A;  2DPW A;  4KC1 A;  3U2W A;  1JVD A;  1K4V A;  1LZ0 A;  2AES A;  2VS4 A;  1H5T A;  5CMF X;  3SX5 A;  2P72 A;  1GX4 A;  4EE5 A;  1MP3 A;  1G23 A;  1H5R B;  1W55 A;  3NGW A;  5AJN A;  3I0F A;  2E3D A;  4C2S A;  2PGY A;  2V0K A;  3SXA A;  1ZIZ A;  1NQI B;  1YP4 A;  3SPT A;  3E25 A;  2YQS A;  4FCU A;  2A8W A;  5C3B A;  2QH5 A;  3OH2 A;  1FXO A;  2FYB A;  4FIX A;  1OQM B;  1NWG B;  2J0A A;  2XME A;  4B5B A;  3SXD A;  1S4O A;  1SS9 A;  1FRW A;  4B4G A;  5EJ1 A;  1NKH B;  5CQN X;  4FRD A;  2RJ4 A;  3I0G A;  1O7O A;  1V82 A;  3ZLL A;  2RJ9 A;  4FRA A;  2RJ0 A;  3V8Y A;  1HJL A;  5CMG X;  1ZI1 A;  5FU8 A;  3Q7U A;  4KPZ A;  1W77 A;  5DDV A;  2JCL A;  1H5R A;  5C8R A;  4KC4 A;  5C48 A;  1G3L A;  2BO6 A;  5C3D A;  2FFV A;  3U2U A;  3SXG A;  2ZU7 A;  1FO9 A;  5C49 A;  4Q7C A;  1YP2 A;  3GUE A;  1HM8 A;  5FUH A;  2V0J A;  3V91 A;  3IOH A;  2APC A;  2ICX A;  3OH3 A;  4LW6 A;  1TZF A;  1R7T A;  4NAI A;  1XZ6 A;  2XWM A;  2FYC B;  1GQ9 A;  2AM3 A;  1FWY A;  1G9R A;  2C0N A;  2Y7A A;  1G1L A;  4Y7V A;  4KNR A;  1ZI5 A;  1Z90 A;  2FYD B;  4FRO A;  5HS2 A;  2OI6 A;  5CMH A;  3PKP A;  4E1K A;  1ZJ1 A;  2BO7 A;  2AM5 A;  4G3S A;  2Y4K A;  1YRO B;  1YP3 A;  2V0L A;  5FYE A;  5FU0 A;  4GBP A;  1WSZ A;  4CJ8 A;  2Y6P A;  4DE7 A;  1R7V A;  5IDT A;  1GWV A;  2Y4M A;  2O1F A;  4LW3 A;  1IIM A;  3SX8 A;  1R7Y A;  4O6M A;  2YQH A;  1H4C A;  3DK5 A;  2YCM A;  1VGW A;  5FTS A;  5C47 A;  4ECM A;  4DDZ A;  4IRQ A;  2PA4 A;  1VH1 A;  1JV1 A;  3V0L A;  3O3P A;  4UEG A;  3K8E A;  3TQD A;  2AH9 A;  3Q80 A;  1H7H A;  4D11 C;  1H5S D;  1INJ A;  1INI A;  1H7T A;  3D5N A;  3JTJ A;  4KRV A;  2VXL A;  5IFY A;  1I52 A;  1ZDG A;  3I0C A;  4FRP A;  1G8O A;  2OEG A;  2XWN A;  1NF5 B;  1QGS A;  1ZHJ A;  1WT2 A;  1WT3 A;  3U2T A;  2ZU8 A;  1H3M A;  2BO4 A;  2OI5 A;  3I0H A;  2QGI A;  4FRL A;  5CMI A;  4HOC A;  2V0I A;  1H4D A;  1R82 A;  5CQO A;  5BXC A;  1FO8 A;  4Y7G A;  1HV9 A;  3I0E A;  2RJ5 A;  2BO8 A;  4ASY A;  3DJ4 A;  2VXM A;  4HO6 A;  1ZCY A;  2Y4L A;  4R7P A;  2D7R A;  1FXJ A;  5C4B A;  