3U0XA

Crystal structure of the b-specific-1,3-galactosyltransferase (gtb) in complex with compound 382
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
290
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title A novel compound from a molecular fragment library screen inhibits glycosyltransferases by displacing the metal ion and interfering with substrate binding
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 290
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u0xA00
4J18A 1FXJA 3R2WA 4NALA 2ZU8A 2PX7A 1H5SD 3DJ4A 4FCEA 1VGZA 1HJJA 2RJ5A 3V0LA 3IOJA 1HV9A 3SXBA 5J49A 4NAIA 1TZFA 4LW6A 2W0WA 4MYBA 4AYJA 1H7GA 5AJPA 5EJZA 1G0RA 1GQ9A 1GWWA 5CQOA 4CVHA 2AM4A 2JCKA 1R7XA 3JUKA 1MP5A 4Y7GA 2MZBA 1JVGA 2VSIA 3D5NA 4EEAA 3SX7A 2NXVA 2Y4MA 4JISA 4FRLA 1H4EA 2YQJA 2P72A 4IRQA 3LW6A 1G2VA 5IDSA 1VPAA 5C1GA 2UX8A 3ST8A 3U2UA 2AGDA 2RJ7A 1YP2A 1W77A 4HO5A 2CU2A 2A8UA 3OAMA 4FRPA 1R82A 1MP3A 4AYLA 3OC9A 5DDVA 1H7FA 1ZCVA 3E25A 1E5KA 3K8EA 3I0LA 1SS9A 4D48A 3Q80A 3OH0A 4G3PA 4Y62A 4M2BA 4Y64A 1ZDFA 3ZLLA 3CGXA 1G3LA 1ZJPA 4BMAA 5C1LA 4AC3A 4KQLA 3U0YA 2VS4A 3GUEA 3V90A 4ASYA 4B4MA 4B4BA 1JVDA 1LL0A 4DDZA 1V83A 1FOAA 1ZJ1A 3JUJA 1GX0A 1O23B 2OI7A 2V0JA 2WE9A 1H7EA 5L6SA 2OEFA 1VH1A 1GWVA 4G3QA 1HM8A 1INIA 1R80A 5C4FA 4EE4A 4ZDQA 2RIXA 3IOIA 2GGOA 1VH3A 1WT3A 1YP3A 1HM0A 1FGGA 2PGVA 2OEGA 4Y63A 5FUHA 3IOHA 1H4CA 2Z87A 4D0TA 1OMXA 3FOQA 2FYDB 3V0NA 2O1FA 1K4VA 4Y7VA 2A8WA 1NMMB 3RSBA 4HO8A 3O3PA 5FYEA 3ZGFA 5C1HA 2PA4A 1WT2A 4KC2A 5CMHA 4FREA 5C4BA 1YROB 4G3SA 3R3IA 4KPZA 3SX5A 3V0PA 1VGWA 1H5SA 1W57A 3USQA 3TZTA 4HO2A 1R7VA 3Q4SA 3OH3A 4FQWA 1IINA 3T7NA 4HO6A 1XZ6A 3OH2A 1GA8A 3SX8A 2XWLA 3DK5A 5BXCA 2BO7A 2WAWA 1VM8A 1WSZA 1MC3A 1JYKA 4P02A 4LW3A 4NANA 5DDTA 4HO9A 3TQDA 1INJA 4CJBA 5C4EA 1QGSA 3CKQA 1VGTA 4R7PA 2WVLA 2X65A 1EYRA 3KIAA 1H5RA 4M2AA 3JTJA 3I0EA 3U2WA 2XMEA 2VS5A 1MP4A 4KC1A 1H4DA 4L41C 4EEOA 1LZ7A 2GGQA 3OKRA 2RJ9A 3I0IX 4HOCA 2Y4KA 1NQIB 4KNXA 2ICYA 1S4OA 3Q7UA 1Z90A 2AESA 3RMWA 2X60A 2XWNA 2VD4A 1O7QA 4Y9XA 1WT0A 1LZJA 2Y7AA 5I1FA 3D98A 5L6VA 1R7UA 3I0GA 4EEGA 3V0MA 1H5SB 2XWMA 2RJ0A 2I5EA 5JQQA 1H5TB 3E26A 1R7TA 5AJNA 1VICA 4BQHA 3EE5A 1IIMA 2P6WA 3F1CA 4Y7TA 5C38A 1LVWA 2RJ1A 3I0FA 4KPXA 4ASJA 2V0KA 4IRPA 2FYCB 2P73A 1ZJ3A 4CJCA 5CQPA 4KC4A 3QVBA 5CQLX 3T7OA 4GBPA 2PGYA 1FG5N 2Y4JA 3SPTA 1FO9A 2YQSA 4B2XA 2AECA 2VSHA 5C8RA 1NHEB 3ZGGA 2QH5A 1H5RB 4B42A 5EJ1A 1HM9A 1ZDGA 1JV3A 2E3DA 3POLA 4P00A 4Y7FA 1G97A 1TVYA 4FRHA 2RIZA 1ZHJA 1ZI5A 5IFYA 3OH4A 4KNRA 4M4KA 1W55A 5CMFX 2YC3A 2RJ6A 2QKXA 1VZXA 3PNNA 5IDTA 2V0HA 4G87A 1G9RA 4FRMA 4UEGA 1H7HA 4JD0A 1H3MA 4HO4A 3BCVA 3PKPA 3SXCA 3F1YA 1V82A 1ZJOA 5EIYA 4EEMA 2W0VA 2WVMA 1ZI3A 3U2TA 3T7MA 4FRAA 3V0OA 4D11C 2JCOA 1ZI4A 5AJOA 3HL3A 5FV9A 1H7LA 3USRA 1OMZA 4K6RA 2D7IA 3K8DA 3CKVA 1ZJ0A 2O1GA 4FCUA 3ZLKA 5C3BA 3CKJA 1QG8A 1GQCA 1G95A 4FRDA 1FGXA 4CJ8A 1ZCYA 1V84A 2OI6A 2AM5A 2X5SA 4FRQA 4E1KA 2ICXA 4AAWA 3SXDA 1FZWA 2RJ4A 2Q4JA 5C36A 3DUVA 3PKQA 4Y7UA 4EVWA 4HCQA 1S4NA 2FYAA 3SXEA 1NWGB 2BO4A 2V0IA 4B2WA 1ZCTA 5FTSA 2FYBA 1R7YA 4D11A 2JCJA 3ZF8A 4HG6A 3I0HA 4HO0A 3RMVA 1G8OA 3CKOA 4YS8A 2QGIA 2YC5A 3OGZA 2WVKA 5C4CA 1QGQA 3D8VA 3V8YA 2BO8A 5C48A 2FFUA 2O1HA 2APCA 1FRWA 2YCMA 4XWIA 2AM3A 2E8BA 4ARWA 1NKHB 1LZIA 1ON6A 1G1LA 1VGUA 2XMHA 4DECA 4KXOA 2RITA 3I0CA 5C49A 5CMIA 1OQMB 1G93A 2Z86A 1LZ0A 1PZTA 5FU0A 2D0JA 1WVCA 2RJ8A 1FWYA 2V0LA 2YQHA 4C2SA 1ZI1A 4B3UA 3SX3A 4D0ZA 5CMJA 1YP4A 3SXAA 1HJLA 4NAKA 1JV1A 2Y6PA 2RIYA 4EE5A 1LL3A 5CMGX 3V0QA 