3I0FA

Crystal structure of gtb c80s/c196s + udp + h antigen
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
277
structure length
268
Chain Sequence
YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGMRRMEMISDFSERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 268
sequence length 277
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0fA00
1G97A 1WSZA 3ZF8A 2W0VA 4E1KA 5DDVA 3GUEA 3I0JA 1S4OA 3D5NA 2OEFA 2XWNA 4M2AA 2RJ8A 4D0ZA 1FGXA 2PGVA 2VS3A 5L6VA 2YC5A 3KIAA 1FXJA 1QGSA 2D7RA 2UX8A 4KT7A 3PKPA 1ZCVA 3SXEA 2JCJA 4G87A 1VPAA 3CKNA 3OH4A 1XHBA 1ZJ0A 1YP3A 2YESA 1JVGA 3SX3A 2VSHA 4G3SA 2ZU9A 3OKRA 1VGWA 1MP4A 4CJCA 4J18A 1OMZA 2V0LA 1H5SB 3OH0A 1ZI3A 1O23B 4EEMA 2ZU8A 3V90A 1ZI4A 4FQWA 2PGYA 1H4EA 1QG8A 1G93A 1ZDFA 3OC9A 1VGTA 5CMFX 5EIYA 1JVDA 2Y4MA 3SX8A 4FCUA 1HJLA 5C1GA 2WE9A 1GWWA 4D48A 2O1FA 1H7GA 1MP3A 1H7HA 2FFUA 2FY7A 1INIA 1H3MA 4Y7TA 1ZCYA 1TW1A 3SXBA 3K8DA 4G3PA 4EE3A 5HS2A 3PNNA 3ST8A 4CJ8A 4K6RA 4M28A 2AECA 4HG6A 5I1FA 4B3UA 1ZI5A 1S4NA 1LZ0A 4NALA 3K8EA 2ICYA 2I7BA 3ZLLA 5CMHA 3CKQA 3E25A 1FRWA 4HOCA 3U0XA 5L6SA 1WT1A 4CVHA 2V0KA 5C3AA 1HV9A 4Y63A 5CMIA 4Y7GA 2Y4KA 1ZCTA 2FYAA 2QH5A 2Z87A 1WT2A 1MP5A 4EEGA 4KPXA 2JCKA 4DECA 5C49A 1V84A 2RJ9A 3V0QA 1FWYA 2VXMA 3IOHA 1W55A 1FG5N 1LZ7A 1NF5B 3V0MA 5CQPA 3SX5A 3N9WA 3PKQA 1ZIZA 3D98A 2DPWA 1G3LA 4HO9A 1H7QA 2OI7A 2OI5A 1IINA 3RMWA 1H5TA 1O0RA 1WT0A 1YP2A 2JCLA 1ON8A 4HO3A 5FTVA 3HL3A 3Q7UA 5CQNX 4B4GA 3CKJA 1E5KA 2RITA 4NAKA 3U2VA 4ASYA 4FRAA 4UEGA 2WVKA 1WVCA 1H5RB 4IRQA 1TZFA 2O1GA 4D11A 2Y6PA 2ZU7A 5FU8A 4KPZA 5CMJA 3SXDA 2XWLA 4AAWA 5C1HA 4FRBA 3F1YA 3FWWA 2VD4A 4MYBA 5C4DA 4KXOA 2BO6A 2YQHA 4B2XA 3DK5A 2P6WA 1ZJPA 4LW3A 2CU2A 2X5ZA 4JISA 4FRQA 4MNDA 1ZDGA 2AH9A 1G0RA 1R7UA 4HO0A 2WEEA 1IIMA 4EE5A 4NAIA 2X5SA 4FRPA 2XMHA 1QWJA 5C1LA 3T7NA 4B4MA 1H5SA 1R7TA 1HM0A 2V0JA 4Y6NA 1GQCA 1JYKA 4Y62A 3V0NA 2YCMA 3TQDA 1GA8A 1G8OA 1H7EA 2W0WA 5C48A 1FR8A 3BCVA 1H4DA 3I0DA 4R7PA 2VFZA 3R3IA 4D11C 3SXCA 3RMVA 1W57A 3TZTA 1R82A 1HM8A 4AYLA 2AE7A 2E8BA 1HJJA 3I0EA 3V8YA 4C2SA 4FRHA 1FXOA 3OH1A 1TVYA 4M2BA 2FFVA 1ZJ2A 2PA4A 2RJ1A 5C4CA 1EYRA 1JV3A 1GQ9A 2RJ4A 2BO4A 1NQIB 2A8UA 2RJ7A 4KC4A 2VXLA 4L41C 5C47A 3I0FA 5J49A 2NXVA 3Q4SA 1QGQA 3V0PA 1TW5A 5IFYA 3JUJA 4BQHA 4Y7VA 1K4VA 4ECMA 2WVMA 4Y7UA 1FR9A 3OAMA 2WVLA 1VGZA 1NMMB 2Z86A 4LW6A 2YC3A 4EEAA 5BXCA 2V0IA 2AESA 1INJA 2Q4JA 4G3QA 4KRVA 1G9RA 1I52A 1VH1A 2YQCA 3DJ4A 3DUVA 5CQMX 1KWSA 1VZXA 1ZI1A 4EE4A 3R2WA 3I0IX 3BRKX 5C4BA 2A8WA 3EE5A 4XWIA 2QGIA 4Y7FA 3E26A 1R80A 3OGZA 5EJ1A 4EVWA 4B42A 3U0YA 3LW6A 3SX7A 3USRA 4ARWA 1O7QA 2Y7AA 3I0GA 1PZTA 3FOQA 1FO8A 1V83A 2WGZA 4HCQA 3CGXA 3O3PA 3D8VA 1H7FA 4DDZA 4M4KA 3RSBA 2X60A 4GBPA 1FGGA 1H5RA 3Q80A 1NWGB 1LZIA 1ZCUA 4JD0A 4FRMA 2BO7A 1H5SD 4KNXA 1Z90A 2RIXA 2QKXA 2RJ0A 5EJZA 3ZGGA 2XMEA 3NGWA 4EEOA 5CMGX 2O1HA 1S4PA 1YP4A 3I0CA 5CQLX 4D0TA 1FOAA 1VM8A 2GGQA 2ICXA 2PX7A 4B4BA 5C36A 4B2WA 2P72A 1ZJ3A 1NHEB 1R7YA 1JV1A 2AM5A 4DE7A 3T7OA 3SXGA 5JQQA 4HO5A 5FU0A 2RJ6A 1XZ6A 1ZJ1A 2P73A 3JUKA 1VZUA 5C3BA 5FV9A 2D7IA 2XWMA 2I5EA 4BMAA 1EZIA 5C4FA 2OEGA 1GX4A 2AM3A 5AJNA 4Y6UA 4FROA 1R81A 4CJBA 2AM4A 4KC2A 1LVWA 3I0LA 1FZWA 1WT3A 4ASJA 5DDTA 4Y64A 1SS9A 2WAWA 1G95A 1YROB 1LL2A 3POLA 3I0HA 1G1LA 2MZBA 2Y4LA 4AC3A 3V8ZA 1G2VA 2X65A 4ZDQA 5AJOA 2E3DA 3U2WA 3ZGFA 5IDSA 1H5SC 4FREA 1OQMB 1R7VA 3U2TA 5C3DA 2YQSA 1VZTA 2V0HA 1H7LA 1GX0A 5FUHA 1JYLA 2VS4A 3IOIA 5C8RA 3U2UA 5C38A 4KC1A 1VGUA 4KNRA 2AGDA 2VS5A 3SXAA 1FO9A 1MC3A 2JCOA 2FYDB 3JTJA 1LZJA 3CKVA 4NANA 4HO8A 4IRPA 4YS8A 3ZLKA 1W77A 1ON6A 5IDTA 1V82A 3OH2A 2Y4JA 3IOJA 3USQA 4HO6A 2VSIA 3F1CA 3V0OA 4FRLA 4Y9XA 1NKHB 2RJ5A 3I0KA 4FCEA 1LL0A 1G23A 2FYCB 4HO2A 2GGOA 5C4EA 2RIYA 3V91A 1R7XA 3CU0A 2YQJA 1VICA 1H7TA 1VH3A 4AYJA 4P02A 4HO4A 3U2XA 3T7MA 1O7OA 4KQLA 5CQOA 4FRDA 4B5BA 2APCA 5FYEA 3OH3A 1PZYB 2BO8A 1LL3A 5AJPA 5FTSA 1H5TB 1GWVA 3V0LA 1ZHJA 1OMXA 2RIZA 4P00A 2OI6A 1H4CA 2FYBA 1ZJOA 2D0JA 3CKOA 3SPTA 2I5KA 1HM9A 3QVBA