1MP4 A;  2YC3 A;  1LZ7 A;  1VZX A;  2X65 A;  1OMZ A;  3KIA A;  4EEA A;  2XWL A;  1FR8 A;  3R3I A;  3T7O A;  2X5S A;  4D11 A;  2O1G A;  3V0Q A;  4L41 C;  4AAW A;  2QKX A;  1IIN A;  3ZF8 A;  1VZU A;  4MYB A;  4M2B A;  4CVH A;  5DDT A;  4AYL A;  1H5S B;  2X5Z A;  1VZT A;  3IOJ A;  2CU2 A;  3OAM A;  3Q4S A;  1H7G A;  4NAL A;  2GGQ A;  1FOA A;  3CU0 A;  3I0I X;  1FG5 N;  1V83 A;  3U2V A;  4HCQ A;  1R7U A;  1TW5 A;  1QGQ A;  4HO4 A;  3ZGG A;  1O0R A;  4JD0 A;  2P73 A;  1S4P A;  2RJ8 A;  2YQC A;  1V84 A;  3PNN A;  2D0J A;  3LW6 A;  5C4F A;  2P6W A;  4J18 A;  4FRM A;  3CGX A; 
#chains in the Genus database with same CATH homology
 1G2V A;  3ZGF A;  1FR9 A;  3TZT A;  2I5K A;  4Y6U A;  1LVW A;  2Z86 A;  4B42 A;  1QG8 A;  3CKQ A;  4D0T A;  1NHE B;  5CQL X;  2WGZ A;  4BMA A;  4EVW A;  1MP5 A;  1R80 A;  3SX7 A;  3U2X A;  4HO5 A;  5D92 A;  5C3A A;  4G3P A;  4Y64 A;  5FV9 A;  4MND A;  4EEM A;  3V0M A;  3U0Y A;  2FYA A;  2FY7 A;  1GQC A;  4YS8 A;  4FRQ A;  4FQW A;  1PZT A;  2OEF A;  4HO0 A;  4KPX A;  4HG6 A;  2WEE A;  2OI7 A;  1JV3 A;  4FCE A;  1H4E A;  1ZI3 A;  4Y62 A;  2RIY A;  1LZJ A;  1G95 A;  3RMV A;  2GGO A;  1E5K A;  2ICY A;  4FRH A;  2VSH A;  1H5T B;  1R81 A;  3OKR A;  4HO8 A;  2AGD A;  4Y7T A;  1XHB A;  2RJ1 A;  1WT1 A;  1PZY B;  1O23 B;  3CKN A;  2JCJ A;  5CMJ A;  3ZLK A;  1H7E A;  2A8U A;  3OH4 A;  4FRB A;  1VH3 A;  2AE7 A;  3OGZ A;  4EEG A;  2W0W A;  5C36 A;  4P00 A;  2VFZ A;  4JIS A;  4B3U A;  2AEC A;  1R7X A;  4EE4 A;  3E26 A;  1S4N A;  3FWW A;  5D91 A;  3RMW A;  3I0L A;  2YES A;  1OMX A;  2FFU A;  2X60 A;  2PX7 A;  1ZJO A;  1ZJ2 A;  4KT7 A;  1VGT A;  5CQM X;  1FGX A;  2ZU9 A;  3F1C A;  3OC9 A;  2VS5 A;  4Y63 A;  1KWS A;  5C38 A;  4Y7U A;  1MC3 A;  3F1Y A;  4DEC A;  1ZJ0 A;  2WE9 A;  3POL A;  1JVG A;  2Z87 A;  2V0H A;  3D8V A;  1ZCT A;  3SXE A;  2JCO A;  4M4K A;  4Y7F A;  2W0V A;  2RIZ A;  4BQH A;  1H5S C;  4AYJ A;  5EJZ A;  1QWJ A;  2AM4 A;  3FOQ A;  1JYK A;  1GX0 A;  4EEO A;  5EIY A;  1H7Q A;  3CKV A;  1H7L A;  2VD4 A;  5IDS A;  3RSB A;  4K6R A;  