3U0XA

Crystal structure of the b-specific-1,3-galactosyltransferase (gtb) in complex with compound 382
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
290
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title A novel compound from a molecular fragment library screen inhibits glycosyltransferases by displacing the metal ion and interfering with substrate binding
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 290
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u0xA00
5C3AA 2D7IA 2YQJA 3JUKA 1R82A 3HL3A 1GA8A 3ST8A 2AM3A 5CQPA 2WGZA 2O1HA 4CVHA 3DUVA 1ZJ3A 4IRQA 3U2VA 3OH0A 1YP2A 2V0KA 4MYBA 4L41C 3V90A 4HO3A 4M2BA 1ZJ0A 5IDSA 1ZJPA 1VZTA 1GX4A 1NF5B 3CKJA 5FTSA 5IDTA 1V82A 3SXCA 4FRLA 3V8ZA 3BCVA 4CJCA 2CU2A 2W0WA 3CKOA 2P72A 1YP4A 4HO9A 3RSBA 1ZCTA 2V0HA 2RIYA 2WVKA 3SX7A 1QWJA 4Y7TA 1H7EA 4FRMA 1JV3A 3V91A 3ZGFA 4LW3A 1IIMA 2FYCB 1LVWA 5AJNA 4B42A 2P6WA 3BRKX 3R3IA 1O0RA 4D0TA 3CGXA 5CQMX 2YQCA 4KC2A 1OMXA 1EYRA 1FGGA 2NXVA 5C1HA 4EVWA 2YQSA 2RJ9A 3FOQA 4M28A 1ZCUA 2ZU8A 1G9RA 3KIAA 4ASYA 5AJOA 3CKQA 2VSIA 3ZLLA 1W55A 3D98A 4FRBA 1VZUA 5FTVA 5JQQA 4NALA 1H7TA 3LW6A 3V0NA 2RJ5A 3FWWA 1IINA 3D8VA 3T7MA 1ZI4A 1H4DA 3U2UA 1R80A 2BO8A 1G0RA 2ICYA 1WT0A 1V83A 3I0LA 1G93A 2A8WA 3U2TA 2WE9A 2AH9A 2RJ6A 1GQ9A 4IRPA 4P02A 4KNRA 5C3DA 1HM0A 1VGTA 1ZIZA 1H3MA 1ZI1A 2FFUA 5J49A 1H7QA 1MP3A 2XWNA 4D11C 1G1LA 1I52A 2YC5A 3ZF8A 4KT7A 2VXMA 5CMHA 1MP4A 3IOJA 1HM8A 1HJJA 3JUJA 1K4VA 2XWMA 1VZXA 5CMJA 1FXJA 2RJ1A 2BO4A 2RIZA 1VICA 3R2WA 5HS2A 1H5SA 2WVMA 4HO2A 5CQLX 4FROA 2RIXA 1H5SD 2ZU9A 2RJ0A 4G3QA 2VS3A 2I5EA 1INJA 3SXDA 3SXGA 1H5RA 4B4BA 2DPWA 1YP3A 1FG5N 4NANA 2YQHA 3I0JA 2AM4A 3I0FA 1ZCYA 4MNDA 5C8RA 4BMAA 3V0PA 4AYLA 4B4MA 1WT1A 1JVGA 1ON8A 1VPAA 3K8EA 3V8YA 1R7UA 1H7GA 2YCMA 5I1FA 1G97A 2YESA 4G3SA 3SXBA 4C2SA 3DJ4A 5FV9A 2XMHA 3I0DA 2OEGA 4LW6A 4D0ZA 3K8DA 3IOHA 4ECMA 2Y4MA 1FR9A 3U2WA 2QH5A 2D0JA 2JCLA 2MZBA 2X60A 2Z87A 3V0MA 3O3PA 5CQNX 1NMMB 1MC3A 1VM8A 1GWVA 4B5BA 5C47A 4Y6NA 1NWGB 4BQHA 3U0YA 4HOCA 3I0EA 1VH1A 4Y7FA 4AYJA 3Q4SA 3GUEA 1KWSA 3OH4A 4FREA 1FXOA 5EJ1A 1PZYB 1NQIB 3OAMA 1JYKA 3E25A 1W77A 4EEAA 1R7XA 5EJZA 2V0JA 1LL3A 1R81A 4HO8A 3POLA 2FYAA 5FU8A 3EE5A 4D11A 5IFYA 1ZJOA 3U0XA 1E5KA 4B3UA 1MP5A 2I5KA 1QGSA 2XWLA 2V0LA 1XZ6A 1ZI3A 1H7FA 4FRQA 4JISA 1G2VA 3E26A 5C48A 2VS4A 5C4FA 5C1LA 4DE7A 4ASJA 3I0IX 2AGDA 2QGIA 1H7LA 4DDZA 3V0OA 2VD4A 1ZDGA 3CKVA 4UEGA 1GQCA 1ZJ2A 2JCJA 4NAIA 1QGQA 2Q4JA 3JTJA 1ZDFA 2PGVA 5L6VA 2WEEA 4FRPA 2VS5A 2QKXA 4J18A 1TW1A 1XHBA 4EE5A 1VGUA 1WVCA 3OC9A 1JVDA 3OH3A 4AAWA 4KNXA 1GX0A 1ZHJA 2PGYA 3IOIA 2Z86A 1R7TA 4KC1A 3SX3A 3V0QA 4HCQA 4E1KA 3CKNA 3ZGGA 1PZTA 5CMFX 4CJBA 1FZWA 2JCOA 2BO7A 1O7OA 2YC3A 2O1FA 5CQOA 3U2XA 4R7PA 3SXEA 2VFZA 4KRVA 4EEGA 3OKRA 2APCA 4Y64A 3ZLKA 3RMWA 1ZCVA 1LL0A 1O7QA 1WT3A 2Y4JA 4D48A 1H7HA 2X65A 4KC4A 2AESA 3T7OA 5DDTA 4ZDQA 2JCKA 2FY7A 1H5TA 3SPTA 2FYDB 4P00A 1FR8A 1LZ0A 1HM9A 3D5NA 1OQMB 4EEMA 3SXAA 4K6RA 3PNNA 2RJ8A 2W0VA 1W57A 4JD0A 2D7RA 2ZU7A 3SX5A 1O23B 1Z90A 5C1GA 1QG8A 5FYEA 5C4EA 4FRDA 4Y7GA 4FCUA 1FOAA 1S4NA 5C38A 4G3PA 1H5SC 4Y7VA 1HJLA 1HV9A 5CMIA 4EEOA 5C4CA 2PX7A 1FGXA 2Y4LA 3I0GA 3TQDA 4XWIA 2XMEA 3F1CA 4Y62A 3N9WA 4HO5A 1G23A 1G95A 1ZI5A 2P73A 4Y6UA 5L6SA 1H5SB 1V84A 4B2WA 3OGZA 4AC3A 4Y7UA 3USQA 4FRAA 3NGWA 1NHEB 3USRA 1VGZA 3F1YA 2WVLA 1H5RB 3PKQA 3OH1A 4HO6A 5C36A 3TZTA 2V0IA 2OEFA 2VXLA 5C49A 3SX8A 1EZIA 4M4KA 2E8BA 2VSHA 1LZ7A 4NAKA 2WAWA 2OI5A 4EE4A 4G87A 4HO4A 4Y63A 4Y9XA 2FFVA 1GWWA 5C4BA 1FO8A 5CMGX 