5DDVA

Crystal structure of ispd from bacillus subtilis at 2.30 angstroms resolution, crystal form ii
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
MSYDVVIPAAGQRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQCDKIILVINEQEREHFQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHDGARPFIKHEQIDELIAEAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQAFRLSLLMKAHAEAERKGFLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAIMES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title A structural and functional study on the 2-C-methyl-d-erythritol-4-phosphate cytidyltransferase (IspD) from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 74
structure length 223
sequence length 225
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5ddvA00
2RIYA 4ARWA 1VGUA 5FV9A 5CMGX 1ZDFA 2OI5A 1ZCUA 4CJCA 5C8RA 3V0NA 4E1KA 1NKHB 1V84A 3T7NA 4MNDA 4FRHA 2VD4A 2AH9A 2ICXA 5FUHA 3OH4A 4M2BA 1FZWA 1NWGB 4EVWA 1H7TA 2Y4MA 4KPXA 3U2XA 3CGXA 3V91A 4FCEA 2E8BA 1NMMB 1H4CA 5EIYA 4FQWA 4CJBA 3K8EA 3SX8A 1TZFA 2Y6PA 3RMWA 2FFUA 3U0XA 2O1GA 1FR8A 1WT3A 5IDSA 2DPWA 4JISA 4KQLA 1YROB 4Y7GA 5FU8A 2BO7A 2QKXA 1FO9A 1LL2A 5DDTA 4FREA 4FRQA 5CMJA 3ST8A 3DK5A 1G9RA 2A8UA 2PX7A 2WVLA 1FRWA 1LZ7A 1PZTA 1EYRA 2V0LA 2W0VA 5CMFX 2QH5A 4ASYA 1G97A 1H5RB 4B2WA 2AECA 2FY7A 4KRVA 3I0LA 1ZI1A 2X60A 4EE5A 4FRDA 1GX4A 1WT0A 1HM8A 4AYLA 1FGGA 2BO4A 1OQMB 1LL3A 4D11A 1JVDA 4EEOA 3OH0A 2MZBA 2D0JA 5C1GA 2Z87A 5JQQA 3SX7A 4Y7TA 1R81A 1FXJA 4IRQA 1VGZA 4HO8A 4B4GA 2WVKA 1JV3A 4Y7UA 5C3BA 2RJ4A 4Y64A 3V0LA 2RJ1A 1H7QA 5C1HA 2ZU8A 3U2WA 2I5KA 2RJ8A 1G2VA 1GQ9A 1HM0A 1VM8A 2D7RA 3CKNA 1LVWA 3DJ4A 4KNXA 1H3MA 3I0KA 4HOCA 1QGQA 4EEGA 1HM9A 3IOIA 1R7YA 5I1FA 5L6VA 3ZF8A 1R7VA 5BXCA 3I0CA 1FR9A 