chains in the Genus database with same CATH superfamily
1G97A 1WSZA 3ZF8A 2W0VA 4E1KA 5DDVA 3GUEA 3I0JA 1S4OA 3D5NA 2OEFA 2XWNA 4M2AA 2RJ8A 4D0ZA 1FGXA 2PGVA 2VS3A 5L6VA 2YC5A 3KIAA 1FXJA 1QGSA 2D7RA 2UX8A 4KT7A 3PKPA 1ZCVA 3SXEA 2JCJA 4G87A 1VPAA 3CKNA 3OH4A 1XHBA 1ZJ0A 1YP3A 2YESA 1JVGA 3SX3A 2VSHA 4G3SA 2ZU9A 3OKRA 1VGWA 1MP4A 4CJCA 4J18A 1OMZA 2V0LA 1H5SB 3OH0A 1ZI3A 4O6NA 1O23B 4EEMA 2ZU8A 3V90A 1ZI4A 4FQWA 2PGYA 1H4EA 1QG8A 1G93A 1ZDFA 3OC9A 1VGTA 5CMFX 5EIYA 1JVDA 2Y4MA 3SX8A 4FCUA 1HJLA 5C1GA 2WE9A 1GWWA 4D48A 2O1FA 1H7GA 1MP3A 1H7HA 2C0NA 2FFUA 2FY7A 1INIA 1H3MA 4Y7TA 1ZCYA 1TW1A 3SXBA 3K8DA 4G3PA 4EE3A 5HS2A 3PNNA 3ST8A 4CJ8A 4K6RA 4M28A 2AECA 4HG6A 5I1FA 4B3UA 1ZI5A 1S4NA 1LZ0A 4NALA 3K8EA 2ICYA 2I7BA 3ZLLA 5CMHA 3CKQA 3E25A 1FRWA 4HOCA 3U0XA 5L6SA 1WT1A 4CVHA 2V0KA 5C3AA 1HV9A 4Y63A 5CMIA 4Y7GA 2Y4KA 1ZCTA 2FYAA 2QH5A 2Z87A 2J0BA 1WT2A 1MP5A 4EEGA 4KPXA 2JCKA 4DECA 5C49A 1V84A 2RJ9A 3V0QA 1FWYA 2VXMA 3IOHA 1W55A 1FG5N 1LZ7A 1NF5B 3V0MA 5CQPA 3SX5A 3N9WA 3PKQA 1ZIZA 3D98A 2DPWA 1G3LA 4HO9A 1H7QA 2OI7A 2OI5A 1IINA 3RMWA 1H5TA 1O0RA 1WT0A 1YP2A 2JCLA 1ON8A 4HO3A 5FTVA 3HL3A 3Q7UA 5CQNX 4B4GA 3CKJA 1E5KA 2RITA 4NAKA 3U2VA 4ASYA 4FRAA 4UEGA 2WVKA 1WVCA 1H5RB 4IRQA 1TZFA 2O1GA 4D11A 2Y6PA 2ZU7A 5FU8A 4KPZA 5CMJA 3SXDA 2XWLA 4AAWA 5C1HA 4FRBA 3F1YA 3FWWA 2VD4A 4MYBA 5C4DA 4KXOA 2BO6A 2YQHA 4B2XA 3DK5A 2P6WA 1ZJPA 4LW3A 2CU2A 2X5ZA 4JISA 4FRQA 4MNDA 1ZDGA 2AH9A 1G0RA 1R7UA 4HO0A 2WEEA 1IIMA 4EE5A 5D92A 4NAIA 2X5SA 4FRPA 2XMHA 1QWJA 5C1LA 3T7NA 4B4MA 1H5SA 1R7TA 1HM0A 2V0JA 4Y6NA 1GQCA 1JYKA 4Y62A 3V0NA 2YCMA 3TQDA 1GA8A 1G8OA 1H7EA 2W0WA 5C48A 1FR8A 3BCVA 1H4DA 3I0DA 4R7PA 2VFZA 3R3IA 4D11C 3SXCA 3RMVA 1W57A 3TZTA 1R82A 1HM8A 4AYLA 2AE7A 2E8BA 1HJJA 3I0EA 3V8YA 4C2SA 4FRHA 1FXOA 3OH1A 1TVYA 4M2BA 2FFVA 1ZJ2A 2PA4A 2RJ1A 5C4CA 1EYRA 1JV3A 1GQ9A 2RJ4A 2BO4A 1NQIB 2A8UA 2RJ7A 4KC4A 2VXLA 4L41C 5C47A 3I0FA 5J49A 2NXVA 3Q4SA 1QGQA 3V0PA 1TW5A 5IFYA 3JUJA 4BQHA 4Y7VA 1K4VA 4ECMA 2WVMA 4Y7UA 1FR9A 3OAMA 2WVLA 1VGZA 1NMMB 2Z86A 4LW6A 2YC3A 4EEAA 5BXCA 2V0IA 2AESA 1INJA 2Q4JA 4G3QA 4KRVA 1G9RA 1I52A 1VH1A 2YQCA 3DJ4A 3DUVA 5CQMX 1KWSA 1VZXA 1ZI1A 4EE4A 3R2WA 3I0IX 3BRKX 5C4BA 2A8WA 3EE5A 4XWIA 2QGIA 4Y7FA 3E26A 1R80A 3OGZA 5EJ1A 2VK9A 4EVWA 4B42A 3U0YA 3LW6A 3SX7A 3USRA 4ARWA 1O7QA 2Y7AA 3I0GA 1PZTA 3FOQA 1FO8A 1V83A 2WGZA 4HCQA 3CGXA 3O3PA 3D8VA 1H7FA 4DDZA 4M4KA 3RSBA 2X60A 4GBPA 1FGGA 1H5RA 3Q80A 1NWGB 1LZIA 1ZCUA 4JD0A 4FRMA 4O6MA 5D91A 2BO7A 1H5SD 4KNXA 1Z90A 2RIXA 2QKXA 2RJ0A 5EJZA 3ZGGA 2XMEA 3NGWA 4EEOA 5CMGX 2O1HA 1S4PA 1YP4A 3I0CA 5CQLX 4D0TA 1FOAA 1VM8A 2GGQA 2ICXA 2PX7A 4B4BA 5C36A 4B2WA 2P72A 1ZJ3A 1NHEB 1R7YA 1JV1A 2AM5A 4DE7A 3T7OA 3SXGA 5JQQA 4HO5A 5FU0A 2RJ6A 4FIXA 1XZ6A 1ZJ1A 2P73A 3JUKA 1VZUA 5C3BA 5FV9A 4Q7CA 2D7IA 2XWMA 2I5EA 4BMAA 1EZIA 5C4FA 2OEGA 1GX4A 2AM3A 5AJNA 4Y6UA 4FROA 1R81A 4CJBA 2AM4A 4KC2A 1LVWA 3I0LA 1FZWA 1WT3A 4ASJA 5DDTA 4Y64A 1SS9A 2WAWA 1G95A 1YROB 1LL2A 3POLA 3I0HA 1G1LA 2MZBA 2Y4LA 4AC3A 3V8ZA 1G2VA 2X65A 4ZDQA 5AJOA 