3RMVA 1H4EA 1H5TB 5C4DA 4KPZA 2A8UA 2UX8A 3V0LA 1WSZA 2Y4KA 4HO0A 4EE3A 1FRWA 1JYLA 1S4OA 1YROB 1LZJA 2RJ7A 2GGOA 1ON6A 1WT2A 3CU0A 4HG6A 2I7BA 1G8OA 2GGQA 2RJ4A 2PA4A 1G3LA 1OMZA 2E3DA 4GBPA 1VH3A 3DK5A 5BXCA 4M2AA 1TZFA 1LL2A 1ZJ1A 2FYBA 4B4GA 4ARWA 1NKHB 4CJ8A 1FWYA 3I0HA 1H4CA 1R7VA 3I0CA 4FQWA 1FO9A 1LZIA 1R7YA 4YS8A 3T7NA 5C3BA 1TVYA 3Q80A 1VGWA 4DECA 5DDVA 5AJPA 3QVBA 2RITA 3I0KA 1SS9A 4FRHA 2AE7A 2AM5A 4KXOA 5EIYA 1S4PA 4FCEA 4KPXA 5FU0A 5FUHA 2OI6A 1INIA 4B2XA 1TW5A 3OH2A 2O1GA 4KQLA 1JV1A 2AECA 3Q7UA 2OI7A 2ICXA 2X5SA 2BO6A 2Y6PA 3PKPA 2X5ZA 2Y7AA
chains in the Genus database with same CATH superfamily
5C3AA 2D7IA 2YQJA 3JUKA 1R82A 3HL3A 1GA8A 3ST8A 2AM3A 5CQPA 2WGZA 2O1HA 4CVHA 3DUVA 1ZJ3A 4IRQA 3U2VA 3OH0A 1YP2A 2V0KA 4MYBA 4L41C 3V90A 4HO3A 4M2BA 1ZJ0A 5IDSA 1ZJPA 1VZTA 1GX4A 1NF5B 3CKJA 5FTSA 5IDTA 1V82A 3SXCA 4FRLA 3V8ZA 3BCVA 4CJCA 2CU2A 2W0WA 3CKOA 2P72A 1YP4A 4HO9A 3RSBA 1ZCTA 2V0HA 2RIYA 2WVKA 3SX7A 1QWJA 4Y7TA 1H7EA 4FRMA 1JV3A 3V91A 3ZGFA 4LW3A 1IIMA 2FYCB 1LVWA 5AJNA 4B42A 2P6WA 3BRKX 3R3IA 1O0RA 4D0TA 3CGXA 5CQMX 2YQCA 4KC2A 1OMXA 1EYRA 1FGGA 2NXVA 2C0NA 5C1HA 4EVWA 2YQSA 2RJ9A 3FOQA 4M28A 1ZCUA 2ZU8A 1G9RA 3KIAA 4ASYA 5AJOA 3CKQA 2VSIA 3ZLLA 1W55A 3D98A 4FRBA 1VZUA 5FTVA 5JQQA 4NALA 1H7TA 3LW6A 3V0NA 2RJ5A 3FWWA 1IINA 4MIXA 3D8VA 3T7MA 1ZI4A 1H4DA 3U2UA 1R80A 2BO8A 1G0RA 2ICYA 1WT0A 1V83A 3I0LA 1G93A 2A8WA 3U2TA 2WE9A 2AH9A 2RJ6A 1GQ9A 4IRPA 4P02A 4KNRA 5C3DA 1HM0A 1VGTA 1ZIZA 1H3MA 1ZI1A 2FFUA 4Q7CA 5J49A 1H7QA 1MP3A 2XWNA 4D11C 1G1LA 1I52A 2YC5A 3ZF8A 4KT7A 2VXMA 5CMHA 1MP4A 3IOJA 1HM8A 1HJJA 3JUJA 1K4VA 2XWMA 1VZXA 5CMJA 1FXJA 2RJ1A 2VK9A 2BO4A 2RIZA 1VICA 3R2WA 5HS2A 1H5SA 2WVMA 4HO2A 5CQLX 4FROA 2RIXA 1H5SD 2ZU9A 2RJ0A 4G3QA 2VS3A 2I5EA 1INJA 3SXDA 3SXGA 1H5RA 4B4BA 2DPWA 1YP3A 1FG5N 4NANA 2YQHA 3I0JA 2AM4A 3I0FA 1ZCYA 4MNDA 5C8RA 4BMAA 3V0PA 4AYLA 4B4MA 1WT1A 1JVGA 1ON8A 1VPAA 3K8EA 3V8YA 5D91A 1R7UA 1H7GA 2YCMA 5I1FA 1G97A 2YESA 4G3SA 3SXBA 4C2SA 3DJ4A 5FV9A 2XMHA 3I0DA 2OEGA 4LW6A 4O6MA 4D0ZA 3K8DA 3IOHA 4ECMA 2Y4MA 1FR9A 3U2WA 2QH5A 2D0JA 2JCLA 2MZBA 2X60A 2Z87A 3V0MA 3O3PA 5CQNX 1NMMB 1MC3A 1VM8A 1GWVA 4B5BA 5C47A 4Y6NA 1NWGB 4BQHA 3U0YA 4HOCA 2J0AA 3I0EA 1VH1A 4Y7FA 4AYJA 3Q4SA 3GUEA 1KWSA 3OH4A 4FREA 1FXOA 5EJ1A 1PZYB 1NQIB 3OAMA 1JYKA 3E25A 1W77A 4EEAA 1R7XA 5EJZA 2V0JA 1LL3A 1R81A 4HO8A 3POLA 2FYAA 5FU8A 3EE5A 4D11A 5IFYA 1ZJOA 3U0XA 1E5KA 4B3UA 1MP5A 2I5KA 1QGSA 2XWLA 2V0LA 1XZ6A 1ZI3A 1H7FA 4FRQA 4JISA 1G2VA 3E26A 5C48A 2VS4A 5C4FA 5C1LA 4DE7A 4ASJA 3I0IX 2AGDA 2QGIA 1H7LA 4DDZA 3V0OA 2VD4A 1ZDGA 3CKVA 4UEGA 1GQCA 1ZJ2A 2JCJA 4NAIA 1QGQA 2Q4JA 3JTJA 1ZDFA 2PGVA 5L6VA 2WEEA 4FRPA 2VS5A 2QKXA 4J18A 1TW1A 1XHBA 4EE5A 4O6NA 1VGUA 1WVCA 3OC9A 1JVDA 3OH3A 4AAWA 4KNXA 1GX0A 1ZHJA 2PGYA 3IOIA 2Z86A 1R7TA 4KC1A 3SX3A 3V0QA 4HCQA 4E1KA 3CKNA 3ZGGA 1PZTA 5CMFX 4CJBA 1FZWA 2JCOA 2BO7A 2J0BA 1O7OA 2YC3A 2O1FA 5CQOA 3U2XA 4R7PA 3SXEA 2VFZA 4KRVA 4EEGA 3OKRA 2APCA 4Y64A 3ZLKA 3RMWA 1ZCVA 1LL0A 1O7QA 1WT3A 2Y4JA 4D48A 1H7HA 2X65A 4KC4A 2AESA 3T7OA 5DDTA 4ZDQA 2JCKA 2FY7A 1H5TA 3SPTA 2FYDB 4P00A 1FR8A 1LZ0A 1HM9A 3D5NA 1OQMB 4EEMA 3SXAA 4K6RA 3PNNA 2RJ8A 2W0VA 1W57A 4JD0A 2D7RA 2ZU7A 3SX5A 1O23B 1Z90A 5C1GA 1QG8A 5FYEA 5C4EA 4FRDA 4Y7GA 4FCUA 1FOAA 1S4NA 5C38A 4G3PA 1H5SC 4Y7VA 1HJLA 1HV9A 5CMIA 4EEOA 5C4CA 2PX7A 1FGXA 2Y4LA 3I0GA 3TQDA 4XWIA 2XMEA 3F1CA 4Y62A 3N9WA 4HO5A 1G23A 1G95A 1ZI5A 2P73A 4Y6UA 5L6SA 1H5SB 4FIXA 1V84A 4B2WA 3OGZA 4AC3A 4Y7UA 3USQA 4FRAA 3NGWA 1NHEB 3USRA 1VGZA 