3F1YA 3Q7UA 3TQDA 2QGIA 4FRAA 2A8WA 1O7OA 2ICYA 5C47A 4LW3A 1ZJ2A 2VS5A 3IOHA 1LZ0A 1GQCA 5C4FA 2AESA 4KPZA 1HJJA 4HO2A 3OH2A 1VH3A 2VFZA 1ZJOA 5C3DA 1G95A 2VSHA 3I0GA 4D0TA 4J18A 2I7BA 1NF5B 4G3SA 3CKOA 4P00A 1EZIA 1H5TB 1VZUA 1I52A 2Y4LA 3CU0A 1ZJ0A 5CQMX 1INJA 3ZLLA 4AYJA 3V8ZA 4K6RA 1QGSA 4LW6A 3D8VA 4Y6UA 1H7FA 1WT2A 2X5ZA 3SX3A 1V83A 3I0IX 2I5EA 1KWSA 3LW6A 3V0OA 2XMEA 2WAWA 2O1HA 4M4KA 3TZTA 2RJ6A 1ZJPA 3OGZA 2FYDB 2AE7A 4AAWA 4B2XA 4HO9A 1R82A 1H7LA 1H5SC 1G23A 3U2TA 3U2UA 1JVGA 4D0ZA 1S4OA 4C2SA 1VICA 2ZU7A 3POLA 3SXEA 1H4EA 3JUKA 1H5SB 3Q80A 4FROA 2YQJA 4G3QA 3HL3A 3OC9A 4HO5A 1H7HA 2ZU9A 5C4EA 2AM4A 3SXGA 1VGTA 1E5KA 3OKRA 3D5NA 1ZCTA 1FO8A 1H7GA 4B42A 5IDTA 4D48A 3RMVA 1QWJA 1TVYA 2XWLA 2YC5A 2VXMA 1VGWA 2V0HA 3CKJA 2O1FA 1VZTA 5C48A 3E26A 3I0JA 3USQA 1LZJA 2YQHA 1H5RA 4HCQA 3SXDA 3OAMA 3V90A 1ZHJA 5HS2A 4MYBA 2RJ5A 2RITA 5C36A 5AJPA 2Z86A 1S4PA 1O7QA 3CKQA 3T7OA 4B4MA 1MC3A 1IIMA 4FRMA 3ZGGA 2OI7A 2PGVA 2YQCA 1SS9A 4NAIA 2YESA 5C1LA 1JYLA 2GGQA 1Z90A 2YCMA 4KC1A 1VPAA 2AM3A 1G3LA 5IFYA 3JUJA 3FWWA 2OEFA 4ZDQA 1ZI5A 5EJ1A 3PKQA 3V0MA 3R2WA 1S4NA 3IOJA 5C3AA 3RSBA 3SXBA 2JCJA 1G93A 1H4DA 2PGYA 3DUVA 5DDVA 2V0IA 4B3UA 5L6SA 5FU0A 1W55A 1WSZA 2JCLA 1K4VA 2AGDA 4P02A 1WVCA 4HO6A 2JCOA 5AJOA 3I0HA 3I0DA 1XHBA 4Y63A 1ZJ1A 1GWVA 2YC3A 4GBPA 3BRKX 4KXOA 3I0EA 1GWWA 1W77A 3NGWA 1JYKA 3KIAA 4FRPA 4EEMA 5CQNX 2GGOA 5CMHA 1ON8A 4KNRA 4B5BA 3GUEA 4HO4A 5CQOA 2RIZA 4JD0A 5FYEA 4EEAA 3CKVA 1NQIB 2BO8A 4G3PA 2W0WA 5C38A 2WEEA 3OH1A 5CQPA 3O3PA 3Q4SA 1FWYA 2OEGA 1GA8A 2Y4KA 4UEGA 3SXAA 1R7TA 4BQHA 4B4BA 1PZYB 3PKPA 1W57A 1FG5N 2RIXA 2VS3A 4KC4A 2X5SA 1YP3A 1H5TA 5EJZA 1FXOA 2VXLA 1YP4A 1R7XA 3OH3A 2XWMA 4FRLA 5AJNA 4NAKA 3V8YA 4EE4A 3D98A 4M2AA 1VZXA 1TW5A 2V0KA 