1O7OA 1R81A 1WT1A 4HO3A 4DE7A 1PZYB 3CU0A 2YESA 1I52A 4B4GA 5C4DA 1H7QA 3U0XA 3U2XA 3I0JA 2VS3A 1QWJA 3U2VA 2WEEA 4M28A 1FXOA 2AE7A 3FWWA 3V91A 2JCLA 1TW1A 2ZU9A 2I7BA 2ZU7A 1ZJ2A 4KRVA 1H5SC 2D7RA 5C3AA 3CKNA 1O0RA 2VFZA 1LL2A 2OI5A 3BRKX 3NGWA 2X5ZA 1TW5A 2WGZA 4B5BA 4FRBA 4Y6UA 3I0KA 1KWSA 5CQMX 2YQCA 2FY7A 1VZUA 1G23A 1S4PA 5HS2A 1GX4A 1FO8A 2Y4LA 4KT7A 1H7TA 2FFVA 1JYLA 2BO6A 5CQNX 1XHBA 1ZIZA 4FROA 3I0DA 2VXMA 1ZCUA 5FTVA 4ECMA 2DPWA 4MNDA 3OH1A 1EZIA 1FR8A 2VXLA 3SXGA 5C3DA 1ON8A 1NF5B 5FU8A 1VZTA 3N9WA 2I5KA 3V8ZA 4EE3A 1H5TA 5C47A 1FR9A 4Y6NA 2AH9A
chains in the Genus database with same CATH superfamily
4J18A 1FXJA 3R2WA 4NALA 2ZU8A 2PX7A 1H5SD 3DJ4A 4FCEA 1VGZA 1HJJA 2RJ5A 3V0LA 3IOJA 1HV9A 3SXBA 5J49A 4NAIA 1TZFA 4LW6A 2W0WA 4MYBA 4AYJA 1H7GA 5AJPA 5D92A 5EJZA 1G0RA 1GQ9A 1GWWA 5CQOA 4CVHA 2AM4A 2JCKA 1R7XA 3JUKA 1MP5A 4Y7GA 2MZBA 1JVGA 2VSIA 3D5NA 4EEAA 3SX7A 2NXVA 2Y4MA 4JISA 4FRLA 1H4EA 2YQJA 2P72A 4IRQA 3LW6A 1G2VA 5IDSA 1VPAA 5C1GA 2UX8A 3ST8A 3U2UA 2AGDA 2RJ7A 1YP2A 1W77A 4HO5A 2CU2A 2A8UA 3OAMA 4FRPA 1R82A 1MP3A 4AYLA 3OC9A 5DDVA 1H7FA 1ZCVA 3E25A 1E5KA 3K8EA 3I0LA 1SS9A 4D48A 4O6NA 3Q80A 3OH0A 4G3PA 4Y62A 4M2BA 4Y64A 1ZDFA 3ZLLA 3CGXA 1G3LA 1ZJPA 4BMAA 5C1LA 4AC3A 4KQLA 3U0YA 2VS4A 3GUEA 3V90A 4ASYA 4B4MA 4B4BA 1JVDA 1LL0A 4DDZA 1V83A 1FOAA 1ZJ1A 3JUJA 1GX0A 1O23B 2OI7A 2V0JA 2WE9A 1H7EA 5L6SA 2OEFA 1VH1A 1GWVA 4G3QA 1HM8A 1INIA 1R80A 5C4FA 4EE4A 4ZDQA 2RIXA 3IOIA 2GGOA 1VH3A 1WT3A 1YP3A 1HM0A 1FGGA 2PGVA 2OEGA 4Y63A 5FUHA 2C0NA 3IOHA 1H4CA 2Z87A 4D0TA 1OMXA 3FOQA 2FYDB 3V0NA 2O1FA 1K4VA 4Y7VA 2A8WA 1NMMB 3RSBA 4HO8A 3O3PA 5FYEA 3ZGFA 5C1HA 2PA4A 1WT2A 4KC2A 5CMHA 4FREA 5C4BA 1YROB 4G3SA 3R3IA 4KPZA 3SX5A 3V0PA 1VGWA 1H5SA 1W57A 3USQA 3TZTA 4HO2A 1R7VA 3Q4SA 3OH3A 4FQWA 1IINA 4Q7CA 3T7NA 4HO6A 1XZ6A 3OH2A 1GA8A 5D91A 3SX8A 2XWLA 3DK5A 5BXCA 2BO7A 2WAWA 1VM8A 1WSZA 4MIXA 1MC3A 1JYKA 4P02A 4LW3A 4NANA 5DDTA 4HO9A 3TQDA 1INJA 4CJBA 5C4EA 1QGSA 3CKQA 1VGTA 4R7PA 2WVLA 2X65A 1EYRA 3KIAA 1H5RA 4M2AA 4FIYA 3JTJA 3I0EA 3U2WA 2XMEA 2VS5A 1MP4A 4KC1A 1H4DA 2J0BA 4L41C 4EEOA 1LZ7A 2GGQA 3OKRA 2RJ9A 3I0IX 4HOCA 2Y4KA 1NQIB 4KNXA 4O6MA 2ICYA 1S4OA 3Q7UA 1Z90A 2AESA 3RMWA 2X60A 2XWNA 2VD4A 1O7QA 4Y9XA 1WT0A 1LZJA 2Y7AA 5I1FA 3D98A 5L6VA 1R7UA 3I0GA 4EEGA 3V0MA 1H5SB 2XWMA 2RJ0A 2I5EA 5JQQA 1H5TB 3E26A 1R7TA 5AJNA 1VICA 4BQHA 3EE5A 1IIMA 2P6WA 3F1CA 4Y7TA 5C38A 1LVWA 2RJ1A 3I0FA 4KPXA 4ASJA 2V0KA 4IRPA 2FYCB 2P73A 1ZJ3A 4CJCA 5CQPA 4KC4A 3QVBA 5CQLX 3T7OA 4GBPA 2PGYA 1FG5N 2Y4JA 3SPTA 1FO9A 2YQSA 4B2XA 2AECA 2VSHA 5C8RA 1NHEB 3ZGGA 2QH5A 1H5RB 4B42A 5EJ1A 1HM9A 1ZDGA 1JV3A 2E3DA 3POLA 4P00A 4Y7FA 1G97A 1TVYA 4FRHA 2RIZA 1ZHJA 1ZI5A 5IFYA 3OH4A 4KNRA 4M4KA 1W55A 5CMFX 2YC3A 2RJ6A 2QKXA 1VZXA 3PNNA 5IDTA 2V0HA 4G87A 1G9RA 4FRMA 4UEGA 1H7HA 4JD0A 1H3MA 4HO4A 3BCVA 3PKPA 3SXCA 3F1YA 1V82A 1ZJOA 5EIYA 4EEMA 2W0VA 2WVMA 1ZI3A 3U2TA 3T7MA 2VK9A 4FRAA 3V0OA 4D11C 2JCOA 1ZI4A 5AJOA 3HL3A 5FV9A 1H7LA 3USRA 1OMZA 4K6RA 2D7IA 3K8DA 3CKVA 1ZJ0A 2O1GA 4FCUA 3ZLKA 5C3BA 3CKJA 1QG8A 1GQCA 1G95A 4FRDA 1FGXA 4CJ8A 1ZCYA 1V84A 2OI6A 2AM5A 2X5SA 4FRQA 4E1KA 2ICXA 4AAWA 3SXDA 1FZWA 2RJ4A 2Q4JA 5C36A 3DUVA 3PKQA 4Y7UA 4EVWA 4HCQA 1S4NA 2FYAA 3SXEA 1NWGB 2BO4A 2V0IA 4B2WA 1ZCTA 5FTSA 2FYBA 1R7YA 4D11A 2JCJA 3ZF8A 4HG6A 3I0HA 4HO0A 3RMVA 1G8OA 3CKOA 4YS8A 2QGIA 2YC5A 3OGZA 2WVKA 5C4CA 1QGQA 3D8VA 3V8YA 2BO8A 5C48A 2FFUA 2O1HA 2APCA 1FRWA 2YCMA 4XWIA 2AM3A 2E8BA 4ARWA 1NKHB 1LZIA 1ON6A 1G1LA 1VGUA 2XMHA 4DECA 4KXOA 2RITA 3I0CA 5C49A 