3F1YA 2WVLA 1H5RB 3PKQA 3OH1A 4HO6A 5C36A 3TZTA 2V0IA 2OEFA 2VXLA 5C49A 3SX8A 1EZIA 4M4KA 2E8BA 2VSHA 1LZ7A 4NAKA 2WAWA 2OI5A 4EE4A 4G87A 4HO4A 4Y63A 4Y9XA 2FFVA 1GWWA 5C4BA 1FO8A 5CMGX 3RMVA 1H4EA 1H5TB 5C4DA 4KPZA 2A8UA 2UX8A 3V0LA 1WSZA 2Y4KA 4HO0A 4EE3A 1FRWA 1JYLA 1S4OA 1YROB 1LZJA 2RJ7A 2GGOA 1ON6A 1WT2A 3CU0A 5D92A 4HG6A 2I7BA 1G8OA 2GGQA 2RJ4A 2PA4A 1G3LA 1OMZA 2E3DA 4GBPA 1VH3A 3DK5A 5BXCA 4M2AA 1TZFA 1LL2A 1ZJ1A 2FYBA 4B4GA 4ARWA 4FIYA 1NKHB 4CJ8A 1FWYA 3I0HA 1H4CA 1R7VA 3I0CA 4FQWA 1FO9A 1LZIA 1R7YA 4YS8A 3T7NA 5C3BA 1TVYA 3Q80A 1VGWA 4DECA 5DDVA 5AJPA 3QVBA 2RITA 3I0KA 1SS9A 4FRHA 2AE7A 2AM5A 4KXOA 5EIYA 1S4PA 4FCEA 4KPXA 5FU0A 5FUHA 2OI6A 1INIA 4B2XA 1TW5A 3OH2A 2O1GA 4KQLA 1JV1A 2AECA 3Q7UA 2OI7A 2ICXA 2X5SA 2BO6A 2Y6PA 3PKPA 2X5ZA 2Y7AA
chains in the Genus database with same CATH topology
5C3AA 2D7IA 2YQJA 3JUKA 1R82A 3HL3A 1GA8A 3ST8A 2AM3A 5CQPA 2WGZA 2O1HA 4CVHA 3DUVA 1ZJ3A 4IRQA 3U2VA 3OH0A 1YP2A 2V0KA 4MYBA 4L41C 3V90A 4HO3A 4M2BA 1ZJ0A 5IDSA 1ZJPA 1VZTA 1GX4A 1NF5B 3CKJA 5FTSA 5IDTA 1V82A 3SXCA 4FRLA 3V8ZA 3BCVA 4CJCA 2CU2A 2W0WA 3CKOA 2P72A 1YP4A 4HO9A 3RSBA 1ZCTA 2V0HA 2RIYA 2WVKA 3SX7A 1QWJA 4Y7TA 1H7EA 4FRMA 1JV3A 3V91A 3ZGFA 4LW3A 1IIMA 2FYCB 1LVWA 5AJNA 4B42A 2P6WA 3BRKX 3R3IA 1O0RA 4D0TA 3CGXA 5CQMX 2YQCA 4KC2A 1OMXA 1EYRA 1FGGA 2NXVA 2C0NA 5C1HA 4EVWA 2YQSA 2RJ9A 3FOQA 4M28A 1ZCUA 2ZU8A 1G9RA 3KIAA 4ASYA 5AJOA 3CKQA 2VSIA 3ZLLA 1W55A 3D98A 4FRBA 1VZUA 5FTVA 5JQQA 4NALA 1H7TA 3LW6A 3V0NA 2RJ5A 3FWWA 1IINA 4MIXA 3D8VA 3T7MA 1ZI4A 1H4DA 3U2UA 1R80A 2BO8A 1G0RA 2ICYA 1WT0A 1V83A 3I0LA 1G93A 2A8WA 3U2TA 2WE9A 2AH9A 2RJ6A 1GQ9A 4IRPA 4P02A 4KNRA 5C3DA 1HM0A 1VGTA 1ZIZA 1H3MA 1ZI1A 2FFUA 4Q7CA 5J49A 1H7QA 1MP3A 2XWNA 4D11C 1G1LA 1I52A 2YC5A 3ZF8A 4KT7A 2VXMA 5CMHA 1MP4A 3IOJA 1HM8A 1HJJA 3JUJA 1K4VA 2XWMA 1VZXA 5CMJA 1FXJA 2RJ1A 2VK9A 2BO4A 2RIZA 1VICA 3R2WA 5HS2A 1H5SA 2WVMA 4HO2A 5CQLX 4FROA 2RIXA 1H5SD 2ZU9A 2RJ0A 4G3QA 2VS3A 2I5EA 1INJA 3SXDA 3SXGA 1H5RA 4B4BA 2DPWA 1YP3A 1FG5N 4NANA 2YQHA 3I0JA 2AM4A 3I0FA 1ZCYA 4MNDA 5C8RA 4BMAA 3V0PA 4AYLA 4B4MA 1WT1A 1JVGA 1ON8A 1VPAA 3K8EA 3V8YA 5D91A 1R7UA 1H7GA 2YCMA 5I1FA 1G97A 2YESA 4G3SA 3SXBA 4C2SA 3DJ4A 5FV9A 2XMHA 3I0DA 2OEGA 4LW6A 4O6MA 4D0ZA 3K8DA 3IOHA 4ECMA 2Y4MA 1FR9A 3U2WA 2QH5A 2D0JA 2JCLA 2MZBA 2X60A 2Z87A 3V0MA 3O3PA 5CQNX 1NMMB 1MC3A 1VM8A 1GWVA 4B5BA 5C47A 4Y6NA 1NWGB 4BQHA 3U0YA 4HOCA 2J0AA 3I0EA 1VH1A 4Y7FA 4AYJA 3Q4SA 3GUEA 1KWSA 3OH4A 4FREA 1FXOA 5EJ1A 1PZYB 1NQIB 3OAMA 1JYKA 3E25A 1W77A 4EEAA 1R7XA 5EJZA 2V0JA 1LL3A 1R81A 4HO8A 3POLA 2FYAA 5FU8A 3EE5A 4D11A 5IFYA 1ZJOA 3U0XA 1E5KA 4B3UA 1MP5A 2I5KA 1QGSA 2XWLA 2V0LA 1XZ6A 1ZI3A 1H7FA 4FRQA 4JISA 1G2VA 3E26A 5C48A 2VS4A 5C4FA 5C1LA 4DE7A 4ASJA 3I0IX 2AGDA 2QGIA 1H7LA 4DDZA 3V0OA 2VD4A 1ZDGA 3CKVA 4UEGA 1GQCA 1ZJ2A 2JCJA 4NAIA 1QGQA 2Q4JA 3JTJA 1ZDFA 2PGVA 5L6VA 2WEEA 4FRPA 2VS5A 2QKXA 4J18A 1TW1A 1XHBA 4EE5A 4O6NA 1VGUA 1WVCA 3OC9A 1JVDA 3OH3A 4AAWA 4KNXA 1GX0A 1ZHJA 2PGYA 3IOIA 2Z86A 1R7TA 4KC1A 3SX3A 3V0QA 4HCQA 4E1KA 3CKNA 3ZGGA 1PZTA 5CMFX 4CJBA 1FZWA 2JCOA 2BO7A 2J0BA 1O7OA 2YC3A 2O1FA 5CQOA 3U2XA 4R7PA 3SXEA 2VFZA 4KRVA 4EEGA 3OKRA 2APCA 4Y64A 3ZLKA 3RMWA 1ZCVA 1LL0A 1O7QA 1WT3A 2Y4JA 4D48A 1H7HA 2X65A 4KC4A 2AESA 3T7OA 5DDTA 4ZDQA 2JCKA 2FY7A 1H5TA 3SPTA 2FYDB 4P00A 1FR8A 1LZ0A 1HM9A 3D5NA 1OQMB 4EEMA 3SXAA 4K6RA 3PNNA 2RJ8A 2W0VA 1W57A 4JD0A 2D7RA 2ZU7A 3SX5A 1O23B 1Z90A 5C1GA 1QG8A 5FYEA 5C4EA 4FRDA 4Y7GA 4FCUA 1FOAA 1S4NA 5C38A 4G3PA 1H5SC 4Y7VA 1HJLA 1HV9A 5CMIA 