5FTSA 4KT7A 3U2VA 2RJ7A 2OI6A 1O23B 2WE9A 1ZCVA 2E3DA 4Y9XA 5CMIA 1G8OA 1HJLA 3E25A 4Y62A 3ZGFA 3I0FA 1JV1A 4D11C 1IINA 2VS4A 1NHEB 2X65A 1TW1A 2Q4JA 1OMXA 2V0JA 1ZI4A 3F1CA 1H5SA 1ZCYA 3BCVA 4L41C 4HO0A 1ZJ3A 1FOAA 3FOQA 4AC3A 3SXCA 1XZ6A 3EE5A 1ZDGA 2RJ9A 4Y7VA 5J49A 2UX8A 2VSIA 2P73A 4DE7A 2YQSA 4ECMA 1V82A 4ASJA 1G0RA 1H7EA 1LZIA 4CJ8A 1QG8A 3R3IA 3PNNA 2Y7AA 1MP4A 4FRBA 1R7UA 4EE3A 1G1LA 4KC2A 2NXVA 4DDZA 5CQLX 2JCKA 3N9WA 4G87A 2RJ0A 5FTVA 4YS8A 1WT1A 2P72A 2P6WA 4XWIA 4M28A 2FYBA 3ZLKA 2AM5A 1VH1A 4Y6NA 1O0RA 2Y4JA 2D7IA 1FGXA 2BO6A 2FYAA 1LL0A 1MP3A 4FCUA 3T7MA 5C4DA 1ZI3A 3V0PA 1MP5A 2PA4A 3SX5A 4CVHA 2FYCB 5C4CA 4HO3A 2WGZA 4DECA 4NANA 1OMZA 2WVMA 4R7PA 1ZIZA 1INIA 5C4BA 2CU2A 1ON6A 3V0QA 2XMHA 1HV9A 1YP2A 4HG6A 3JTJA 3SPTA 3USRA 3QVBA 1GX0A 2FFVA 2XWNA 3U0YA 1R80A 1H5SD 4NALA 4BMAA 2APCA 3K8DA 4IRPA 4Y7FA 5C49A
chains in the Genus database with same CATH superfamily
2RIYA 4ARWA 1VGUA 5FV9A 5CMGX 1ZDFA 2OI5A 1ZCUA 4CJCA 5C8RA 3V0NA 4E1KA 1NKHB 1V84A 3T7NA 4FIXA 4MNDA 4FRHA 2VD4A 2AH9A 2ICXA 5FUHA 3OH4A 4M2BA 2J0BA 1FZWA 1NWGB 4EVWA 1H7TA 2Y4MA 4KPXA 3U2XA 3CGXA 3V91A 4FCEA 2E8BA 1NMMB 1H4CA 5EIYA 4FQWA 5D91A 4CJBA 3K8EA 3SX8A 1TZFA 2Y6PA 3RMWA 2FFUA 3U0XA 2O1GA 1FR8A 1WT3A 5IDSA 2DPWA 4JISA 4KQLA 1YROB 4Y7GA 5FU8A 2BO7A 2QKXA 1FO9A 1LL2A 4Q7CA 5DDTA 4FREA 4FRQA 5CMJA 3ST8A 3DK5A 1G9RA 2A8UA 2PX7A 2WVLA 1FRWA 1LZ7A 1PZTA 1EYRA 2V0LA 2W0VA 5CMFX 2QH5A 4ASYA 1G97A 1H5RB 4B2WA 2AECA 2FY7A 4KRVA 3I0LA 1ZI1A 2X60A 4EE5A 4FRDA 1GX4A 1WT0A 1HM8A 4AYLA 1FGGA 2BO4A 1OQMB 1LL3A 4D11A 1JVDA 4EEOA 3OH0A 2MZBA 2D0JA 5C1GA 2Z87A 5JQQA 3SX7A 4Y7TA 1R81A 1FXJA 4IRQA 1VGZA 4HO8A 4B4GA 4MIXA 2WVKA 1JV3A 4Y7UA 5C3BA 2RJ4A 4Y64A 3V0LA 2RJ1A 1H7QA 5C1HA 2ZU8A 3U2WA 2I5KA 