2E3DA 3U2WA 3ZGFA 5IDSA 1H5SC 4FREA 1OQMB 1R7VA 3U2TA 5C3DA 2YQSA 1VZTA 2V0HA 1H7LA 1GX0A 5FUHA 1JYLA 2VS4A 3IOIA 5C8RA 3U2UA 2J0AA 5C38A 4FIYA 4KC1A 1VGUA 4KNRA 2AGDA 2VS5A 3SXAA 1FO9A 1MC3A 2JCOA 2FYDB 3JTJA 1LZJA 3CKVA 4NANA 4HO8A 4IRPA 4YS8A 3ZLKA 1W77A 1ON6A 5IDTA 1V82A 3OH2A 2Y4JA 3IOJA 3USQA 4HO6A 2VSIA 3F1CA 3V0OA 4FRLA 4Y9XA 1NKHB 2RJ5A 3I0KA 4MIXA 4FCEA 1LL0A 1G23A 2FYCB 4HO2A 2GGOA 5C4EA 2RIYA 3V91A 1R7XA 3CU0A 2YQJA 1VICA 1H7TA 1VH3A 4AYJA 4P02A 4HO4A 3U2XA 3T7MA 1O7OA 4KQLA 5CQOA 4FRDA 4B5BA 2APCA 5FYEA 3OH3A 1PZYB 2BO8A 1LL3A 5AJPA 5FTSA 1H5TB 1GWVA 3V0LA 1ZHJA 1OMXA 2RIZA 4P00A 2OI6A 1H4CA 2FYBA 1ZJOA 2D0JA 3CKOA 3SPTA 2I5KA 1HM9A 3QVBA
chains in the Genus database with same CATH topology
1G97A 1WSZA 3ZF8A 2W0VA 4E1KA 5DDVA 3GUEA 3I0JA 1S4OA 3D5NA 2OEFA 2XWNA 4M2AA 2RJ8A 4D0ZA 1FGXA 2PGVA 2VS3A 5L6VA 2YC5A 3KIAA 1FXJA 1QGSA 2D7RA 2UX8A 4KT7A 3PKPA 1ZCVA 3SXEA 2JCJA 4G87A 1VPAA 3CKNA 3OH4A 1XHBA 1ZJ0A 1YP3A 2YESA 1JVGA 3SX3A 2VSHA 4G3SA 2ZU9A 3OKRA 1VGWA 1MP4A 4CJCA 4J18A 1OMZA 2V0LA 1H5SB 3OH0A 1ZI3A 4O6NA 1O23B 4EEMA 2ZU8A 3V90A 1ZI4A 4FQWA 2PGYA 1H4EA 1QG8A 1G93A 1ZDFA 3OC9A 1VGTA 5CMFX 5EIYA 1JVDA 2Y4MA 3SX8A 4FCUA 1HJLA 5C1GA 2WE9A 1GWWA 4D48A 2O1FA 1H7GA 1MP3A 1H7HA 2C0NA 2FFUA 2FY7A 1INIA 1H3MA 4Y7TA 1ZCYA 1TW1A 3SXBA 3K8DA 4G3PA 4EE3A 5HS2A 3PNNA 3ST8A 4CJ8A 4K6RA 4M28A 2AECA 4HG6A 5I1FA 4B3UA 1ZI5A 1S4NA 1LZ0A 4NALA 3K8EA 2ICYA 2I7BA 3ZLLA 5CMHA 3CKQA 3E25A 1FRWA 4HOCA 3U0XA 5L6SA 1WT1A 4CVHA 2V0KA 5C3AA 1HV9A 4Y63A 5CMIA 4Y7GA 2Y4KA 1ZCTA 2FYAA 2QH5A 2Z87A 2J0BA 1WT2A 1MP5A 4EEGA 4KPXA 2JCKA 4DECA 5C49A 1V84A 2RJ9A 3V0QA 1FWYA 2VXMA 3IOHA 1W55A 1FG5N 1LZ7A 1NF5B 3V0MA 5CQPA 3SX5A 3N9WA 3PKQA 1ZIZA 3D98A 2DPWA 1G3LA 4HO9A 1H7QA 2OI7A 2OI5A 1IINA 3RMWA 1H5TA 1O0RA 1WT0A 1YP2A 2JCLA 1ON8A 4HO3A 5FTVA 3HL3A 3Q7UA 5CQNX 4B4GA 3CKJA 1E5KA 2RITA 4NAKA 3U2VA 4ASYA 4FRAA 4UEGA 2WVKA 1WVCA 1H5RB 4IRQA 1TZFA 2O1GA 4D11A 2Y6PA 2ZU7A 5FU8A 4KPZA 5CMJA 3SXDA 2XWLA 4AAWA 5C1HA 4FRBA 3F1YA 3FWWA 2VD4A 4MYBA 5C4DA 4KXOA 2BO6A 2YQHA 4B2XA 3DK5A 2P6WA 1ZJPA 4LW3A 2CU2A 2X5ZA 4JISA 4FRQA 4MNDA 1ZDGA 2AH9A 1G0RA 1R7UA 4HO0A 2WEEA 1IIMA 4EE5A 5D92A 4NAIA 2X5SA 4FRPA 2XMHA 1QWJA 5C1LA 3T7NA 4B4MA 1H5SA 1R7TA 1HM0A 2V0JA 4Y6NA 1GQCA 1JYKA 4Y62A 3V0NA 2YCMA 3TQDA 1GA8A 1G8OA 1H7EA 2W0WA 5C48A 1FR8A 3BCVA 1H4DA 3I0DA 4R7PA 2VFZA 3R3IA 4D11C 3SXCA 3RMVA 1W57A 3TZTA 1R82A 1HM8A 4AYLA 2AE7A 2E8BA 1HJJA 3I0EA 3V8YA 4C2SA 4FRHA 1FXOA 3OH1A 1TVYA 4M2BA 2FFVA 1ZJ2A 2PA4A 2RJ1A 5C4CA 1EYRA 1JV3A 1GQ9A 2RJ4A 2BO4A 1NQIB 2A8UA 2RJ7A 4KC4A 2VXLA 4L41C 5C47A 3I0FA 5J49A 2NXVA 3Q4SA 1QGQA 3V0PA 1TW5A 5IFYA 3JUJA 4BQHA 4Y7VA 1K4VA 4ECMA 2WVMA 4Y7UA 1FR9A 3OAMA 2WVLA 1VGZA 1NMMB 2Z86A 4LW6A 2YC3A 4EEAA 5BXCA 2V0IA 2AESA 1INJA 2Q4JA 4G3QA 4KRVA 1G9RA 1I52A 1VH1A 2YQCA 3DJ4A 3DUVA 5CQMX 1KWSA 1VZXA 1ZI1A 4EE4A 3R2WA 3I0IX 3BRKX 5C4BA 2A8WA 3EE5A 4XWIA 2QGIA 4Y7FA 3E26A 1R80A 3OGZA 5EJ1A 2VK9A 4EVWA 4B42A 3U0YA 3LW6A 3SX7A 3USRA 4ARWA 1O7QA 2Y7AA 3I0GA 1PZTA 3FOQA 1FO8A 1V83A 2WGZA 4HCQA 3CGXA 3O3PA 3D8VA 1H7FA 4DDZA 4M4KA 3RSBA 2X60A 4GBPA 1FGGA 1H5RA 3Q80A 1NWGB 1LZIA 1ZCUA 4JD0A 4FRMA 4O6MA 5D91A 2BO7A 1H5SD 4KNXA 1Z90A 2RIXA 2QKXA 2RJ0A 5EJZA 3ZGGA 2XMEA 3NGWA 4EEOA 5CMGX 2O1HA 1S4PA 1YP4A 3I0CA 5CQLX 4D0TA 1FOAA 1VM8A 2GGQA 2ICXA 2PX7A 4B4BA 5C36A 4B2WA 2P72A 1ZJ3A 1NHEB 1R7YA 1JV1A 2AM5A 4DE7A 3T7OA 3SXGA 5JQQA 4HO5A 5FU0A 2RJ6A 4FIXA 1XZ6A 1ZJ1A 2P73A 3JUKA 1VZUA 5C3BA 5FV9A 4Q7CA 2D7IA 2XWMA 2I5EA 4BMAA 