5CMIA 1OQMB 1G93A 2Z86A 1LZ0A 1PZTA 5FU0A 2D0JA 1WVCA 2RJ8A 1FWYA 2V0LA 2YQHA 4C2SA 1ZI1A 4B3UA 3SX3A 4D0ZA 5CMJA 1YP4A 3SXAA 1HJLA 4NAKA 1JV1A 2Y6PA 2RIYA 4EE5A 1LL3A 5CMGX 3V0QA 1O7OA 1R81A 1WT1A 4HO3A 4DE7A 1PZYB 3CU0A 2YESA 1I52A 4B4GA 5C4DA 1H7QA 3U0XA 3U2XA 3I0JA 2VS3A 1QWJA 3U2VA 2WEEA 4M28A 1FXOA 2AE7A 3FWWA 3V91A 2JCLA 1TW1A 2ZU9A 2I7BA 2ZU7A 1ZJ2A 4KRVA 1H5SC 2D7RA 5C3AA 3CKNA 1O0RA 2VFZA 1LL2A 2OI5A 3BRKX 3NGWA 2X5ZA 1TW5A 2WGZA 4B5BA 4FRBA 4Y6UA 3I0KA 1KWSA 5CQMX 2YQCA 2FY7A 1VZUA 1G23A 1S4PA 5HS2A 1GX4A 1FO8A 2Y4LA 4KT7A 1H7TA 2FFVA 1JYLA 2BO6A 5CQNX 1XHBA 1ZIZA 4FROA 3I0DA 2VXMA 1ZCUA 5FTVA 4ECMA 2DPWA 4MNDA 3OH1A 1EZIA 1FR8A 2VXLA 3SXGA 2J0AA 5C3DA 1ON8A 1NF5B 4FIXA 5FU8A 1VZTA 3N9WA 2I5KA 3V8ZA 4EE3A 1H5TA 5C47A 1FR9A 4Y6NA 2AH9A
chains in the Genus database with same CATH topology
4J18A 1FXJA 3R2WA 4NALA 2ZU8A 2PX7A 1H5SD 3DJ4A 4FCEA 1VGZA 1HJJA 2RJ5A 3V0LA 3IOJA 1HV9A 3SXBA 5J49A 4NAIA 1TZFA 4LW6A 2W0WA 4MYBA 4AYJA 1H7GA 5AJPA 5D92A 5EJZA 1G0RA 1GQ9A 1GWWA 5CQOA 4CVHA 2AM4A 2JCKA 1R7XA 3JUKA 1MP5A 4Y7GA 2MZBA 1JVGA 2VSIA 3D5NA 4EEAA 3SX7A 2NXVA 2Y4MA 4JISA 4FRLA 1H4EA 2YQJA 2P72A 4IRQA 3LW6A 1G2VA 5IDSA 1VPAA 5C1GA 2UX8A 3ST8A 3U2UA 2AGDA 2RJ7A 1YP2A 1W77A 4HO5A 2CU2A 2A8UA 3OAMA 4FRPA 1R82A 1MP3A 4AYLA 3OC9A 5DDVA 1H7FA 1ZCVA 3E25A 1E5KA 3K8EA 3I0LA 1SS9A 4D48A 4O6NA 3Q80A 3OH0A 4G3PA 4Y62A 4M2BA 4Y64A 1ZDFA 3ZLLA 3CGXA 1G3LA 1ZJPA 4BMAA 5C1LA 4AC3A 4KQLA 3U0YA 2VS4A 3GUEA 3V90A 4ASYA 4B4MA 4B4BA 1JVDA 1LL0A 4DDZA 1V83A 1FOAA 1ZJ1A 3JUJA 1GX0A 1O23B 2OI7A 2V0JA 2WE9A 1H7EA 5L6SA 2OEFA 1VH1A 1GWVA 4G3QA 1HM8A 1INIA 1R80A 5C4FA 4EE4A 4ZDQA 2RIXA 3IOIA 2GGOA 1VH3A 1WT3A 1YP3A 1HM0A 1FGGA 2PGVA 2OEGA 4Y63A 5FUHA 2C0NA 3IOHA 1H4CA 2Z87A 4D0TA 1OMXA 3FOQA 2FYDB 3V0NA 2O1FA 1K4VA 4Y7VA 2A8WA 1NMMB 3RSBA 4HO8A 3O3PA 5FYEA 3ZGFA 5C1HA 2PA4A 1WT2A 4KC2A 5CMHA 4FREA 5C4BA 1YROB 4G3SA 3R3IA 4KPZA 3SX5A 3V0PA 1VGWA 1H5SA 1W57A 3USQA 3TZTA 4HO2A 1R7VA 3Q4SA 3OH3A 4FQWA 1IINA 4Q7CA 3T7NA 4HO6A 1XZ6A 3OH2A 1GA8A 5D91A 3SX8A 2XWLA 3DK5A 5BXCA 2BO7A 2WAWA 1VM8A 1WSZA 4MIXA 1MC3A 1JYKA 4P02A 4LW3A 4NANA 5DDTA 4HO9A 3TQDA 1INJA 4CJBA 5C4EA 1QGSA 3CKQA 1VGTA 4R7PA 2WVLA 2X65A 1EYRA 3KIAA 1H5RA 4M2AA 4FIYA 3JTJA 3I0EA 3U2WA 2XMEA 2VS5A 1MP4A 4KC1A 1H4DA 2J0BA 4L41C 4EEOA 1LZ7A 2GGQA 3OKRA 2RJ9A 3I0IX 4HOCA 2Y4KA 1NQIB 4KNXA 4O6MA 2ICYA 1S4OA 3Q7UA 1Z90A 2AESA 3RMWA 2X60A 2XWNA 2VD4A 1O7QA 4Y9XA 1WT0A 1LZJA 2Y7AA 5I1FA 3D98A 5L6VA 1R7UA 3I0GA 4EEGA 3V0MA 1H5SB 2XWMA 2RJ0A 2I5EA 5JQQA 1H5TB 3E26A 1R7TA 5AJNA 1VICA 4BQHA 3EE5A 1IIMA 2P6WA 3F1CA 4Y7TA 5C38A 1LVWA 2RJ1A 3I0FA 4KPXA 4ASJA 2V0KA 4IRPA 2FYCB 2P73A 1ZJ3A 4CJCA 5CQPA 4KC4A 3QVBA 5CQLX 3T7OA 4GBPA 2PGYA 1FG5N 2Y4JA 3SPTA 1FO9A 2YQSA 4B2XA 2AECA 2VSHA 5C8RA 1NHEB 3ZGGA 2QH5A 1H5RB 4B42A 5EJ1A 1HM9A 1ZDGA 1JV3A 2E3DA 3POLA 4P00A 4Y7FA 1G97A 1TVYA 4FRHA 2RIZA 1ZHJA 1ZI5A 5IFYA 3OH4A 4KNRA 4M4KA 1W55A 5CMFX 2YC3A 2RJ6A 2QKXA 1VZXA 3PNNA 5IDTA 2V0HA 4G87A 1G9RA 4FRMA 4UEGA 1H7HA 4JD0A 1H3MA 4HO4A 3BCVA 3PKPA 3SXCA 3F1YA 1V82A 1ZJOA 5EIYA 4EEMA 2W0VA 2WVMA 1ZI3A 3U2TA 3T7MA 2VK9A 4FRAA 3V0OA 4D11C 2JCOA 1ZI4A 5AJOA 3HL3A 5FV9A 1H7LA 3USRA 1OMZA 4K6RA 2D7IA 3K8DA 3CKVA 1ZJ0A 2O1GA 4FCUA 3ZLKA 5C3BA 3CKJA 1QG8A 1GQCA 1G95A 4FRDA 1FGXA 4CJ8A 1ZCYA 1V84A 2OI6A 2AM5A 2X5SA 4FRQA 4E1KA 2ICXA 4AAWA 3SXDA 1FZWA 2RJ4A 2Q4JA 5C36A 3DUVA 3PKQA 4Y7UA 4EVWA 4HCQA 1S4NA 2FYAA 3SXEA 1NWGB 2BO4A 2V0IA 4B2WA 1ZCTA 5FTSA 2FYBA 1R7YA 4D11A 2JCJA 3ZF8A 4HG6A 3I0HA 4HO0A 3RMVA 