4EEOA 5C4CA 2PX7A 1FGXA 2Y4LA 3I0GA 3TQDA 4XWIA 2XMEA 3F1CA 4Y62A 3N9WA 4HO5A 1G23A 1G95A 1ZI5A 2P73A 4Y6UA 5L6SA 1H5SB 4FIXA 1V84A 4B2WA 3OGZA 4AC3A 4Y7UA 3USQA 4FRAA 3NGWA 1NHEB 3USRA 1VGZA 3F1YA 2WVLA 1H5RB 3PKQA 3OH1A 4HO6A 5C36A 3TZTA 2V0IA 2OEFA 2VXLA 5C49A 3SX8A 1EZIA 4M4KA 2E8BA 2VSHA 1LZ7A 4NAKA 2WAWA 2OI5A 4EE4A 4G87A 4HO4A 4Y63A 4Y9XA 2FFVA 1GWWA 5C4BA 1FO8A 5CMGX 3RMVA 1H4EA 1H5TB 5C4DA 4KPZA 2A8UA 2UX8A 3V0LA 1WSZA 2Y4KA 4HO0A 4EE3A 1FRWA 1JYLA 1S4OA 1YROB 1LZJA 2RJ7A 2GGOA 1ON6A 1WT2A 3CU0A 5D92A 4HG6A 2I7BA 1G8OA 2GGQA 2RJ4A 2PA4A 1G3LA 1OMZA 2E3DA 4GBPA 1VH3A 3DK5A 5BXCA 4M2AA 1TZFA 1LL2A 1ZJ1A 2FYBA 4B4GA 4ARWA 4FIYA 1NKHB 4CJ8A 1FWYA 3I0HA 1H4CA 1R7VA 3I0CA 4FQWA 1FO9A 1LZIA 1R7YA 4YS8A 3T7NA 5C3BA 1TVYA 3Q80A 1VGWA 4DECA 5DDVA 5AJPA 3QVBA 2RITA 3I0KA 1SS9A 4FRHA 2AE7A 2AM5A 4KXOA 5EIYA 1S4PA 4FCEA 4KPXA 5FU0A 5FUHA 2OI6A 1INIA 4B2XA 1TW5A 3OH2A 2O1GA 4KQLA 1JV1A 2AECA 3Q7UA 2OI7A 2ICXA 2X5SA 2BO6A 2Y6PA 3PKPA 2X5ZA 2Y7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3A A;  2D7I A;  2YQJ A;  3JUK A;  1R82 A;  3HL3 A;  1GA8 A;  3ST8 A;  2AM3 A;  5CQP A;  2WGZ A;  2O1H A;  4CVH A;  3DUV A;  1ZJ3 A;  4IRQ A;  3U2V A;  3OH0 A;  1YP2 A;  2V0K A;  4MYB A;  4L41 C;  3V90 A;  4HO3 A;  4M2B A;  1ZJ0 A;  5IDS A;  1ZJP A;  1VZT A;  1GX4 A;  1NF5 B;  3CKJ A;  5FTS A;  5IDT A;  1V82 A;  3SXC A;  4FRL A;  3V8Z A;  3BCV A;  4CJC A;  2CU2 A;  2W0W A;  3CKO A;  2P72 A;  1YP4 A;  4HO9 A;  3RSB A;  1ZCT A;  2V0H A;  2RIY A;  2WVK A;  3SX7 A;  1QWJ A;  4Y7T A;  1H7E A;  4FRM A;  1JV3 A;  3V91 A;  3ZGF A;  4LW3 A;  1IIM A;  2FYC B;  1LVW A;  5AJN A;  4B42 A;  2P6W A;  3BRK X;  3R3I A;  1O0R A;  4D0T A;  3CGX A;  5CQM X;  2YQC A;  4KC2 A;  1OMX A;  1EYR A;  1FGG A;  2NXV A;  5C1H A;  4EVW A;  2YQS A;  2RJ9 A;  3FOQ A;  4M28 A;  1ZCU A;  2ZU8 A;  1G9R A;  3KIA A;  4ASY A;  5AJO A;  3CKQ A;  2VSI A;  3ZLL A;  1W55 A;  3D98 A;  4FRB A;  1VZU A;  5FTV A;  5JQQ A;  4NAL A;  1H7T A;  3LW6 A;  3V0N A;  2RJ5 A;  3FWW A;  1IIN A;  3D8V A;  3T7M A;  1ZI4 A;  1H4D A;  3U2U A;  1R80 A;  2BO8 A;  1G0R A;  2ICY A;  1WT0 A;  1V83 A;  3I0L A;  1G93 A;  2A8W A;  3U2T A;  2WE9 A;  2AH9 A;  2RJ6 A;  1GQ9 A;  4IRP A;  4P02 A;  4KNR A;  5C3D A;  1HM0 A;  1VGT A;  1ZIZ A;  1H3M A;  1ZI1 A;  2FFU A;  5J49 A;  1H7Q A;  1MP3 A;  2XWN A;  4D11 C;  1G1L A;  1I52 A;  2YC5 A;  3ZF8 A;  4KT7 A;  2VXM A;  5CMH A;  1MP4 A;  3IOJ A;  1HM8 A;  1HJJ A;  3JUJ A;  1K4V A;  2XWM A;  1VZX A;  5CMJ A;  1FXJ A;  2RJ1 A;  2BO4 A;  2RIZ A;  1VIC A;  3R2W A;  5HS2 A;  1H5S A;  2WVM A;  4HO2 A;  5CQL X;  4FRO A;  2RIX A;  1H5S D;  2ZU9 A;  2RJ0 A;  4G3Q A;  2VS3 A;  2I5E A;  1INJ A;  3SXD A;  3SXG A;  1H5R A;  4B4B A;  2DPW A;  1YP3 A;  1FG5 N;  4NAN A;  2YQH A;  3I0J A;  2AM4 A;  3I0F A;  1ZCY A;  4MND A;  5C8R A;  4BMA A;  3V0P A;  4AYL A;  4B4M A;  1WT1 A;  1JVG A;  1ON8 A;  1VPA A;  3K8E A;  3V8Y A;  1R7U A;  1H7G A;  2YCM A;  5I1F A;  1G97 A;  2YES A;  4G3S A;  3SXB A;  4C2S A;  3DJ4 A;  5FV9 A;  2XMH A;  3I0D A;  2OEG A;  4LW6 A;  4D0Z A;  3K8D A;  3IOH A;  4ECM A;  2Y4M A;  1FR9 A;  3U2W A;  2QH5 A;  2D0J A;  2JCL A;  2MZB A;  2X60 A;  2Z87 A;  3V0M A;  3O3P A;  5CQN X;  1NMM B;  1MC3 A;  1VM8 A;  1GWV A;  4B5B A;  5C47 A;  4Y6N A;  1NWG B;  4BQH A;  3U0Y A;  4HOC A;  3I0E A;  1VH1 A;  4Y7F A;  4AYJ A;  3Q4S A;  3GUE A;  1KWS A;  3OH4 A;  4FRE A;  1FXO A;  5EJ1 A;  1PZY B;  1NQI B;  3OAM A;  1JYK A;  3E25 A;  1W77 A;  4EEA A;  1R7X A;  5EJZ A;  