1EZIA 5C4FA 2OEGA 1GX4A 2AM3A 5AJNA 4Y6UA 4FROA 1R81A 4CJBA 2AM4A 4KC2A 1LVWA 3I0LA 1FZWA 1WT3A 4ASJA 5DDTA 4Y64A 1SS9A 2WAWA 1G95A 1YROB 1LL2A 3POLA 3I0HA 1G1LA 2MZBA 2Y4LA 4AC3A 3V8ZA 1G2VA 2X65A 4ZDQA 5AJOA 2E3DA 3U2WA 3ZGFA 5IDSA 1H5SC 4FREA 1OQMB 1R7VA 3U2TA 5C3DA 2YQSA 1VZTA 2V0HA 1H7LA 1GX0A 5FUHA 1JYLA 2VS4A 3IOIA 5C8RA 3U2UA 2J0AA 5C38A 4FIYA 4KC1A 1VGUA 4KNRA 2AGDA 2VS5A 3SXAA 1FO9A 1MC3A 2JCOA 2FYDB 3JTJA 1LZJA 3CKVA 4NANA 4HO8A 4IRPA 4YS8A 3ZLKA 1W77A 1ON6A 5IDTA 1V82A 3OH2A 2Y4JA 3IOJA 3USQA 4HO6A 2VSIA 3F1CA 3V0OA 4FRLA 4Y9XA 1NKHB 2RJ5A 3I0KA 4MIXA 4FCEA 1LL0A 1G23A 2FYCB 4HO2A 2GGOA 5C4EA 2RIYA 3V91A 1R7XA 3CU0A 2YQJA 1VICA 1H7TA 1VH3A 4AYJA 4P02A 4HO4A 3U2XA 3T7MA 1O7OA 4KQLA 5CQOA 4FRDA 4B5BA 2APCA 5FYEA 3OH3A 1PZYB 2BO8A 1LL3A 5AJPA 5FTSA 1H5TB 1GWVA 3V0LA 1ZHJA 1OMXA 2RIZA 4P00A 2OI6A 1H4CA 2FYBA 1ZJOA 2D0JA 3CKOA 3SPTA 2I5KA 1HM9A 3QVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G97 A;  1WSZ A;  3ZF8 A;  2W0V A;  4E1K A;  5DDV A;  3GUE A;  3I0J A;  1S4O A;  3D5N A;  2OEF A;  2XWN A;  4M2A A;  2RJ8 A;  4D0Z A;  1FGX A;  2PGV A;  2VS3 A;  5L6V A;  2YC5 A;  3KIA A;  1FXJ A;  1QGS A;  2D7R A;  2UX8 A;  4KT7 A;  3PKP A;  1ZCV A;  3SXE A;  2JCJ A;  4G87 A;  1VPA A;  3CKN A;  3OH4 A;  1XHB A;  1ZJ0 A;  1YP3 A;  2YES A;  1JVG A;  3SX3 A;  2VSH A;  4G3S A;  2ZU9 A;  3OKR A;  1VGW A;  1MP4 A;  4CJC A;  4J18 A;  1OMZ A;  2V0L A;  1H5S B;  3OH0 A;  1ZI3 A;  1O23 B;  4EEM A;  2ZU8 A;  3V90 A;  1ZI4 A;  4FQW A;  2PGY A;  1H4E A;  1QG8 A;  1G93 A;  1ZDF A;  3OC9 A;  1VGT A;  5CMF X;  5EIY A;  1JVD A;  2Y4M A;  3SX8 A;  4FCU A;  1HJL A;  5C1G A;  2WE9 A;  1GWW A;  4D48 A;  2O1F A;  1H7G A;  1MP3 A;  1H7H A;  2FFU A;  2FY7 A;  1INI A;  1H3M A;  4Y7T A;  1ZCY A;  1TW1 A;  3SXB A;  3K8D A;  4G3P A;  4EE3 A;  5HS2 A;  3PNN A;  3ST8 A;  4CJ8 A;  4K6R A;  4M28 A;  2AEC A;  4HG6 A;  5I1F A;  4B3U A;  1ZI5 A;  1S4N A;  1LZ0 A;  4NAL A;  3K8E A;  2ICY A;  2I7B A;  3ZLL A;  5CMH A;  3CKQ A;  3E25 A;  1FRW A;  4HOC A;  3U0X A;  5L6S A;  1WT1 A;  4CVH A;  2V0K A;  5C3A A;  1HV9 A;  4Y63 A;  5CMI A;  4Y7G A;  2Y4K A;  1ZCT A;  2FYA A;  2QH5 A;  2Z87 A;  1WT2 A;  1MP5 A;  4EEG A;  4KPX A;  2JCK A;  4DEC A;  5C49 A;  1V84 A;  2RJ9 A;  3V0Q A;  1FWY A;  2VXM A;  3IOH A;  1W55 A;  1FG5 N;  1LZ7 A;  1NF5 B;  3V0M A;  5CQP A;  3SX5 A;  3N9W A;  3PKQ A;  1ZIZ A;  3D98 A;  2DPW A;  1G3L A;  4HO9 A;  1H7Q A;  2OI7 A;  2OI5 A;  1IIN A;  3RMW A;  1H5T A;  1O0R A;  1WT0 A;  1YP2 A;  2JCL A;  1ON8 A;  4HO3 A;  5FTV A;  3HL3 A;  3Q7U A;  5CQN X;  4B4G A;  3CKJ A;  1E5K A;  2RIT A;  4NAK A;  3U2V A;  4ASY A;  4FRA A;  4UEG A;  2WVK A;  1WVC A;  1H5R B;  4IRQ A;  1TZF A;  2O1G A;  4D11 A;  2Y6P A;  2ZU7 A;  5FU8 A;  4KPZ A;  5CMJ A;  3SXD A;  2XWL A;  4AAW A;  5C1H A;  4FRB A;  3F1Y A;  3FWW A;  2VD4 A;  4MYB A;  5C4D A;  4KXO A;  2BO6 A;  2YQH A;  4B2X A;  3DK5 A;  2P6W A;  1ZJP A;  4LW3 A;  2CU2 A;  2X5Z A;  4JIS A;  4FRQ A;  4MND A;  1ZDG A;  2AH9 A;  1G0R A;  1R7U A;  4HO0 A;  2WEE A;  1IIM A;  4EE5 A;  4NAI A;  2X5S A;  4FRP A;  2XMH A;  1QWJ A;  5C1L A;  3T7N A;  4B4M A;  1H5S A;  1R7T A;  1HM0 A;  2V0J A;  4Y6N A;  1GQC A;  1JYK A;  4Y62 A;  3V0N A;  2YCM A;  3TQD A;  1GA8 A;  1G8O A;  1H7E A;  2W0W A;  5C48 A;  1FR8 A;  3BCV A;  1H4D A;  3I0D A;  4R7P A;  2VFZ A;  3R3I A;  4D11 C;  3SXC A;  3RMV A;  1W57 A;  3TZT A;  1R82 A;  1HM8 A;  4AYL A;  2AE7 A;  2E8B A;  1HJJ A;  3I0E A;  3V8Y A;  4C2S A;  4FRH