2UX8 A;  4XWI A;  4B4M A;  5JQQ A;  4G87 A;  1FGG A;  3I0K A;  4HO3 A;  2YC5 A;  5CQP A;  5C4C A;  1ZI4 A;  4IRP A;  2WVK A;  5C4E A;  1ZDF A;  2E8B A;  3D98 A;  4Y9X A;  4D0Z A;  2RJ7 A;  1HM9 A;  4MIX A;  2RIX A;  3V90 A;  1LL0 A;  4O6N A;  2Q4J A;  1HM0 A;  1WVC A;  1ZJP A;  2D7I A;  3BRK X;  4CJC A;  5I1F A;  3SXB A;  3K8D A;  1GA8 A;  2YQJ A;  3SXC A;  3T7M A;  1ZCV A;  3ST8 A;  4D48 A;  1TVY A;  1ZJ3 A;  3R2W A;  3USQ A;  3T7N A;  1VPA A;  1LL3 A;  1G93 A;  2PGV A;  3IOI A;  1H5S A;  5L6V A;  1EZI A;  1H7F A;  4M2A A;  3U0X A;  2RJ6 A;  4B2W A;  2J0B A;  3EE5 A;  4HO2 A;  1VIC A;  3JUJ A;  3V0P A;  1TW1 A;  4G3Q A;  1JYL A;  3USR A;  1ON6 A;  4KXO A;  4ZDQ A;  5C4D A;  4FRE A;  3I0J A;  4AC3 A;  1GWW A;  1O7Q A;  4P02 A;  2O1H A;  4KQL A;  2WVL A;  5FTV A;  3V0O A;  4FIY A;  5L6S A;  2VK9 A;  1G97 A;  4HO9 A;  1WT0 A;  3CKO A;  3QVB A;  5J49 A;  5AJO A;  5C1L A;  1FZW A;  4Y6N A;  2I7B A;  2WVM A;  3I0D A;  5AJP A;  3BCV A;  5C1G A;  3PKQ A;  4NAK A;  4KC2 A;  3V0N A;  4M28 A;  1LL2 A;  1HJJ A;  4EE3 A;  4CJB A;  4ARW A;  2MZB A;  3OH0 A;  1W57 A;  4NAN A;  3JUK A;  5C1H A;  3DUV A;  2VSI A;  4KNX A;  2Y4J A;  4B2X A;  1LZI A;  1ON8 A;  1VGZ A;  1G0R A;  2JCK A;  2I5E A;  1NMM B;  1VGU A;  4ASJ A;  2VS3 A;  3V8Z A;  1ZCU A;  1EYR A;  3HL3 A;  1VM8 A;  2WAW A;  3SX3 A;  3N9W A;  2RIT A;  2XMH A;  2NXV A;  3CKJ A;  4B4B A;  3OH1 A;  2DPW A;  4KC1 A;  3U2W A;  1JVD A;  1K4V A;  1LZ0 A;  2AES A;  2VS4 A;  1H5T A;  5CMF X;  3SX5 A;  2P72 A;  1GX4 A;  4EE5 A;  1MP3 A;  1G23 A;  1H5R B;  1W55 A;  3NGW A;  5AJN A;  3I0F A;  2E3D A;  4C2S A;  2PGY A;  2V0K A;  3SXA A;  1ZIZ A;  1NQI B;  1YP4 A;  3SPT A;  3E25 A;  2YQS A;  4FCU A;  2A8W A;  5C3B A;  2QH5 A;  3OH2 A;  1FXO A;  2FYB A;  4FIX A;  1OQM B;  1NWG B;  2J0A A;  2XME A;  4B5B A;  3SXD A;  1S4O A;  1SS9 A;  1FRW A;  4B4G A;  5EJ1 A;  1NKH B;  5CQN X;  4FRD A;  2RJ4 A;  3I0G A;  1O7O A;  1V82 A;  3ZLL A;  2RJ9 A;  4FRA A;  2RJ0 A;  3V8Y A;  1HJL A;  5CMG X;  1ZI1 A;  5FU8 A;  3Q7U A;  4KPZ A;  