2V0J A;  1LL3 A;  1R81 A;  4HO8 A;  3POL A;  2FYA A;  5FU8 A;  3EE5 A;  4D11 A;  5IFY A;  1ZJO A;  3U0X A;  1E5K A;  4B3U A;  1MP5 A;  2I5K A;  1QGS A;  2XWL A;  2V0L A;  1XZ6 A;  1ZI3 A;  1H7F A;  4FRQ A;  4JIS A;  1G2V A;  3E26 A;  5C48 A;  2VS4 A;  5C4F A;  5C1L A;  4DE7 A;  4ASJ A;  3I0I X;  2AGD A;  2QGI A;  1H7L A;  4DDZ A;  3V0O A;  2VD4 A;  1ZDG A;  3CKV A;  4UEG A;  1GQC A;  1ZJ2 A;  2JCJ A;  4NAI A;  1QGQ A;  2Q4J A;  3JTJ A;  1ZDF A;  2PGV A;  5L6V A;  2WEE A;  4FRP A;  2VS5 A;  2QKX A;  4J18 A;  1TW1 A;  1XHB A;  4EE5 A;  1VGU A;  1WVC A;  3OC9 A;  1JVD A;  3OH3 A;  4AAW A;  4KNX A;  1GX0 A;  1ZHJ A;  2PGY A;  3IOI A;  2Z86 A;  1R7T A;  4KC1 A;  3SX3 A;  3V0Q A;  4HCQ A;  4E1K A;  3CKN A;  3ZGG A;  1PZT A;  5CMF X;  4CJB A;  1FZW A;  2JCO A;  2BO7 A;  1O7O A;  2YC3 A;  2O1F A;  5CQO A;  3U2X A;  4R7P A;  3SXE A;  2VFZ A;  4KRV A;  4EEG A;  3OKR A;  2APC A;  4Y64 A;  3ZLK A;  3RMW A;  1ZCV A;  1LL0 A;  1O7Q A;  1WT3 A;  2Y4J A;  4D48 A;  1H7H A;  2X65 A;  4KC4 A;  2AES A;  3T7O A;  5DDT A;  4ZDQ A;  2JCK A;  2FY7 A;  1H5T A;  3SPT A;  2FYD B;  4P00 A;  1FR8 A;  1LZ0 A;  1HM9 A;  3D5N A;  1OQM B;  4EEM A;  3SXA A;  4K6R A;  3PNN A;  2RJ8 A;  2W0V A;  1W57 A;  4JD0 A;  2D7R A;  2ZU7 A;  3SX5 A;  1O23 B;  1Z90 A;  5C1G A;  1QG8 A;  5FYE A;  5C4E A;  4FRD A;  4Y7G A;  4FCU A;  1FOA A;  1S4N A;  5C38 A;  4G3P A;  1H5S C;  4Y7V A;  1HJL A;  1HV9 A;  5CMI A;  4EEO A;  5C4C A;  2PX7 A;  1FGX A;  2Y4L A;  3I0G A;  3TQD A;  4XWI A;  2XME A;  3F1C A;  4Y62 A;  3N9W A;  4HO5 A;  1G23 A;  1G95 A;  1ZI5 A;  2P73 A;  4Y6U A;  5L6S A;  1H5S B;  1V84 A;  4B2W A;  3OGZ A;  4AC3 A;  4Y7U A;  3USQ A;  4FRA A;  3NGW A;  1NHE B;  3USR A;  1VGZ A;  3F1Y A;  2WVL A;  1H5R B;  3PKQ A;  3OH1 A;  4HO6 A;  5C36 A;  3TZT A;  2V0I A;  2OEF A;  2VXL A;  5C49 A;  3SX8 A;  1EZI A;  4M4K A;  2E8B A;  2VSH A;  1LZ7 A;  4NAK A;  2WAW A;  2OI5 A;  4EE4 A;  4G87 A;  4HO4 A;  4Y63 A;  4Y9X A;  2FFV A;  1GWW A;  5C4B A;  1FO8 A;  5CMG X;  3RMV A;  1H4E A;  1H5T B;  5C4D A;  4KPZ A;  2A8U A;  2UX8 A;  3V0L A;  1WSZ A;  2Y4K A;  4HO0 A;  4EE3 A;  1FRW A;  1JYL A;  1S4O A;  1YRO B;  1LZJ A;  2RJ7 A;  2GGO A;  1ON6 A;  1WT2 A;  3CU0 A;  4HG6 A;  2I7B A;  1G8O A;  2GGQ A;  2RJ4 A;  2PA4 A;  1G3L A;  1OMZ A;  2E3D A;  4GBP A;  1VH3 A;  3DK5 A;  5BXC A;  4M2A A;  1TZF A;  1LL2 A;  1ZJ1 A;  2FYB A;  4B4G A;  4ARW A;  1NKH B;  4CJ8 A;  1FWY A;  3I0H A;  1H4C A;  1R7V A;  3I0C A;  4FQW A;  1FO9 A;  1LZI A;  1R7Y A;  4YS8 A;  3T7N A;  5C3B A;  1TVY A;  3Q80 A;  1VGW A;  4DEC A;  5DDV A;  5AJP A;  3QVB A;  2RIT A;  3I0K A;  1SS9 A;  4FRH A;  2AE7 A;  2AM5 A;  4KXO A;  5EIY A;  1S4P A;  4FCE A;  4KPX A;  5FU0 A;  5FUH A;  2OI6 A;  1INI A;  4B2X A;  1TW5 A;  3OH2 A;  2O1G A;  4KQL A;  1JV1 A;  2AEC A;  3Q7U A;  2OI7 A;  2ICX A;  2X5S A;  2BO6 A;  2Y6P A;  3PKP A;  2X5Z A;  2Y7A A; 
#chains in the Genus database with same CATH topology
 5C3A A;  2D7I A;  2YQJ A;  3JUK A;  1R82 A;  3HL3 A;  1GA8 A;  3ST8 A;  2AM3 A;  5CQP A;  2WGZ A;  2O1H A;  4CVH A;  3DUV A;  1ZJ3 A;  4IRQ A;  3U2V A;  3OH0 A;  1YP2 A;  2V0K A;  4MYB A;  4L41 C;  3V90 A;  4HO3 A;  4M2B A;  1ZJ0 A;  5IDS A;  1ZJP A;  1VZT A;  1GX4 A;  1NF5 B;  3CKJ A;  5FTS A;  5IDT A;  1V82 A;  3SXC A;  4FRL A;  3V8Z A;  3BCV A;  4CJC A;  2CU2 A;  2W0W A;  3CKO A;  2P72 A;  1YP4 A;  4HO9 A;  3RSB A;  1ZCT A;  2V0H A;  2RIY A;  2WVK A;  3SX7 A;  1QWJ A;  4Y7T A;  1H7E A;  4FRM A;  1JV3 A;  3V91 A;  3ZGF