A;  1FXO A;  3OH1 A;  1TVY A;  4M2B A;  2FFV A;  1ZJ2 A;  2PA4 A;  2RJ1 A;  5C4C A;  1EYR A;  1JV3 A;  1GQ9 A;  2RJ4 A;  2BO4 A;  1NQI B;  2A8U A;  2RJ7 A;  4KC4 A;  2VXL A;  4L41 C;  5C47 A;  3I0F A;  5J49 A;  2NXV A;  3Q4S A;  1QGQ A;  3V0P A;  1TW5 A;  5IFY A;  3JUJ A;  4BQH A;  4Y7V A;  1K4V A;  4ECM A;  2WVM A;  4Y7U A;  1FR9 A;  3OAM A;  2WVL A;  1VGZ A;  1NMM B;  2Z86 A;  4LW6 A;  2YC3 A;  4EEA A;  5BXC A;  2V0I A;  2AES A;  1INJ A;  2Q4J A;  4G3Q A;  4KRV A;  1G9R A;  1I52 A;  1VH1 A;  2YQC A;  3DJ4 A;  3DUV A;  5CQM X;  1KWS A;  1VZX A;  1ZI1 A;  4EE4 A;  3R2W A;  3I0I X;  3BRK X;  5C4B A;  2A8W A;  3EE5 A;  4XWI A;  2QGI A;  4Y7F A;  3E26 A;  1R80 A;  3OGZ A;  5EJ1 A;  4EVW A;  4B42 A;  3U0Y A;  3LW6 A;  3SX7 A;  3USR A;  4ARW A;  1O7Q A;  2Y7A A;  3I0G A;  1PZT A;  3FOQ A;  1FO8 A;  1V83 A;  2WGZ A;  4HCQ A;  3CGX A;  3O3P A;  3D8V A;  1H7F A;  4DDZ A;  4M4K A;  3RSB A;  2X60 A;  4GBP A;  1FGG A;  1H5R A;  3Q80 A;  1NWG B;  1LZI A;  1ZCU A;  4JD0 A;  4FRM A;  2BO7 A;  1H5S D;  4KNX A;  1Z90 A;  2RIX A;  2QKX A;  2RJ0 A;  5EJZ A;  3ZGG A;  2XME A;  3NGW A;  4EEO A;  5CMG X;  2O1H A;  1S4P A;  1YP4 A;  3I0C A;  5CQL X;  4D0T A;  1FOA A;  1VM8 A;  2GGQ A;  2ICX A;  2PX7 A;  4B4B A;  5C36 A;  4B2W A;  2P72 A;  1ZJ3 A;  1NHE B;  1R7Y A;  1JV1 A;  2AM5 A;  4DE7 A;  3T7O A;  3SXG A;  5JQQ A;  4HO5 A;  5FU0 A;  2RJ6 A;  1XZ6 A;  1ZJ1 A;  2P73 A;  3JUK A;  1VZU A;  5C3B A;  5FV9 A;  2D7I A;  2XWM A;  2I5E A;  4BMA A;  1EZI A;  5C4F A;  2OEG A;  1GX4 A;  2AM3 A;  5AJN A;  4Y6U A;  4FRO A;  1R81 A;  4CJB A;  2AM4 A;  4KC2 A;  1LVW A;  3I0L A;  1FZW A;  1WT3 A;  4ASJ A;  5DDT A;  4Y64 A;  1SS9 A;  2WAW A;  1G95 A;  1YRO B;  1LL2 A;  3POL A;  3I0H A;  1G1L A;  2MZB A;  2Y4L A;  4AC3 A;  3V8Z A;  1G2V A;  2X65 A;  4ZDQ A;  5AJO A;  2E3D A;  3U2W A;  3ZGF A;  5IDS A;  1H5S C;  4FRE A;  1OQM B;  1R7V A;  3U2T A;  5C3D A;  2YQS A;  1VZT A;  2V0H A;  1H7L A;  1GX0 A;  5FUH A;  1JYL A;  2VS4 A;  3IOI A;  5C8R A;  3U2U A;  5C38 A;  4KC1 A;  1VGU A;  4KNR A;  2AGD A;  2VS5 A;  3SXA A;  1FO9 A;  1MC3 A;  2JCO A;  2FYD B;  3JTJ A;  1LZJ A;  3CKV A;  4NAN A;  4HO8 A;  4IRP A;  4YS8 A;  3ZLK A;  1W77 A;  1ON6 A;  5IDT A;  1V82 A;  3OH2 A;  2Y4J A;  3IOJ A;  3USQ A;  4HO6 A;  2VSI A;  3F1C A;  3V0O A;  4FRL A;  4Y9X A;  1NKH B;  2RJ5 A;  3I0K A;  4FCE A;  1LL0 A;  1G23 A;  2FYC B;  4HO2 A;  2GGO A;  5C4E A;  2RIY A;  3V91 A;  1R7X A;  3CU0 A;  2YQJ A;  1VIC A;  1H7T A;  1VH3 A;  4AYJ A;  4P02 A;  4HO4 A;  3U2X A;  3T7M A;  1O7O A;  4KQL A;  5CQO A;  4FRD A;  4B5B A;  2APC A;  5FYE A;  3OH3 A;  1PZY B;  2BO8 A;  1LL3 A;  5AJP A;  5FTS A;  1H5T B;  1GWV A;  3V0L A;  1ZHJ A;  1OMX A;  2RIZ A;  4P00 A;  2OI6 A;  1H4C A;  2FYB A;  1ZJO A;  2D0J A;  3CKO A;  3SPT A;  2I5K A;  1HM9 A;  3QVB A; 
#chains in the Genus database with same CATH topology
 1G97 A;  1WSZ A;  3ZF8 A;  2W0V A;  4E1K A;  5DDV A;  3GUE A;  3I0J A;  1S4O A;  3D5N A;  2OEF A;  2XWN A;  4M2A A;  2RJ8 A;  4D0Z A;  1FGX A;  2PGV A;  2VS3 A;  5L6V A;  2YC5 A;  3KIA A;  1FXJ A;  1QGS A;  2D7R A;  2UX8 A;  4KT7 A;  3PKP A;  1ZCV A;  3SXE A;  2JCJ A;  4G87 A;  1VPA A;  3CKN A;  3OH4 A;  1XHB A;  1ZJ0 A;  1YP3 A;  2YES A;  1JVG A;  3SX3 A;  2VSH A;  4G3S A;  2ZU9 A;  3OKR A;  1VGW A;  1MP4 A;  4CJC A;  4J18 A;  1OMZ A;  2V0L A;  1H5S B;  3OH0 A;  1ZI3 A;  4O6N A;  1O23 B;  4EEM A;  2ZU8 A;  3V90 A;  1ZI4 A;  4FQW A;  2PGY A;  1H4E A;  1QG8 A;  1G93 A;  