1G8OA 3CKOA 4YS8A 2QGIA 2YC5A 3OGZA 2WVKA 5C4CA 1QGQA 3D8VA 3V8YA 2BO8A 5C48A 2FFUA 2O1HA 2APCA 1FRWA 2YCMA 4XWIA 2AM3A 2E8BA 4ARWA 1NKHB 1LZIA 1ON6A 1G1LA 1VGUA 2XMHA 4DECA 4KXOA 2RITA 3I0CA 5C49A 5CMIA 1OQMB 1G93A 2Z86A 1LZ0A 1PZTA 5FU0A 2D0JA 1WVCA 2RJ8A 1FWYA 2V0LA 2YQHA 4C2SA 1ZI1A 4B3UA 3SX3A 4D0ZA 5CMJA 1YP4A 3SXAA 1HJLA 4NAKA 1JV1A 2Y6PA 2RIYA 4EE5A 1LL3A 5CMGX 3V0QA 1O7OA 1R81A 1WT1A 4HO3A 4DE7A 1PZYB 3CU0A 2YESA 1I52A 4B4GA 5C4DA 1H7QA 3U0XA 3U2XA 3I0JA 2VS3A 1QWJA 3U2VA 2WEEA 4M28A 1FXOA 2AE7A 3FWWA 3V91A 2JCLA 1TW1A 2ZU9A 2I7BA 2ZU7A 1ZJ2A 4KRVA 1H5SC 2D7RA 5C3AA 3CKNA 1O0RA 2VFZA 1LL2A 2OI5A 3BRKX 3NGWA 2X5ZA 1TW5A 2WGZA 4B5BA 4FRBA 4Y6UA 3I0KA 1KWSA 5CQMX 2YQCA 2FY7A 1VZUA 1G23A 1S4PA 5HS2A 1GX4A 1FO8A 2Y4LA 4KT7A 1H7TA 2FFVA 1JYLA 2BO6A 5CQNX 1XHBA 1ZIZA 4FROA 3I0DA 2VXMA 1ZCUA 5FTVA 4ECMA 2DPWA 4MNDA 3OH1A 1EZIA 1FR8A 2VXLA 3SXGA 2J0AA 5C3DA 1ON8A 1NF5B 4FIXA 5FU8A 1VZTA 3N9WA 2I5KA 3V8ZA 4EE3A 1H5TA 5C47A 1FR9A 4Y6NA 2AH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J18 A;  1FXJ A;  3R2W A;  4NAL A;  2ZU8 A;  2PX7 A;  1H5S D;  3DJ4 A;  4FCE A;  1VGZ A;  1HJJ A;  2RJ5 A;  3V0L A;  3IOJ A;  1HV9 A;  3SXB A;  5J49 A;  4NAI A;  1TZF A;  4LW6 A;  2W0W A;  4MYB A;  4AYJ A;  1H7G A;  5AJP A;  5EJZ A;  1G0R A;  1GQ9 A;  1GWW A;  5CQO A;  4CVH A;  2AM4 A;  2JCK A;  1R7X A;  3JUK A;  1MP5 A;  4Y7G A;  2MZB A;  1JVG A;  2VSI A;  3D5N A;  4EEA A;  3SX7 A;  2NXV A;  2Y4M A;  4JIS A;  4FRL A;  1H4E A;  2YQJ A;  2P72 A;  4IRQ A;  3LW6 A;  1G2V A;  5IDS A;  1VPA A;  5C1G A;  2UX8 A;  3ST8 A;  3U2U A;  2AGD A;  2RJ7 A;  1YP2 A;  1W77 A;  4HO5 A;  2CU2 A;  2A8U A;  3OAM A;  4FRP A;  1R82 A;  1MP3 A;  4AYL A;  3OC9 A;  5DDV A;  1H7F A;  1ZCV A;  3E25 A;  1E5K A;  3K8E A;  3I0L A;  1SS9 A;  4D48 A;  3Q80 A;  3OH0 A;  4G3P A;  4Y62 A;  4M2B A;  4Y64 A;  1ZDF A;  3ZLL A;  3CGX A;  1G3L A;  1ZJP A;  4BMA A;  5C1L A;  4AC3 A;  4KQL A;  3U0Y A;  2VS4 A;  3GUE A;  3V90 A;  4ASY A;  4B4M A;  4B4B A;  1JVD A;  1LL0 A;  4DDZ A;  1V83 A;  1FOA A;  1ZJ1 A;  3JUJ A;  1GX0 A;  1O23 B;  2OI7 A;  2V0J A;  2WE9 A;  1H7E A;  5L6S A;  2OEF A;  1VH1 A;  1GWV A;  4G3Q A;  1HM8 A;  1INI A;  1R80 A;  5C4F A;  4EE4 A;  4ZDQ A;  2RIX A;  3IOI A;  2GGO A;  1VH3 A;  1WT3 A;  1YP3 A;  1HM0 A;  1FGG A;  2PGV A;  2OEG A;  4Y63 A;  5FUH A;  3IOH A;  1H4C A;  2Z87 A;  4D0T A;  1OMX A;  3FOQ A;  2FYD B;  3V0N A;  2O1F A;  1K4V A;  4Y7V A;  2A8W A;  1NMM B;  3RSB A;  4HO8 A;  3O3P A;  5FYE A;  3ZGF A;  5C1H A;  2PA4 A;  1WT2 A;  4KC2 A;  5CMH A;  4FRE A;  5C4B A;  1YRO B;  4G3S A;  3R3I A;  4KPZ A;  3SX5 A;  3V0P A;  1VGW A;  1H5S A;  1W57 A;  3USQ A;  3TZT A;  4HO2 A;  1R7V A;  3Q4S A;  3OH3 A;  4FQW A;  1IIN A;  3T7N A;  4HO6 A;  1XZ6 A;  3OH2 A;  1GA8 A;  3SX8 A;  2XWL A;  3DK5 A;  5BXC A;  2BO7 A;  2WAW A;  1VM8 A;  1WSZ A;  1MC3 A;  1JYK A;  4P02 A;  4LW3 A;  4NAN A;  5DDT A;  4HO9 A;  3TQD A;  1INJ A;  4CJB A;  5C4E A;  1QGS A;  3CKQ A;  1VGT A;  4R7P A;  2WVL A;  2X65 A;  1EYR A;  3KIA A;  1H5R A;  4M2A A;  3JTJ A;  3I0E A;  3U2W A;  2XME A;  2VS5 A;  1MP4 A;  4KC1 A;  1H4D A;  4L41 C;  4EEO A;  1LZ7 A;  2GGQ A;  3OKR A;  2RJ9 A;  3I0I X;  4HOC A;  2Y4K A;  1NQI B;  4KNX A;  2ICY A;  1S4O A;  3Q7U A;  1Z90 A;  2AES A;  3RMW A;  2X60 A;  2XWN A;  2VD4 A;  1O7Q A;  4Y9X A;  1WT0 A;  1LZJ A;  2Y7A A;  5I1F A;  3D98 A;  5L6V A;  1R7U A;  3I0G A;  4EEG A;  3V0M A;  1H5S B;  2XWM A;  2RJ0 A;  2I5E A;  5JQQ A;  1H5T B;  3E26 A;  1R7T A;  