A;  4LW3 A;  1IIM A;  2FYC B;  1LVW A;  5AJN A;  4B42 A;  2P6W A;  3BRK X;  3R3I A;  1O0R A;  4D0T A;  3CGX A;  5CQM X;  2YQC A;  4KC2 A;  1OMX A;  1EYR A;  1FGG A;  2NXV A;  2C0N A;  5C1H A;  4EVW A;  2YQS A;  2RJ9 A;  3FOQ A;  4M28 A;  1ZCU A;  2ZU8 A;  1G9R A;  3KIA A;  4ASY A;  5AJO A;  3CKQ A;  2VSI A;  3ZLL A;  1W55 A;  3D98 A;  4FRB A;  1VZU A;  5FTV A;  5JQQ A;  4NAL A;  1H7T A;  3LW6 A;  3V0N A;  2RJ5 A;  3FWW A;  1IIN A;  4MIX A;  3D8V A;  3T7M A;  1ZI4 A;  1H4D A;  3U2U A;  1R80 A;  2BO8 A;  1G0R A;  2ICY A;  1WT0 A;  1V83 A;  3I0L A;  1G93 A;  2A8W A;  3U2T A;  2WE9 A;  2AH9 A;  2RJ6 A;  1GQ9 A;  4IRP A;  4P02 A;  4KNR A;  5C3D A;  1HM0 A;  1VGT A;  1ZIZ A;  1H3M A;  1ZI1 A;  2FFU A;  4Q7C A;  5J49 A;  1H7Q A;  1MP3 A;  2XWN A;  4D11 C;  1G1L A;  1I52 A;  2YC5 A;  3ZF8 A;  4KT7 A;  2VXM A;  5CMH A;  1MP4 A;  3IOJ A;  1HM8 A;  1HJJ A;  3JUJ A;  1K4V A;  2XWM A;  1VZX A;  5CMJ A;  1FXJ A;  2RJ1 A;  2VK9 A;  2BO4 A;  2RIZ A;  1VIC A;  3R2W A;  5HS2 A;  1H5S A;  2WVM A;  4HO2 A;  5CQL X;  4FRO A;  2RIX A;  1H5S D;  2ZU9 A;  2RJ0 A;  4G3Q A;  2VS3 A;  2I5E A;  1INJ A;  3SXD A;  3SXG A;  1H5R A;  4B4B A;  2DPW A;  1YP3 A;  1FG5 N;  4NAN A;  2YQH A;  3I0J A;  2AM4 A;  3I0F A;  1ZCY A;  4MND A;  5C8R A;  4BMA A;  3V0P A;  4AYL A;  4B4M A;  1WT1 A;  1JVG A;  1ON8 A;  1VPA A;  3K8E A;  3V8Y A;  5D91 A;  1R7U A;  1H7G A;  2YCM A;  5I1F A;  1G97 A;  2YES A;  4G3S A;  3SXB A;  4C2S A;  3DJ4 A;  5FV9 A;  2XMH A;  3I0D A;  2OEG A;  4LW6 A;  4O6M A;  4D0Z A;  3K8D A;  3IOH A;  4ECM A;  2Y4M A;  1FR9 A;  3U2W A;  2QH5 A;  2D0J A;  2JCL A;  2MZB A;  2X60 A;  2Z87 A;  3V0M A;  3O3P A;  5CQN X;  1NMM B;  1MC3 A;  1VM8 A;  1GWV A;  4B5B A;  5C47 A;  4Y6N A;  1NWG B;  4BQH A;  3U0Y A;  4HOC A;  2J0A A;  3I0E A;  1VH1 A;  4Y7F A;  4AYJ A;  3Q4S A;  3GUE A;  1KWS A;  3OH4 A;  4FRE A;  1FXO A;  5EJ1 A;  1PZY B;  1NQI B;  3OAM A;  1JYK A;  3E25 A;  1W77 A;  4EEA A;  1R7X A;  5EJZ A;  2V0J A;  1LL3 A;  1R81 A;  4HO8 A;  3POL A;  2FYA A;  5FU8 A;  3EE5 A;  4D11 A;  5IFY A;  1ZJO A;  3U0X A;  1E5K A;  4B3U A;  1MP5 A;  2I5K A;  1QGS A;  2XWL A;  2V0L A;  1XZ6 A;  1ZI3 A;  1H7F A;  4FRQ A;  4JIS A;  1G2V A;  3E26 A;  5C48 A;  2VS4 A;  5C4F A;  5C1L A;  4DE7 A;  4ASJ A;  3I0I X;  2AGD A;  2QGI A;  1H7L A;  4DDZ A;  3V0O A;  2VD4 A;  1ZDG A;  3CKV A;  4UEG A;  1GQC A;  1ZJ2 A;  2JCJ A;  4NAI A;  1QGQ A;  2Q4J A;  3JTJ A;  1ZDF A;  2PGV A;  5L6V A;  2WEE A;  4FRP A;  2VS5 A;  2QKX A;  4J18 A;  1TW1 A;  1XHB A;  4EE5 A;  4O6N A;  1VGU A;  1WVC A;  3OC9 A;  1JVD A;  3OH3 A;  4AAW A;  4KNX A;  1GX0 A;  1ZHJ A;  2PGY A;  3IOI A;  2Z86 A;  1R7T A;  4KC1 A;  3SX3 A;  3V0Q A;  4HCQ A;  4E1K A;  3CKN A;  3ZGG A;  1PZT A;  5CMF X;  4CJB A;  1FZW A;  2JCO A;  2BO7 A;  2J0B A;  1O7O A;  2YC3 A;  2O1F A;  5CQO A;  3U2X A;  4R7P A;  3SXE A;  2VFZ A;  4KRV A;  4EEG A;  3OKR A;  2APC A;  4Y64 A;  3ZLK A;  3RMW A;  1ZCV A;  1LL0 A;  1O7Q A;  1WT3 A;  2Y4J A;  4D48 A;  1H7H A;  2X65 A;  4KC4 A;  2AES A;  3T7O A;  5DDT A;  4ZDQ A;  2JCK A;  2FY7 A;  1H5T A;  3SPT A;  2FYD B;  4P00 A;  1FR8 A;  1LZ0 A;  1HM9 A;  3D5N A;  1OQM B;  4EEM A;  3SXA A;  4K6R A;  3PNN A;  2RJ8 A;  2W0V A;  1W57 A;  4JD0 A;  2D7R A;  2ZU7 A;  3SX5 A;  1O23 B;  1Z90 A;  5C1G A;  1QG8 A;  5FYE A;  5C4E A;  4FRD A;  4Y7G A;  4FCU A;  1FOA A;  1S4N A;  5C38 A;  4G3P A;  1H5S C;  4Y7V A;  1HJL A;  1HV9 A;  5CMI A;  4EEO A;  5C4C A;  2PX7 A;  1FGX A;  2Y4L A;  3I0G A;  3TQD A;  