1ZDF A;  3OC9 A;  1VGT A;  5CMF X;  5EIY A;  1JVD A;  2Y4M A;  3SX8 A;  4FCU A;  1HJL A;  5C1G A;  2WE9 A;  1GWW A;  4D48 A;  2O1F A;  1H7G A;  1MP3 A;  1H7H A;  2C0N A;  2FFU A;  2FY7 A;  1INI A;  1H3M A;  4Y7T A;  1ZCY A;  1TW1 A;  3SXB A;  3K8D A;  4G3P A;  4EE3 A;  5HS2 A;  3PNN A;  3ST8 A;  4CJ8 A;  4K6R A;  4M28 A;  2AEC A;  4HG6 A;  5I1F A;  4B3U A;  1ZI5 A;  1S4N A;  1LZ0 A;  4NAL A;  3K8E A;  2ICY A;  2I7B A;  3ZLL A;  5CMH A;  3CKQ A;  3E25 A;  1FRW A;  4HOC A;  3U0X A;  5L6S A;  1WT1 A;  4CVH A;  2V0K A;  5C3A A;  1HV9 A;  4Y63 A;  5CMI A;  4Y7G A;  2Y4K A;  1ZCT A;  2FYA A;  2QH5 A;  2Z87 A;  2J0B A;  1WT2 A;  1MP5 A;  4EEG A;  4KPX A;  2JCK A;  4DEC A;  5C49 A;  1V84 A;  2RJ9 A;  3V0Q A;  1FWY A;  2VXM A;  3IOH A;  1W55 A;  1FG5 N;  1LZ7 A;  1NF5 B;  3V0M A;  5CQP A;  3SX5 A;  3N9W A;  3PKQ A;  1ZIZ A;  3D98 A;  2DPW A;  1G3L A;  4HO9 A;  1H7Q A;  2OI7 A;  2OI5 A;  1IIN A;  3RMW A;  1H5T A;  1O0R A;  1WT0 A;  1YP2 A;  2JCL A;  1ON8 A;  4HO3 A;  5FTV A;  3HL3 A;  3Q7U A;  5CQN X;  4B4G A;  3CKJ A;  1E5K A;  2RIT A;  4NAK A;  3U2V A;  4ASY A;  4FRA A;  4UEG A;  2WVK A;  1WVC A;  1H5R B;  4IRQ A;  1TZF A;  2O1G A;  4D11 A;  2Y6P A;  2ZU7 A;  5FU8 A;  4KPZ A;  5CMJ A;  3SXD A;  2XWL A;  4AAW A;  5C1H A;  4FRB A;  3F1Y A;  3FWW A;  2VD4 A;  4MYB A;  5C4D A;  4KXO A;  2BO6 A;  2YQH A;  4B2X A;  3DK5 A;  2P6W A;  1ZJP A;  4LW3 A;  2CU2 A;  2X5Z A;  4JIS A;  4FRQ A;  4MND A;  1ZDG A;  2AH9 A;  1G0R A;  1R7U A;  4HO0 A;  2WEE A;  1IIM A;  4EE5 A;  5D92 A;  4NAI A;  2X5S A;  4FRP A;  2XMH A;  1QWJ A;  5C1L A;  3T7N A;  4B4M A;  1H5S A;  1R7T A;  1HM0 A;  2V0J A;  4Y6N A;  1GQC A;  1JYK A;  4Y62 A;  3V0N A;  2YCM A;  3TQD A;  1GA8 A;  1G8O A;  1H7E A;  2W0W A;  5C48 A;  1FR8 A;  3BCV A;  1H4D A;  3I0D A;  4R7P A;  2VFZ A;  3R3I A;  4D11 C;  3SXC A;  3RMV A;  1W57 A;  3TZT A;  1R82 A;  1HM8 A;  4AYL A;  2AE7 A;  2E8B A;  1HJJ A;  3I0E A;  3V8Y A;  4C2S A;  4FRH A;  1FXO A;  3OH1 A;  1TVY A;  4M2B A;  2FFV A;  1ZJ2 A;  2PA4 A;  2RJ1 A;  5C4C A;  1EYR A;  1JV3 A;  1GQ9 A;  2RJ4 A;  2BO4 A;  1NQI B;  2A8U A;  2RJ7 A;  4KC4 A;  2VXL A;  4L41 C;  5C47 A;  3I0F A;  5J49 A;  2NXV A;  3Q4S A;  1QGQ A;  3V0P A;  1TW5 A;  5IFY A;  3JUJ A;  4BQH A;  4Y7V A;  1K4V A;  4ECM A;  2WVM A;  4Y7U A;  1FR9 A;  3OAM A;  2WVL A;  1VGZ A;  1NMM B;  2Z86 A;  4LW6 A;  2YC3 A;  4EEA A;  5BXC A;  2V0I A;  2AES A;  1INJ A;  2Q4J A;  4G3Q A;  4KRV A;  1G9R A;  1I52 A;  1VH1 A;  2YQC A;  3DJ4 A;  3DUV A;  5CQM X;  1KWS A;  1VZX A;  1ZI1 A;  4EE4 A;  3R2W A;  3I0I X;  3BRK X;  5C4B A;  2A8W A;  3EE5 A;  4XWI A;  2QGI A;  4Y7F A;  3E26 A;  1R80 A;  3OGZ A;  5EJ1 A;  2VK9 A;  4EVW A;  4B42 A;  3U0Y A;  3LW6 A;  3SX7 A;  3USR A;  4ARW A;  1O7Q A;  2Y7A A;  3I0G A;  1PZT A;  3FOQ A;  1FO8 A;  1V83 A;  2WGZ A;  4HCQ A;  3CGX A;  3O3P A;  3D8V A;  1H7F A;  4DDZ A;  4M4K A;  3RSB A;  2X60 A;  4GBP A;  1FGG A;  1H5R A;  3Q80 A;  1NWG B;  1LZI A;  1ZCU A;  4JD0 A;  4FRM A;  4O6M A;  5D91 A;  2BO7 A;  1H5S D;  4KNX A;  1Z90 A;  2RIX A;  2QKX A;  2RJ0 A;  5EJZ A;  3ZGG A;  2XME A;  3NGW A;  4EEO A;  5CMG X;  2O1H A;  1S4P A;  1YP4 A;  3I0C A;  5CQL X;  4D0T A;  1FOA A;  1VM8 A;  2GGQ A;  2ICX A;  2PX7 A;  4B4B A;  5C36 A;  4B2W A;  2P72 A;  1ZJ3 A;  1NHE B;  1R7Y A;  1JV1 A;  2AM5 A;  4DE7 A;  3T7O A;  3SXG A;  5JQQ A;  4HO5 A;  5FU0 A;  2RJ6 A;  4FIX A;  1XZ6 A;  1ZJ1 A;  2P73 A;  3JUK A;  1VZU A;  5C3B A;  5FV9 A;  4Q7C A;  2D7I