5AJN A;  1VIC A;  4BQH A;  3EE5 A;  1IIM A;  2P6W A;  3F1C A;  4Y7T A;  5C38 A;  1LVW A;  2RJ1 A;  3I0F A;  4KPX A;  4ASJ A;  2V0K A;  4IRP A;  2FYC B;  2P73 A;  1ZJ3 A;  4CJC A;  5CQP A;  4KC4 A;  3QVB A;  5CQL X;  3T7O A;  4GBP A;  2PGY A;  1FG5 N;  2Y4J A;  3SPT A;  1FO9 A;  2YQS A;  4B2X A;  2AEC A;  2VSH A;  5C8R A;  1NHE B;  3ZGG A;  2QH5 A;  1H5R B;  4B42 A;  5EJ1 A;  1HM9 A;  1ZDG A;  1JV3 A;  2E3D A;  3POL A;  4P00 A;  4Y7F A;  1G97 A;  1TVY A;  4FRH A;  2RIZ A;  1ZHJ A;  1ZI5 A;  5IFY A;  3OH4 A;  4KNR A;  4M4K A;  1W55 A;  5CMF X;  2YC3 A;  2RJ6 A;  2QKX A;  1VZX A;  3PNN A;  5IDT A;  2V0H A;  4G87 A;  1G9R A;  4FRM A;  4UEG A;  1H7H A;  4JD0 A;  1H3M A;  4HO4 A;  3BCV A;  3PKP A;  3SXC A;  3F1Y A;  1V82 A;  1ZJO A;  5EIY A;  4EEM A;  2W0V A;  2WVM A;  1ZI3 A;  3U2T A;  3T7M A;  4FRA A;  3V0O A;  4D11 C;  2JCO A;  1ZI4 A;  5AJO A;  3HL3 A;  5FV9 A;  1H7L A;  3USR A;  1OMZ A;  4K6R A;  2D7I A;  3K8D A;  3CKV A;  1ZJ0 A;  2O1G A;  4FCU A;  3ZLK A;  5C3B A;  3CKJ A;  1QG8 A;  1GQC A;  1G95 A;  4FRD A;  1FGX A;  4CJ8 A;  1ZCY A;  1V84 A;  2OI6 A;  2AM5 A;  2X5S A;  4FRQ A;  4E1K A;  2ICX A;  4AAW A;  3SXD A;  1FZW A;  2RJ4 A;  2Q4J A;  5C36 A;  3DUV A;  3PKQ A;  4Y7U A;  4EVW A;  4HCQ A;  1S4N A;  2FYA A;  3SXE A;  1NWG B;  2BO4 A;  2V0I A;  4B2W A;  1ZCT A;  5FTS A;  2FYB A;  1R7Y A;  4D11 A;  2JCJ A;  3ZF8 A;  4HG6 A;  3I0H A;  4HO0 A;  3RMV A;  1G8O A;  3CKO A;  4YS8 A;  2QGI A;  2YC5 A;  3OGZ A;  2WVK A;  5C4C A;  1QGQ A;  3D8V A;  3V8Y A;  2BO8 A;  5C48 A;  2FFU A;  2O1H A;  2APC A;  1FRW A;  2YCM A;  4XWI A;  2AM3 A;  2E8B A;  4ARW A;  1NKH B;  1LZI A;  1ON6 A;  1G1L A;  1VGU A;  2XMH A;  4DEC A;  4KXO A;  2RIT A;  3I0C A;  5C49 A;  5CMI A;  1OQM B;  1G93 A;  2Z86 A;  1LZ0 A;  1PZT A;  5FU0 A;  2D0J A;  1WVC A;  2RJ8 A;  1FWY A;  2V0L A;  2YQH A;  4C2S A;  1ZI1 A;  4B3U A;  3SX3 A;  4D0Z A;  5CMJ A;  1YP4 A;  3SXA A;  1HJL A;  4NAK A;  1JV1 A;  2Y6P A;  2RIY A;  4EE5 A;  1LL3 A;  5CMG X;  3V0Q A;  1O7O A;  1R81 A;  1WT1 A;  4HO3 A;  4DE7 A;  1PZY B;  3CU0 A;  2YES A;  1I52 A;  4B4G A;  5C4D A;  1H7Q A;  3U0X A;  3U2X A;  3I0J A;  2VS3 A;  1QWJ A;  3U2V A;  2WEE A;  4M28 A;  1FXO A;  2AE7 A;  3FWW A;  3V91 A;  2JCL A;  1TW1 A;  2ZU9 A;  2I7B A;  2ZU7 A;  1ZJ2 A;  4KRV A;  1H5S C;  2D7R A;  5C3A A;  3CKN A;  1O0R A;  2VFZ A;  1LL2 A;  2OI5 A;  3BRK X;  3NGW A;  2X5Z A;  1TW5 A;  2WGZ A;  4B5B A;  4FRB A;  4Y6U A;  3I0K A;  1KWS A;  5CQM X;  2YQC A;  2FY7 A;  1VZU A;  1G23 A;  1S4P A;  5HS2 A;  1GX4 A;  1FO8 A;  2Y4L A;  4KT7 A;  1H7T A;  2FFV A;  1JYL A;  2BO6 A;  5CQN X;  1XHB A;  1ZIZ A;  4FRO A;  3I0D A;  2VXM A;  1ZCU A;  5FTV A;  4ECM A;  2DPW A;  4MND A;  3OH1 A;  1EZI A;  1FR8 A;  2VXL A;  3SXG A;  5C3D A;  1ON8 A;  1NF5 B;  5FU8 A;  1VZT A;  3N9W A;  2I5K A;  3V8Z A;  4EE3 A;  1H5T A;  5C47 A;  1FR9 A;  4Y6N A;  2AH9 A; 
#chains in the Genus database with same CATH topology
 4J18 A;  1FXJ A;  3R2W A;  4NAL A;  2ZU8 A;  2PX7 A;  1H5S D;  3DJ4 A;  4FCE A;  1VGZ A;  1HJJ A;  2RJ5 A;  3V0L A;  3IOJ A;  1HV9 A;  3SXB A;  5J49 A;  4NAI A;  1TZF A;  4LW6 A;  2W0W A;  4MYB A;  4AYJ A;  1H7G A;  5AJP A;  5D92 A;  5EJZ A;  1G0R A;  1GQ9 A;  1GWW A;  5CQO A;  4CVH A;  2AM4 A;  2JCK A;  1R7X A;  3JUK A;  1MP5 A;  4Y7G A;  2MZB A;  1JVG A;  2VSI A;  3D5N A;  4EEA A;  3SX7 A;  2NXV A;  2Y4M A;  4JIS A;  4FRL A;  1H4E A;  2YQJ A;  2P72 A;  4IRQ A;  3LW6 A;  1G2V A;  5IDS A;  1VPA A;  5C1G A;  2UX8 A;  3ST8 