2RJ8A 1G2VA 1GQ9A 1HM0A 1VM8A 2D7RA 3CKNA 1LVWA 3DJ4A 4KNXA 1H3MA 3I0KA 4HOCA 1QGQA 4EEGA 1HM9A 3IOIA 1R7YA 5I1FA 5L6VA 3ZF8A 1R7VA 5BXCA 3I0CA 1FR9A 3F1YA 3Q7UA 3TQDA 2QGIA 4FRAA 2A8WA 1O7OA 2ICYA 5C47A 4LW3A 1ZJ2A 2VS5A 3IOHA 1LZ0A 1GQCA 5C4FA 2AESA 4KPZA 1HJJA 4HO2A 3OH2A 1VH3A 2VFZA 1ZJOA 5C3DA 1G95A 2VSHA 3I0GA 4D0TA 5D92A 4J18A 2I7BA 1NF5B 4G3SA 3CKOA 4P00A 1EZIA 1H5TB 1VZUA 1I52A 2Y4LA 3CU0A 1ZJ0A 5CQMX 1INJA 3ZLLA 4AYJA 3V8ZA 4K6RA 1QGSA 4LW6A 3D8VA 4Y6UA 1H7FA 1WT2A 2X5ZA 3SX3A 1V83A 3I0IX 2I5EA 1KWSA 3LW6A 3V0OA 2XMEA 2WAWA 2O1HA 4M4KA 3TZTA 2RJ6A 1ZJPA 3OGZA 2FYDB 2AE7A 4AAWA 4B2XA 4HO9A 1R82A 1H7LA 1H5SC 1G23A 3U2TA 3U2UA 1JVGA 4D0ZA 1S4OA 4C2SA 1VICA 2ZU7A 3POLA 3SXEA 1H4EA 3JUKA 1H5SB 3Q80A 4FROA 2YQJA 4G3QA 3HL3A 3OC9A 4HO5A 1H7HA 2ZU9A 5C4EA 2AM4A 3SXGA 1VGTA 1E5KA 3OKRA 3D5NA 1ZCTA 1FO8A 1H7GA 4B42A 5IDTA 4D48A 3RMVA 1QWJA 1TVYA 2XWLA 2YC5A 2VXMA 1VGWA 2V0HA 4FIYA 3CKJA 2O1FA 1VZTA 5C48A 3E26A 3I0JA 3USQA 1LZJA 2YQHA 1H5RA 4HCQA 3SXDA 3OAMA 3V90A 1ZHJA 5HS2A 4MYBA 2RJ5A 2RITA 5C36A 5AJPA 2Z86A 1S4PA 1O7QA 3CKQA 3T7OA 4B4MA 1MC3A 1IIMA 4FRMA 3ZGGA 2OI7A 2PGVA 2YQCA 1SS9A 4NAIA 2YESA 5C1LA 1JYLA 2GGQA 1Z90A 2YCMA 4KC1A 1VPAA 2AM3A 1G3LA 5IFYA 3JUJA 3FWWA 2OEFA 4ZDQA 1ZI5A 5EJ1A 3PKQA 3V0MA 3R2WA 1S4NA 3IOJA 5C3AA 3RSBA 3SXBA 2JCJA 1G93A 1H4DA 2PGYA 3DUVA 5DDVA 2V0IA 4B3UA 5L6SA 5FU0A 1W55A 1WSZA 2JCLA 1K4VA 2AGDA 4P02A 1WVCA 4HO6A 2JCOA 5AJOA 4O6NA 3I0HA 3I0DA 1XHBA 4Y63A 1ZJ1A 1GWVA 2YC3A 4GBPA 3BRKX 4KXOA 3I0EA 1GWWA 1W77A 3NGWA 1JYKA 2J0AA 3KIAA 4FRPA 4EEMA 5CQNX 2GGOA 5CMHA 1ON8A 4KNRA 4B5BA 3GUEA 4HO4A 5CQOA 2RIZA 4JD0A 5FYEA 4EEAA 3CKVA 1NQIB 2BO8A 4G3PA 2W0WA 5C38A 2WEEA 3OH1A 5CQPA 3O3PA 3Q4SA 1FWYA 2OEGA 1GA8A 2Y4KA 4UEGA 3SXAA 1R7TA 