4XWI A;  2XME A;  3F1C A;  4Y62 A;  3N9W A;  4HO5 A;  1G23 A;  1G95 A;  1ZI5 A;  2P73 A;  4Y6U A;  5L6S A;  1H5S B;  4FIX A;  1V84 A;  4B2W A;  3OGZ A;  4AC3 A;  4Y7U A;  3USQ A;  4FRA A;  3NGW A;  1NHE B;  3USR A;  1VGZ A;  3F1Y A;  2WVL A;  1H5R B;  3PKQ A;  3OH1 A;  4HO6 A;  5C36 A;  3TZT A;  2V0I A;  2OEF A;  2VXL A;  5C49 A;  3SX8 A;  1EZI A;  4M4K A;  2E8B A;  2VSH A;  1LZ7 A;  4NAK A;  2WAW A;  2OI5 A;  4EE4 A;  4G87 A;  4HO4 A;  4Y63 A;  4Y9X A;  2FFV A;  1GWW A;  5C4B A;  1FO8 A;  5CMG X;  3RMV A;  1H4E A;  1H5T B;  5C4D A;  4KPZ A;  2A8U A;  2UX8 A;  3V0L A;  1WSZ A;  2Y4K A;  4HO0 A;  4EE3 A;  1FRW A;  1JYL A;  1S4O A;  1YRO B;  1LZJ A;  2RJ7 A;  2GGO A;  1ON6 A;  1WT2 A;  3CU0 A;  5D92 A;  4HG6 A;  2I7B A;  1G8O A;  2GGQ A;  2RJ4 A;  2PA4 A;  1G3L A;  1OMZ A;  2E3D A;  4GBP A;  1VH3 A;  3DK5 A;  5BXC A;  4M2A A;  1TZF A;  1LL2 A;  1ZJ1 A;  2FYB A;  4B4G A;  4ARW A;  4FIY A;  1NKH B;  4CJ8 A;  1FWY A;  3I0H A;  1H4C A;  1R7V A;  3I0C A;  4FQW A;  1FO9 A;  1LZI A;  1R7Y A;  4YS8 A;  3T7N A;  5C3B A;  1TVY A;  3Q80 A;  1VGW A;  4DEC A;  5DDV A;  5AJP A;  3QVB A;  2RIT A;  3I0K A;  1SS9 A;  4FRH A;  2AE7 A;  2AM5 A;  4KXO A;  5EIY A;  1S4P A;  4FCE A;  4KPX A;  5FU0 A;  5FUH A;  2OI6 A;  1INI A;  4B2X A;  1TW5 A;  3OH2 A;  2O1G A;  4KQL A;  1JV1 A;  2AEC A;  3Q7U A;  2OI7 A;  2ICX A;  2X5S A;  2BO6 A;  2Y6P A;  3PKP A;  2X5Z A;  2Y7A A; 
#chains in the Genus database with same CATH homology
 5C3A A;  2D7I A;  2YQJ A;  3JUK A;  1R82 A;  3HL3 A;  1GA8 A;  3ST8 A;  2AM3 A;  5CQP A;  2WGZ A;  2O1H A;  4CVH A;  3DUV A;  1ZJ3 A;  4IRQ A;  3U2V A;  3OH0 A;  1YP2 A;  2V0K A;  4MYB A;  4L41 C;  3V90 A;  4HO3 A;  4M2B A;  1ZJ0 A;  5IDS A;  1ZJP A;  1VZT A;  1GX4 A;  1NF5 B;  3CKJ A;  5FTS A;  5IDT A;  1V82 A;  3SXC A;  4FRL A;  3V8Z A;  3BCV A;  4CJC A;  2CU2 A;  2W0W A;  3CKO A;  2P72 A;  1YP4 A;  4HO9 A;  3RSB A;  1ZCT A;  2V0H A;  2RIY A;  2WVK A;  3SX7 A;  1QWJ A;  4Y7T A;  1H7E A;  4FRM A;  1JV3 A;  3V91 A;  3ZGF A;  4LW3 A;  1IIM A;  2FYC B;  1LVW A;  5AJN A;  4B42 A;  2P6W A;  3BRK X;  3R3I A;  1O0R A;  4D0T A;  3CGX A;  5CQM X;  2YQC A;  4KC2 A;  1OMX A;  1EYR A;  1FGG A;  2NXV A;  2C0N A;  5C1H A;  4EVW A;  2YQS A;  2RJ9 A;  3FOQ A;  4M28 A;  1ZCU A;  2ZU8 A;  1G9R A;  3KIA A;  4ASY A;  5AJO A;  3CKQ A;  2VSI A;  3ZLL A;  1W55 A;  3D98 A;  4FRB A;  1VZU A;  5FTV A;  5JQQ A;  4NAL A;  1H7T A;  3LW6 A;  3V0N A;  2RJ5 A;  3FWW A;  1IIN A;  4MIX A;  3D8V A;  3T7M A;  1ZI4 A;  1H4D A;  3U2U A;  1R80 A;  2BO8 A;  1G0R A;  2ICY A;  1WT0 A;  1V83 A;  3I0L A;  1G93 A;  2A8W A;  3U2T A;  2WE9 A;  2AH9 A;  2RJ6 A;  1GQ9 A;  4IRP A;  4P02 A;  4KNR A;  5C3D A;  1HM0 A;  1VGT A;  1ZIZ A;  1H3M A;  1ZI1 A;  2FFU A;  4Q7C A;  5J49 A;  1H7Q A;  1MP3 A;  2XWN A;  4D11 C;  1G1L A;  1I52 A;  2YC5 A;  3ZF8 A;  4KT7 A;  2VXM A;  5CMH A;  1MP4 A;  3IOJ A;  1HM8 A;  1HJJ A;  3JUJ A;  1K4V A;  2XWM A;  1VZX A;  5CMJ A;  1FXJ A;  2RJ1 A;  2VK9 A;  2BO4 A;  2RIZ A;  1VIC A;  3R2W A;  5HS2 A;  1H5S A;  2WVM A;  4HO2 A;  5CQL X;  4FRO A;  2RIX A;  1H5S D;  2ZU9 A;  2RJ0 A;  4G3Q A;  2VS3 A;  2I5E A;  1INJ A;  3SXD A;  3SXG A;  1H5R A;  4B4B A;  2DPW A;  1YP3 A;  1FG5 N;  4NAN A;  2YQH A;  3I0J A;  2AM4 A;  3I0F A;  1ZCY A;  4MND A;  5C8R A;  4BMA A;  3V0P A;  4AYL A;  4B4M A;  1WT1 A;  1JVG A;  1ON8 A;  1VPA A;  3K8E A;  3V8Y A;  5D91 A;  1R7U A;  1H7G A;  2YCM A;  5I1F A;  1G97 A;  2YES A;  4G3S A;  3SXB A;  4C2S A;  3DJ4 A;  