A;  3U2U A;  2AGD A;  2RJ7 A;  1YP2 A;  1W77 A;  4HO5 A;  2CU2 A;  2A8U A;  3OAM A;  4FRP A;  1R82 A;  1MP3 A;  4AYL A;  3OC9 A;  5DDV A;  1H7F A;  1ZCV A;  3E25 A;  1E5K A;  3K8E A;  3I0L A;  1SS9 A;  4D48 A;  4O6N A;  3Q80 A;  3OH0 A;  4G3P A;  4Y62 A;  4M2B A;  4Y64 A;  1ZDF A;  3ZLL A;  3CGX A;  1G3L A;  1ZJP A;  4BMA A;  5C1L A;  4AC3 A;  4KQL A;  3U0Y A;  2VS4 A;  3GUE A;  3V90 A;  4ASY A;  4B4M A;  4B4B A;  1JVD A;  1LL0 A;  4DDZ A;  1V83 A;  1FOA A;  1ZJ1 A;  3JUJ A;  1GX0 A;  1O23 B;  2OI7 A;  2V0J A;  2WE9 A;  1H7E A;  5L6S A;  2OEF A;  1VH1 A;  1GWV A;  4G3Q A;  1HM8 A;  1INI A;  1R80 A;  5C4F A;  4EE4 A;  4ZDQ A;  2RIX A;  3IOI A;  2GGO A;  1VH3 A;  1WT3 A;  1YP3 A;  1HM0 A;  1FGG A;  2PGV A;  2OEG A;  4Y63 A;  5FUH A;  2C0N A;  3IOH A;  1H4C A;  2Z87 A;  4D0T A;  1OMX A;  3FOQ A;  2FYD B;  3V0N A;  2O1F A;  1K4V A;  4Y7V A;  2A8W A;  1NMM B;  3RSB A;  4HO8 A;  3O3P A;  5FYE A;  3ZGF A;  5C1H A;  2PA4 A;  1WT2 A;  4KC2 A;  5CMH A;  4FRE A;  5C4B A;  1YRO B;  4G3S A;  3R3I A;  4KPZ A;  3SX5 A;  3V0P A;  1VGW A;  1H5S A;  1W57 A;  3USQ A;  3TZT A;  4HO2 A;  1R7V A;  3Q4S A;  3OH3 A;  4FQW A;  1IIN A;  4Q7C A;  3T7N A;  4HO6 A;  1XZ6 A;  3OH2 A;  1GA8 A;  5D91 A;  3SX8 A;  2XWL A;  3DK5 A;  5BXC A;  2BO7 A;  2WAW A;  1VM8 A;  1WSZ A;  4MIX A;  1MC3 A;  1JYK A;  4P02 A;  4LW3 A;  4NAN A;  5DDT A;  4HO9 A;  3TQD A;  1INJ A;  4CJB A;  5C4E A;  1QGS A;  3CKQ A;  1VGT A;  4R7P A;  2WVL A;  2X65 A;  1EYR A;  3KIA A;  1H5R A;  4M2A A;  4FIY A;  3JTJ A;  3I0E A;  3U2W A;  2XME A;  2VS5 A;  1MP4 A;  4KC1 A;  1H4D A;  2J0B A;  4L41 C;  4EEO A;  1LZ7 A;  2GGQ A;  3OKR A;  2RJ9 A;  3I0I X;  4HOC A;  2Y4K A;  1NQI B;  4KNX A;  4O6M A;  2ICY A;  1S4O A;  3Q7U A;  1Z90 A;  2AES A;  3RMW A;  2X60 A;  2XWN A;  2VD4 A;  1O7Q A;  4Y9X A;  1WT0 A;  1LZJ A;  2Y7A A;  5I1F A;  3D98 A;  5L6V A;  1R7U A;  3I0G A;  4EEG A;  3V0M A;  1H5S B;  2XWM A;  2RJ0 A;  2I5E A;  5JQQ A;  1H5T B;  3E26 A;  1R7T A;  5AJN A;  1VIC A;  4BQH A;  3EE5 A;  1IIM A;  2P6W A;  3F1C A;  4Y7T A;  5C38 A;  1LVW A;  2RJ1 A;  3I0F A;  4KPX A;  4ASJ A;  2V0K A;  4IRP A;  2FYC B;  2P73 A;  1ZJ3 A;  4CJC A;  5CQP A;  4KC4 A;  3QVB A;  5CQL X;  3T7O A;  4GBP A;  2PGY A;  1FG5 N;  2Y4J A;  3SPT A;  1FO9 A;  2YQS A;  4B2X A;  2AEC A;  2VSH A;  5C8R A;  1NHE B;  3ZGG A;  2QH5 A;  1H5R B;  4B42 A;  5EJ1 A;  1HM9 A;  1ZDG A;  1JV3 A;  2E3D A;  3POL A;  4P00 A;  4Y7F A;  1G97 A;  1TVY A;  4FRH A;  2RIZ A;  1ZHJ A;  1ZI5 A;  5IFY A;  3OH4 A;  4KNR A;  4M4K A;  1W55 A;  5CMF X;  2YC3 A;  2RJ6 A;  2QKX A;  1VZX A;  3PNN A;  5IDT A;  2V0H A;  4G87 A;  1G9R A;  4FRM A;  4UEG A;  1H7H A;  4JD0 A;  1H3M A;  4HO4 A;  3BCV A;  3PKP A;  3SXC A;  3F1Y A;  1V82 A;  1ZJO A;  5EIY A;  4EEM A;  2W0V A;  2WVM A;  1ZI3 A;  3U2T A;  3T7M A;  2VK9 A;  4FRA A;  3V0O A;  4D11 C;  2JCO A;  1ZI4 A;  5AJO A;  3HL3 A;  5FV9 A;  1H7L A;  3USR A;  1OMZ A;  4K6R A;  2D7I A;  3K8D A;  3CKV A;  1ZJ0 A;  2O1G A;  4FCU A;  3ZLK A;  5C3B A;  3CKJ A;  1QG8 A;  1GQC A;  1G95 A;  4FRD A;  1FGX A;  4CJ8 A;  1ZCY A;  1V84 A;  2OI6 A;  2AM5 A;  2X5S A;  4FRQ A;  4E1K A;  2ICX A;  4AAW A;  3SXD A;  1FZW A;  2RJ4 A;  2Q4J A;  5C36 A;  3DUV A;  3PKQ A;  4Y7U A;  4EVW A;  4HCQ A;  1S4N A;  2FYA A;  3SXE A;  1NWG B;  2BO4 A;  2V0I A;  4B2W A;  1ZCT A;  5FTS A;  2FYB A;  1R7Y A;  4D11 A;  2JCJ A;  3ZF8 A;  4HG6 A;  3I0H A;  4HO0 A;  3RMV A;  1G8O A;  3CKO A;  4YS8 A;  2QGI A;  2YC5 A;  3OGZ A;  2WVK A;  