A;  2XWM A;  2I5E A;  4BMA A;  1EZI A;  5C4F A;  2OEG A;  1GX4 A;  2AM3 A;  5AJN A;  4Y6U A;  4FRO A;  1R81 A;  4CJB A;  2AM4 A;  4KC2 A;  1LVW A;  3I0L A;  1FZW A;  1WT3 A;  4ASJ A;  5DDT A;  4Y64 A;  1SS9 A;  2WAW A;  1G95 A;  1YRO B;  1LL2 A;  3POL A;  3I0H A;  1G1L A;  2MZB A;  2Y4L A;  4AC3 A;  3V8Z A;  1G2V A;  2X65 A;  4ZDQ A;  5AJO A;  2E3D A;  3U2W A;  3ZGF A;  5IDS A;  1H5S C;  4FRE A;  1OQM B;  1R7V A;  3U2T A;  5C3D A;  2YQS A;  1VZT A;  2V0H A;  1H7L A;  1GX0 A;  5FUH A;  1JYL A;  2VS4 A;  3IOI A;  5C8R A;  3U2U A;  2J0A A;  5C38 A;  4FIY A;  4KC1 A;  1VGU A;  4KNR A;  2AGD A;  2VS5 A;  3SXA A;  1FO9 A;  1MC3 A;  2JCO A;  2FYD B;  3JTJ A;  1LZJ A;  3CKV A;  4NAN A;  4HO8 A;  4IRP A;  4YS8 A;  3ZLK A;  1W77 A;  1ON6 A;  5IDT A;  1V82 A;  3OH2 A;  2Y4J A;  3IOJ A;  3USQ A;  4HO6 A;  2VSI A;  3F1C A;  3V0O A;  4FRL A;  4Y9X A;  1NKH B;  2RJ5 A;  3I0K A;  4MIX A;  4FCE A;  1LL0 A;  1G23 A;  2FYC B;  4HO2 A;  2GGO A;  5C4E A;  2RIY A;  3V91 A;  1R7X A;  3CU0 A;  2YQJ A;  1VIC A;  1H7T A;  1VH3 A;  4AYJ A;  4P02 A;  4HO4 A;  3U2X A;  3T7M A;  1O7O A;  4KQL A;  5CQO A;  4FRD A;  4B5B A;  2APC A;  5FYE A;  3OH3 A;  1PZY B;  2BO8 A;  1LL3 A;  5AJP A;  5FTS A;  1H5T B;  1GWV A;  3V0L A;  1ZHJ A;  1OMX A;  2RIZ A;  4P00 A;  2OI6 A;  1H4C A;  2FYB A;  1ZJO A;  2D0J A;  3CKO A;  3SPT A;  2I5K A;  1HM9 A;  3QVB A; 
#chains in the Genus database with same CATH homology
 1G97 A;  1WSZ A;  3ZF8 A;  2W0V A;  4E1K A;  5DDV A;  3GUE A;  3I0J A;  1S4O A;  3D5N A;  2OEF A;  2XWN A;  4M2A A;  2RJ8 A;  4D0Z A;  1FGX A;  2PGV A;  2VS3 A;  5L6V A;  2YC5 A;  3KIA A;  1FXJ A;  1QGS A;  2D7R A;  2UX8 A;  4KT7 A;  3PKP A;  1ZCV A;  3SXE A;  2JCJ A;  4G87 A;  1VPA A;  3CKN A;  3OH4 A;  1XHB A;  1ZJ0 A;  1YP3 A;  2YES A;  1JVG A;  3SX3 A;  2VSH A;  4G3S A;  2ZU9 A;  3OKR A;  1VGW A;  1MP4 A;  4CJC A;  4J18 A;  1OMZ A;  2V0L A;  1H5S B;  3OH0 A;  1ZI3 A;  4O6N A;  1O23 B;  4EEM A;  2ZU8 A;  3V90 A;  1ZI4 A;  4FQW A;  2PGY A;  1H4E A;  1QG8 A;  1G93 A;  1ZDF A;  3OC9 A;  1VGT A;  5CMF X;  5EIY A;  1JVD A;  2Y4M A;  3SX8 A;  4FCU A;  1HJL A;  5C1G A;  2WE9 A;  1GWW A;  4D48 A;  2O1F A;  1H7G A;  1MP3 A;  1H7H A;  2C0N A;  2FFU A;  2FY7 A;  1INI A;  1H3M A;  4Y7T A;  1ZCY A;  1TW1 A;  3SXB A;  3K8D A;  4G3P A;  4EE3 A;  5HS2 A;  3PNN A;  3ST8 A;  4CJ8 A;  4K6R A;  4M28 A;  2AEC A;  4HG6 A;  5I1F A;  4B3U A;  1ZI5 A;  1S4N A;  1LZ0 A;  4NAL A;  3K8E A;  2ICY A;  2I7B A;  3ZLL A;  5CMH A;  3CKQ A;  3E25 A;  1FRW A;  4HOC A;  3U0X A;  5L6S A;  1WT1 A;  4CVH A;  2V0K A;  5C3A A;  1HV9 A;  4Y63 A;  5CMI A;  4Y7G A;  2Y4K A;  1ZCT A;  2FYA A;  2QH5 A;  2Z87 A;  2J0B A;  1WT2 A;  1MP5 A;  4EEG A;  4KPX A;  2JCK A;  4DEC A;  5C49 A;  1V84 A;  2RJ9 A;  3V0Q A;  1FWY A;  2VXM A;  3IOH A;  1W55 A;  1FG5 N;  1LZ7 A;  1NF5 B;  3V0M A;  5CQP A;  3SX5 A;  3N9W A;  3PKQ A;  1ZIZ A;  3D98 A;  2DPW A;  1G3L A;  4HO9 A;  1H7Q A;  2OI7 A;  2OI5 A;  1IIN A;  3RMW A;  1H5T A;  1O0R A;  1WT0 A;  1YP2 A;  2JCL A;  1ON8 A;  4HO3 A;  5FTV A;  3HL3 A;  3Q7U A;  5CQN X;  4B4G A;  3CKJ A;  1E5K A;  2RIT A;  4NAK A;  3U2V A;  4ASY A;  4FRA A;  4UEG A;  2WVK A;  1WVC A;  1H5R B;  4IRQ A;  1TZF A;  2O1G A;  4D11 A;  2Y6P A;  2ZU7 A;  5FU8 A;  4KPZ A;  5CMJ A;  3SXD A;  2XWL A;  4AAW A;  5C1H A;  4FRB A;  3F1Y A;  3FWW A;  2VD4 A;  4MYB A;  5C4D A;  4KXO A;  2BO6 A;  2YQH A;  4B2X A;  3DK5 A;  2P6W A;  1ZJP A;  4LW3 A;  2CU2 A;  2X5Z A;  4JIS A;  