5FV9 A;  2XMH A;  3I0D A;  2OEG A;  4LW6 A;  4O6M A;  4D0Z A;  3K8D A;  3IOH A;  4ECM A;  2Y4M A;  1FR9 A;  3U2W A;  2QH5 A;  2D0J A;  2JCL A;  2MZB A;  2X60 A;  2Z87 A;  3V0M A;  3O3P A;  5CQN X;  1NMM B;  1MC3 A;  1VM8 A;  1GWV A;  4B5B A;  5C47 A;  4Y6N A;  1NWG B;  4BQH A;  3U0Y A;  4HOC A;  2J0A A;  3I0E A;  1VH1 A;  4Y7F A;  4AYJ A;  3Q4S A;  3GUE A;  1KWS A;  3OH4 A;  4FRE A;  1FXO A;  5EJ1 A;  1PZY B;  1NQI B;  3OAM A;  1JYK A;  3E25 A;  1W77 A;  4EEA A;  1R7X A;  5EJZ A;  2V0J A;  1LL3 A;  1R81 A;  4HO8 A;  3POL A;  2FYA A;  5FU8 A;  3EE5 A;  4D11 A;  5IFY A;  1ZJO A;  3U0X A;  1E5K A;  4B3U A;  1MP5 A;  2I5K A;  1QGS A;  2XWL A;  2V0L A;  1XZ6 A;  1ZI3 A;  1H7F A;  4FRQ A;  4JIS A;  1G2V A;  3E26 A;  5C48 A;  2VS4 A;  5C4F A;  5C1L A;  4DE7 A;  4ASJ A;  3I0I X;  2AGD A;  2QGI A;  1H7L A;  4DDZ A;  3V0O A;  2VD4 A;  1ZDG A;  3CKV A;  4UEG A;  1GQC A;  1ZJ2 A;  2JCJ A;  4NAI A;  1QGQ A;  2Q4J A;  3JTJ A;  1ZDF A;  2PGV A;  5L6V A;  2WEE A;  4FRP A;  2VS5 A;  2QKX A;  4J18 A;  1TW1 A;  1XHB A;  4EE5 A;  4O6N A;  1VGU A;  1WVC A;  3OC9 A;  1JVD A;  3OH3 A;  4AAW A;  4KNX A;  1GX0 A;  1ZHJ A;  2PGY A;  3IOI A;  2Z86 A;  1R7T A;  4KC1 A;  3SX3 A;  3V0Q A;  4HCQ A;  4E1K A;  3CKN A;  3ZGG A;  1PZT A;  5CMF X;  4CJB A;  1FZW A;  2JCO A;  2BO7 A;  2J0B A;  1O7O A;  2YC3 A;  2O1F A;  5CQO A;  3U2X A;  4R7P A;  3SXE A;  2VFZ A;  4KRV A;  4EEG A;  3OKR A;  2APC A;  4Y64 A;  3ZLK A;  3RMW A;  1ZCV A;  1LL0 A;  1O7Q A;  1WT3 A;  2Y4J A;  4D48 A;  1H7H A;  2X65 A;  4KC4 A;  2AES A;  3T7O A;  5DDT A;  4ZDQ A;  2JCK A;  2FY7 A;  1H5T A;  3SPT A;  2FYD B;  4P00 A;  1FR8 A;  1LZ0 A;  1HM9 A;  3D5N A;  1OQM B;  4EEM A;  3SXA A;  4K6R A;  3PNN A;  2RJ8 A;  2W0V A;  1W57 A;  4JD0 A;  2D7R A;  2ZU7 A;  3SX5 A;  1O23 B;  1Z90 A;  5C1G A;  1QG8 A;  5FYE A;  5C4E A;  4FRD A;  4Y7G A;  4FCU A;  1FOA A;  1S4N A;  5C38 A;  4G3P A;  1H5S C;  4Y7V A;  1HJL A;  1HV9 A;  5CMI A;  4EEO A;  5C4C A;  2PX7 A;  1FGX A;  2Y4L A;  3I0G A;  3TQD A;  4XWI A;  2XME A;  3F1C A;  4Y62 A;  3N9W A;  4HO5 A;  1G23 A;  1G95 A;  1ZI5 A;  2P73 A;  4Y6U A;  5L6S A;  1H5S B;  4FIX A;  1V84 A;  4B2W A;  3OGZ A;  4AC3 A;  4Y7U A;  3USQ A;  4FRA A;  3NGW A;  1NHE B;  3USR A;  1VGZ A;  3F1Y A;  2WVL A;  1H5R B;  3PKQ A;  3OH1 A;  4HO6 A;  5C36 A;  3TZT A;  2V0I A;  2OEF A;  2VXL A;  5C49 A;  3SX8 A;  1EZI A;  4M4K A;  2E8B A;  2VSH A;  1LZ7 A;  4NAK A;  2WAW A;  2OI5 A;  4EE4 A;  4G87 A;  4HO4 A;  4Y63 A;  4Y9X A;  2FFV A;  1GWW A;  5C4B A;  1FO8 A;  5CMG X;  3RMV A;  1H4E A;  1H5T B;  5C4D A;  4KPZ A;  2A8U A;  2UX8 A;  3V0L A;  1WSZ A;  2Y4K A;  4HO0 A;  4EE3 A;  1FRW A;  1JYL A;  1S4O A;  1YRO B;  1LZJ A;  2RJ7 A;  2GGO A;  1ON6 A;  1WT2 A;  3CU0 A;  5D92 A;  4HG6 A;  2I7B A;  1G8O A;  2GGQ A;  2RJ4 A;  2PA4 A;  1G3L A;  1OMZ A;  2E3D A;  4GBP A;  1VH3 A;  3DK5 A;  5BXC A;  4M2A A;  1TZF A;  1LL2 A;  1ZJ1 A;  2FYB A;  4B4G A;  4ARW A;  4FIY A;  1NKH B;  4CJ8 A;  1FWY A;  3I0H A;  1H4C A;  1R7V A;  3I0C A;  4FQW A;  1FO9 A;  1LZI A;  1R7Y A;  4YS8 A;  3T7N A;  5C3B A;  1TVY A;  3Q80 A;  1VGW A;  4DEC A;  5DDV A;  5AJP A;  3QVB A;  2RIT A;  3I0K A;  1SS9 A;  4FRH A;  2AE7 A;  2AM5 A;  4KXO A;  5EIY A;  1S4P A;  4FCE A;  4KPX A;  5FU0 A;  5FUH A;  2OI6 A;  1INI A;  4B2X A;  1TW5 A;  3OH2 A;  2O1G A;  4KQL A;  1JV1 A;  2AEC A;  3Q7U A;  2OI7 A;  2ICX A;  2X5S A;  2BO6 A;  2Y6P A;  3PKP A;  2X5Z A;  2Y7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...