5C4C A;  1QGQ A;  3D8V A;  3V8Y A;  2BO8 A;  5C48 A;  2FFU A;  2O1H A;  2APC A;  1FRW A;  2YCM A;  4XWI A;  2AM3 A;  2E8B A;  4ARW A;  1NKH B;  1LZI A;  1ON6 A;  1G1L A;  1VGU A;  2XMH A;  4DEC A;  4KXO A;  2RIT A;  3I0C A;  5C49 A;  5CMI A;  1OQM B;  1G93 A;  2Z86 A;  1LZ0 A;  1PZT A;  5FU0 A;  2D0J A;  1WVC A;  2RJ8 A;  1FWY A;  2V0L A;  2YQH A;  4C2S A;  1ZI1 A;  4B3U A;  3SX3 A;  4D0Z A;  5CMJ A;  1YP4 A;  3SXA A;  1HJL A;  4NAK A;  1JV1 A;  2Y6P A;  2RIY A;  4EE5 A;  1LL3 A;  5CMG X;  3V0Q A;  1O7O A;  1R81 A;  1WT1 A;  4HO3 A;  4DE7 A;  1PZY B;  3CU0 A;  2YES A;  1I52 A;  4B4G A;  5C4D A;  1H7Q A;  3U0X A;  3U2X A;  3I0J A;  2VS3 A;  1QWJ A;  3U2V A;  2WEE A;  4M28 A;  1FXO A;  2AE7 A;  3FWW A;  3V91 A;  2JCL A;  1TW1 A;  2ZU9 A;  2I7B A;  2ZU7 A;  1ZJ2 A;  4KRV A;  1H5S C;  2D7R A;  5C3A A;  3CKN A;  1O0R A;  2VFZ A;  1LL2 A;  2OI5 A;  3BRK X;  3NGW A;  2X5Z A;  1TW5 A;  2WGZ A;  4B5B A;  4FRB A;  4Y6U A;  3I0K A;  1KWS A;  5CQM X;  2YQC A;  2FY7 A;  1VZU A;  1G23 A;  1S4P A;  5HS2 A;  1GX4 A;  1FO8 A;  2Y4L A;  4KT7 A;  1H7T A;  2FFV A;  1JYL A;  2BO6 A;  5CQN X;  1XHB A;  1ZIZ A;  4FRO A;  3I0D A;  2VXM A;  1ZCU A;  5FTV A;  4ECM A;  2DPW A;  4MND A;  3OH1 A;  1EZI A;  1FR8 A;  2VXL A;  3SXG A;  2J0A A;  5C3D A;  1ON8 A;  1NF5 B;  4FIX A;  5FU8 A;  1VZT A;  3N9W A;  2I5K A;  3V8Z A;  4EE3 A;  1H5T A;  5C47 A;  1FR9 A;  4Y6N A;  2AH9 A; 
#chains in the Genus database with same CATH homology
 4J18 A;  1FXJ A;  3R2W A;  4NAL A;  2ZU8 A;  2PX7 A;  1H5S D;  3DJ4 A;  4FCE A;  1VGZ A;  1HJJ A;  2RJ5 A;  3V0L A;  3IOJ A;  1HV9 A;  3SXB A;  5J49 A;  4NAI A;  1TZF A;  4LW6 A;  2W0W A;  4MYB A;  4AYJ A;  1H7G A;  5AJP A;  5D92 A;  5EJZ A;  1G0R A;  1GQ9 A;  1GWW A;  5CQO A;  4CVH A;  2AM4 A;  2JCK A;  1R7X A;  3JUK A;  1MP5 A;  4Y7G A;  2MZB A;  1JVG A;  2VSI A;  3D5N A;  4EEA A;  3SX7 A;  2NXV A;  2Y4M A;  4JIS A;  4FRL A;  1H4E A;  2YQJ A;  2P72 A;  4IRQ A;  3LW6 A;  1G2V A;  5IDS A;  1VPA A;  5C1G A;  2UX8 A;  3ST8 A;  3U2U A;  2AGD A;  2RJ7 A;  1YP2 A;  1W77 A;  4HO5 A;  2CU2 A;  2A8U A;  3OAM A;  4FRP A;  1R82 A;  1MP3 A;  4AYL A;  3OC9 A;  5DDV A;  1H7F A;  1ZCV A;  3E25 A;  1E5K A;  3K8E A;  3I0L A;  1SS9 A;  4D48 A;  4O6N A;  3Q80 A;  3OH0 A;  4G3P A;  4Y62 A;  4M2B A;  4Y64 A;  1ZDF A;  3ZLL A;  3CGX A;  1G3L A;  1ZJP A;  4BMA A;  5C1L A;  4AC3 A;  4KQL A;  3U0Y A;  2VS4 A;  3GUE A;  3V90 A;  4ASY A;  4B4M A;  4B4B A;  1JVD A;  1LL0 A;  4DDZ A;  1V83 A;  1FOA A;  1ZJ1 A;  3JUJ A;  1GX0 A;  1O23 B;  2OI7 A;  2V0J A;  2WE9 A;  1H7E A;  5L6S A;  2OEF A;  1VH1 A;  1GWV A;  4G3Q A;  1HM8 A;  1INI A;  1R80 A;  5C4F A;  4EE4 A;  4ZDQ A;  2RIX A;  3IOI A;  2GGO A;  1VH3 A;  1WT3 A;  1YP3 A;  1HM0 A;  1FGG A;  2PGV A;  2OEG A;  4Y63 A;  5FUH A;  2C0N A;  3IOH A;  1H4C A;  2Z87 A;  4D0T A;  1OMX A;  3FOQ A;  2FYD B;  3V0N A;  2O1F A;  1K4V A;  4Y7V A;  2A8W A;  1NMM B;  3RSB A;  4HO8 A;  3O3P A;  5FYE A;  3ZGF A;  5C1H A;  2PA4 A;  1WT2 A;  4KC2 A;  5CMH A;  4FRE A;  5C4B A;  1YRO B;  4G3S A;  3R3I A;  4KPZ A;  3SX5 A;  3V0P A;  1VGW A;  1H5S A;  1W57 A;  3USQ A;  3TZT A;  4HO2 A;  1R7V A;  3Q4S A;  3OH3 A;  4FQW A;  1IIN A;  4Q7C A;  3T7N A;  4HO6 A;  1XZ6 A;  3OH2 A;  1GA8 A;  5D91 A;  3SX8 A;  2XWL A;  3DK5 A;  5BXC A;  2BO7 A;  2WAW A;  1VM8 A;  1WSZ A;  4MIX A;  1MC3 A;  1JYK A;  4P02 A;  4LW3 A;  4NAN A;  5DDT A;  4HO9 A;  3TQD A;  1INJ A;  4CJB A;  5C4E A;  1QGS A;  3CKQ A;  1VGT A;  4R7P A;  2WVL A;  