4FRQ A;  4MND A;  1ZDG A;  2AH9 A;  1G0R A;  1R7U A;  4HO0 A;  2WEE A;  1IIM A;  4EE5 A;  5D92 A;  4NAI A;  2X5S A;  4FRP A;  2XMH A;  1QWJ A;  5C1L A;  3T7N A;  4B4M A;  1H5S A;  1R7T A;  1HM0 A;  2V0J A;  4Y6N A;  1GQC A;  1JYK A;  4Y62 A;  3V0N A;  2YCM A;  3TQD A;  1GA8 A;  1G8O A;  1H7E A;  2W0W A;  5C48 A;  1FR8 A;  3BCV A;  1H4D A;  3I0D A;  4R7P A;  2VFZ A;  3R3I A;  4D11 C;  3SXC A;  3RMV A;  1W57 A;  3TZT A;  1R82 A;  1HM8 A;  4AYL A;  2AE7 A;  2E8B A;  1HJJ A;  3I0E A;  3V8Y A;  4C2S A;  4FRH A;  1FXO A;  3OH1 A;  1TVY A;  4M2B A;  2FFV A;  1ZJ2 A;  2PA4 A;  2RJ1 A;  5C4C A;  1EYR A;  1JV3 A;  1GQ9 A;  2RJ4 A;  2BO4 A;  1NQI B;  2A8U A;  2RJ7 A;  4KC4 A;  2VXL A;  4L41 C;  5C47 A;  3I0F A;  5J49 A;  2NXV A;  3Q4S A;  1QGQ A;  3V0P A;  1TW5 A;  5IFY A;  3JUJ A;  4BQH A;  4Y7V A;  1K4V A;  4ECM A;  2WVM A;  4Y7U A;  1FR9 A;  3OAM A;  2WVL A;  1VGZ A;  1NMM B;  2Z86 A;  4LW6 A;  2YC3 A;  4EEA A;  5BXC A;  2V0I A;  2AES A;  1INJ A;  2Q4J A;  4G3Q A;  4KRV A;  1G9R A;  1I52 A;  1VH1 A;  2YQC A;  3DJ4 A;  3DUV A;  5CQM X;  1KWS A;  1VZX A;  1ZI1 A;  4EE4 A;  3R2W A;  3I0I X;  3BRK X;  5C4B A;  2A8W A;  3EE5 A;  4XWI A;  2QGI A;  4Y7F A;  3E26 A;  1R80 A;  3OGZ A;  5EJ1 A;  2VK9 A;  4EVW A;  4B42 A;  3U0Y A;  3LW6 A;  3SX7 A;  3USR A;  4ARW A;  1O7Q A;  2Y7A A;  3I0G A;  1PZT A;  3FOQ A;  1FO8 A;  1V83 A;  2WGZ A;  4HCQ A;  3CGX A;  3O3P A;  3D8V A;  1H7F A;  4DDZ A;  4M4K A;  3RSB A;  2X60 A;  4GBP A;  1FGG A;  1H5R A;  3Q80 A;  1NWG B;  1LZI A;  1ZCU A;  4JD0 A;  4FRM A;  4O6M A;  5D91 A;  2BO7 A;  1H5S D;  4KNX A;  1Z90 A;  2RIX A;  2QKX A;  2RJ0 A;  5EJZ A;  3ZGG A;  2XME A;  3NGW A;  4EEO A;  5CMG X;  2O1H A;  1S4P A;  1YP4 A;  3I0C A;  5CQL X;  4D0T A;  1FOA A;  1VM8 A;  2GGQ A;  2ICX A;  2PX7 A;  4B4B A;  5C36 A;  4B2W A;  2P72 A;  1ZJ3 A;  1NHE B;  1R7Y A;  1JV1 A;  2AM5 A;  4DE7 A;  3T7O A;  3SXG A;  5JQQ A;  4HO5 A;  5FU0 A;  2RJ6 A;  4FIX A;  1XZ6 A;  1ZJ1 A;  2P73 A;  3JUK A;  1VZU A;  5C3B A;  5FV9 A;  4Q7C A;  2D7I A;  2XWM A;  2I5E A;  4BMA A;  1EZI A;  5C4F A;  2OEG A;  1GX4 A;  2AM3 A;  5AJN A;  4Y6U A;  4FRO A;  1R81 A;  4CJB A;  2AM4 A;  4KC2 A;  1LVW A;  3I0L A;  1FZW A;  1WT3 A;  4ASJ A;  5DDT A;  4Y64 A;  1SS9 A;  2WAW A;  1G95 A;  1YRO B;  1LL2 A;  3POL A;  3I0H A;  1G1L A;  2MZB A;  2Y4L A;  4AC3 A;  3V8Z A;  1G2V A;  2X65 A;  4ZDQ A;  5AJO A;  2E3D A;  3U2W A;  3ZGF A;  5IDS A;  1H5S C;  4FRE A;  1OQM B;  1R7V A;  3U2T A;  5C3D A;  2YQS A;  1VZT A;  2V0H A;  1H7L A;  1GX0 A;  5FUH A;  1JYL A;  2VS4 A;  3IOI A;  5C8R A;  3U2U A;  2J0A A;  5C38 A;  4FIY A;  4KC1 A;  1VGU A;  4KNR A;  2AGD A;  2VS5 A;  3SXA A;  1FO9 A;  1MC3 A;  2JCO A;  2FYD B;  3JTJ A;  1LZJ A;  3CKV A;  4NAN A;  4HO8 A;  4IRP A;  4YS8 A;  3ZLK A;  1W77 A;  1ON6 A;  5IDT A;  1V82 A;  3OH2 A;  2Y4J A;  3IOJ A;  3USQ A;  4HO6 A;  2VSI A;  3F1C A;  3V0O A;  4FRL A;  4Y9X A;  1NKH B;  2RJ5 A;  3I0K A;  4MIX A;  4FCE A;  1LL0 A;  1G23 A;  2FYC B;  4HO2 A;  2GGO A;  5C4E A;  2RIY A;  3V91 A;  1R7X A;  3CU0 A;  2YQJ A;  1VIC A;  1H7T A;  1VH3 A;  4AYJ A;  4P02 A;  4HO4 A;  3U2X A;  3T7M A;  1O7O A;  4KQL A;  5CQO A;  4FRD A;  4B5B A;  2APC A;  5FYE A;  3OH3 A;  1PZY B;  2BO8 A;  1LL3 A;  5AJP A;  5FTS A;  1H5T B;  1GWV A;  3V0L A;  1ZHJ A;  1OMX A;  2RIZ A;  4P00 A;  2OI6 A;  1H4C A;  2FYB A;  1ZJO A;  2D0J A;  3CKO A;  3SPT A;  2I5K A;  1HM9 A;  3QVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...