1W77 A;  5DDV A;  2JCL A;  1H5R A;  5C8R A;  4KC4 A;  5C48 A;  1G3L A;  2BO6 A;  5C3D A;  2FFV A;  3U2U A;  3SXG A;  2ZU7 A;  1FO9 A;  5C49 A;  4Q7C A;  1YP2 A;  3GUE A;  1HM8 A;  5FUH A;  2V0J A;  3V91 A;  3IOH A;  2APC A;  2ICX A;  3OH3 A;  4LW6 A;  1TZF A;  1R7T A;  4NAI A;  1XZ6 A;  2XWM A;  2FYC B;  1GQ9 A;  2AM3 A;  1FWY A;  1G9R A;  2C0N A;  2Y7A A;  1G1L A;  4Y7V A;  4KNR A;  1ZI5 A;  1Z90 A;  2FYD B;  4FRO A;  5HS2 A;  2OI6 A;  5CMH A;  3PKP A;  4E1K A;  1ZJ1 A;  2BO7 A;  2AM5 A;  4G3S A;  2Y4K A;  1YRO B;  1YP3 A;  2V0L A;  5FYE A;  5FU0 A;  4GBP A;  1WSZ A;  4CJ8 A;  2Y6P A;  4DE7 A;  1R7V A;  5IDT A;  1GWV A;  2Y4M A;  2O1F A;  4LW3 A;  1IIM A;  3SX8 A;  1R7Y A;  4O6M A;  2YQH A;  1H4C A;  3DK5 A;  2YCM A;  1VGW A;  5FTS A;  5C47 A;  4ECM A;  4DDZ A;  4IRQ A;  2PA4 A;  1VH1 A;  1JV1 A;  3V0L A;  3O3P A;  4UEG A;  3K8E A;  3TQD A;  2AH9 A;  3Q80 A;  1H7H A;  4D11 C;  1H5S D;  1INJ A;  1INI A;  1H7T A;  3D5N A;  3JTJ A;  4KRV A;  2VXL A;  5IFY A;  1I52 A;  1ZDG A;  3I0C A;  4FRP A;  1G8O A;  2OEG A;  2XWN A;  1NF5 B;  1QGS A;  1ZHJ A;  1WT2 A;  1WT3 A;  3U2T A;  2ZU8 A;  1H3M A;  2BO4 A;  2OI5 A;  3I0H A;  2QGI A;  4FRL A;  5CMI A;  4HOC A;  2V0I A;  1H4D A;  1R82 A;  5CQO A;  5BXC A;  1FO8 A;  4Y7G A;  1HV9 A;  3I0E A;  2RJ5 A;  2BO8 A;  4ASY A;  3DJ4 A;  2VXM A;  4HO6 A;  1ZCY A;  2Y4L A;  4R7P A;  2D7R A;  1FXJ A;  5C4B A;  1MP4 A;  2YC3 A;  1LZ7 A;  1VZX A;  2X65 A;  1OMZ A;  3KIA A;  4EEA A;  2XWL A;  1FR8 A;  3R3I A;  3T7O A;  2X5S A;  4D11 A;  2O1G A;  3V0Q A;  4L41 C;  4AAW A;  2QKX A;  1IIN A;  3ZF8 A;  1VZU A;  4MYB A;  4M2B A;  4CVH A;  5DDT A;  4AYL A;  1H5S B;  2X5Z A;  1VZT A;  3IOJ A;  2CU2 A;  3OAM A;  3Q4S A;  1H7G A;  4NAL A;  2GGQ A;  1FOA A;  3CU0 A;  3I0I X;  1FG5 N;  1V83 A;  3U2V A;  4HCQ A;  1R7U A;  1TW5 A;  1QGQ A;  4HO4 A;  3ZGG A;  1O0R A;  4JD0 A;  2P73 A;  1S4P A;  2RJ8 A;  2YQC A;  1V84 A;  3PNN A;  2D0J A;  3LW6 A;  5C4F A;  2P6W A;  4J18 A;  4FRM A;  3CGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...