2X65 A;  1EYR A;  3KIA A;  1H5R A;  4M2A A;  4FIY A;  3JTJ A;  3I0E A;  3U2W A;  2XME A;  2VS5 A;  1MP4 A;  4KC1 A;  1H4D A;  2J0B A;  4L41 C;  4EEO A;  1LZ7 A;  2GGQ A;  3OKR A;  2RJ9 A;  3I0I X;  4HOC A;  2Y4K A;  1NQI B;  4KNX A;  4O6M A;  2ICY A;  1S4O A;  3Q7U A;  1Z90 A;  2AES A;  3RMW A;  2X60 A;  2XWN A;  2VD4 A;  1O7Q A;  4Y9X A;  1WT0 A;  1LZJ A;  2Y7A A;  5I1F A;  3D98 A;  5L6V A;  1R7U A;  3I0G A;  4EEG A;  3V0M A;  1H5S B;  2XWM A;  2RJ0 A;  2I5E A;  5JQQ A;  1H5T B;  3E26 A;  1R7T A;  5AJN A;  1VIC A;  4BQH A;  3EE5 A;  1IIM A;  2P6W A;  3F1C A;  4Y7T A;  5C38 A;  1LVW A;  2RJ1 A;  3I0F A;  4KPX A;  4ASJ A;  2V0K A;  4IRP A;  2FYC B;  2P73 A;  1ZJ3 A;  4CJC A;  5CQP A;  4KC4 A;  3QVB A;  5CQL X;  3T7O A;  4GBP A;  2PGY A;  1FG5 N;  2Y4J A;  3SPT A;  1FO9 A;  2YQS A;  4B2X A;  2AEC A;  2VSH A;  5C8R A;  1NHE B;  3ZGG A;  2QH5 A;  1H5R B;  4B42 A;  5EJ1 A;  1HM9 A;  1ZDG A;  1JV3 A;  2E3D A;  3POL A;  4P00 A;  4Y7F A;  1G97 A;  1TVY A;  4FRH A;  2RIZ A;  1ZHJ A;  1ZI5 A;  5IFY A;  3OH4 A;  4KNR A;  4M4K A;  1W55 A;  5CMF X;  2YC3 A;  2RJ6 A;  2QKX A;  1VZX A;  3PNN A;  5IDT A;  2V0H A;  4G87 A;  1G9R A;  4FRM A;  4UEG A;  1H7H A;  4JD0 A;  1H3M A;  4HO4 A;  3BCV A;  3PKP A;  3SXC A;  3F1Y A;  1V82 A;  1ZJO A;  5EIY A;  4EEM A;  2W0V A;  2WVM A;  1ZI3 A;  3U2T A;  3T7M A;  2VK9 A;  4FRA A;  3V0O A;  4D11 C;  2JCO A;  1ZI4 A;  5AJO A;  3HL3 A;  5FV9 A;  1H7L A;  3USR A;  1OMZ A;  4K6R A;  2D7I A;  3K8D A;  3CKV A;  1ZJ0 A;  2O1G A;  4FCU A;  3ZLK A;  5C3B A;  3CKJ A;  1QG8 A;  1GQC A;  1G95 A;  4FRD A;  1FGX A;  4CJ8 A;  1ZCY A;  1V84 A;  2OI6 A;  2AM5 A;  2X5S A;  4FRQ A;  4E1K A;  2ICX A;  4AAW A;  3SXD A;  1FZW A;  2RJ4 A;  2Q4J A;  5C36 A;  3DUV A;  3PKQ A;  4Y7U A;  4EVW A;  4HCQ A;  1S4N A;  2FYA A;  3SXE A;  1NWG B;  2BO4 A;  2V0I A;  4B2W A;  1ZCT A;  5FTS A;  2FYB A;  1R7Y A;  4D11 A;  2JCJ A;  3ZF8 A;  4HG6 A;  3I0H A;  4HO0 A;  3RMV A;  1G8O A;  3CKO A;  4YS8 A;  2QGI A;  2YC5 A;  3OGZ A;  2WVK A;  5C4C A;  1QGQ A;  3D8V A;  3V8Y A;  2BO8 A;  5C48 A;  2FFU A;  2O1H A;  2APC A;  1FRW A;  2YCM A;  4XWI A;  2AM3 A;  2E8B A;  4ARW A;  1NKH B;  1LZI A;  1ON6 A;  1G1L A;  1VGU A;  2XMH A;  4DEC A;  4KXO A;  2RIT A;  3I0C A;  5C49 A;  5CMI A;  1OQM B;  1G93 A;  2Z86 A;  1LZ0 A;  1PZT A;  5FU0 A;  2D0J A;  1WVC A;  2RJ8 A;  1FWY A;  2V0L A;  2YQH A;  4C2S A;  1ZI1 A;  4B3U A;  3SX3 A;  4D0Z A;  5CMJ A;  1YP4 A;  3SXA A;  1HJL A;  4NAK A;  1JV1 A;  2Y6P A;  2RIY A;  4EE5 A;  1LL3 A;  5CMG X;  3V0Q A;  1O7O A;  1R81 A;  1WT1 A;  4HO3 A;  4DE7 A;  1PZY B;  3CU0 A;  2YES A;  1I52 A;  4B4G A;  5C4D A;  1H7Q A;  3U0X A;  3U2X A;  3I0J A;  2VS3 A;  1QWJ A;  3U2V A;  2WEE A;  4M28 A;  1FXO A;  2AE7 A;  3FWW A;  3V91 A;  2JCL A;  1TW1 A;  2ZU9 A;  2I7B A;  2ZU7 A;  1ZJ2 A;  4KRV A;  1H5S C;  2D7R A;  5C3A A;  3CKN A;  1O0R A;  2VFZ A;  1LL2 A;  2OI5 A;  3BRK X;  3NGW A;  2X5Z A;  1TW5 A;  2WGZ A;  4B5B A;  4FRB A;  4Y6U A;  3I0K A;  1KWS A;  5CQM X;  2YQC A;  2FY7 A;  1VZU A;  1G23 A;  1S4P A;  5HS2 A;  1GX4 A;  1FO8 A;  2Y4L A;  4KT7 A;  1H7T A;  2FFV A;  1JYL A;  2BO6 A;  5CQN X;  1XHB A;  1ZIZ A;  4FRO A;  3I0D A;  2VXM A;  1ZCU A;  5FTV A;  4ECM A;  2DPW A;  4MND A;  3OH1 A;  1EZI A;  1FR8 A;  2VXL A;  3SXG A;  2J0A A;  5C3D A;  1ON8 A;  1NF5 B;  4FIX A;  5FU8 A;  1VZT A;  3N9W A;  2I5K A;  3V8Z A;  4EE3 A;  1H5T A;  5C47 A;  1FR9 A;  4Y6N A;  2AH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...