4BQHA 4B4BA 1PZYB 3PKPA 1W57A 1FG5N 2RIXA 2VS3A 4KC4A 2X5SA 1YP3A 1H5TA 2VK9A 5EJZA 1FXOA 2VXLA 1YP4A 1R7XA 3OH3A 2XWMA 4FRLA 5AJNA 4NAKA 3V8YA 4EE4A 3D98A 4M2AA 1VZXA 1TW5A 2V0KA 5FTSA 4KT7A 3U2VA 2RJ7A 2OI6A 1O23B 2WE9A 1ZCVA 2E3DA 4Y9XA 5CMIA 1G8OA 1HJLA 3E25A 4O6MA 4Y62A 3ZGFA 3I0FA 1JV1A 4D11C 1IINA 2VS4A 1NHEB 2X65A 1TW1A 2Q4JA 1OMXA 2V0JA 1ZI4A 3F1CA 1H5SA 1ZCYA 3BCVA 4L41C 4HO0A 1ZJ3A 1FOAA 3FOQA 4AC3A 3SXCA 1XZ6A 3EE5A 1ZDGA 2RJ9A 4Y7VA 5J49A 2UX8A 2VSIA 2P73A 4DE7A 2YQSA 4ECMA 1V82A 4ASJA 1G0RA 1H7EA 1LZIA 4CJ8A 1QG8A 3R3IA 3PNNA 2Y7AA 1MP4A 4FRBA 1R7UA 4EE3A 1G1LA 4KC2A 2NXVA 4DDZA 2C0NA 5CQLX 2JCKA 3N9WA 4G87A 2RJ0A 5FTVA 4YS8A 1WT1A 2P72A 2P6WA 4XWIA 4M28A 2FYBA 3ZLKA 2AM5A 1VH1A 4Y6NA 1O0RA 2Y4JA 2D7IA 1FGXA 2BO6A 2FYAA 1LL0A 1MP3A 4FCUA 3T7MA 5C4DA 1ZI3A 3V0PA 1MP5A 2PA4A 3SX5A 4CVHA 2FYCB 5C4CA 4HO3A 2WGZA 4DECA 4NANA 1OMZA 2WVMA 4R7PA 1ZIZA 1INIA 5C4BA 2CU2A 1ON6A 3V0QA 2XMHA 1HV9A 1YP2A 4HG6A 3JTJA 3SPTA 3USRA 3QVBA 1GX0A 2XWNA 2FFVA 3U0YA 1R80A 1H5SD 4NALA 4BMAA 2APCA 3K8DA 4IRPA 4Y7FA 5C49A
chains in the Genus database with same CATH topology
2RIYA 4ARWA 1VGUA 5FV9A 5CMGX 1ZDFA 2OI5A 1ZCUA 4CJCA 5C8RA 3V0NA 4E1KA 1NKHB 1V84A 3T7NA 4FIXA 4MNDA 4FRHA 2VD4A 2AH9A 2ICXA 5FUHA 3OH4A 4M2BA 2J0BA 1FZWA 1NWGB 4EVWA 1H7TA 2Y4MA 4KPXA 3U2XA 3CGXA 3V91A 4FCEA 2E8BA 1NMMB 1H4CA 5EIYA 4FQWA 5D91A 4CJBA 3K8EA 3SX8A 1TZFA 2Y6PA 3RMWA 2FFUA 3U0XA 2O1GA 1FR8A 1WT3A 5IDSA 2DPWA 4JISA 4KQLA 1YROB 4Y7GA 5FU8A 2BO7A 2QKXA 1FO9A 1LL2A 4Q7CA 5DDTA 4FREA 4FRQA 5CMJA 3ST8A 3DK5A 1G9RA 2A8UA 2PX7A 2WVLA 1FRWA 1LZ7A 1PZTA 1EYRA 2V0LA 2W0VA 5CMFX 2QH5A 4ASYA 1G97A 1H5RB 4B2WA 2AECA 2FY7A 4KRVA 3I0LA 1ZI1A 2X60A 4EE5A 4FRDA 1GX4A 1WT0A 1HM8A 4AYLA 1FGGA 2BO4A 1OQMB 1LL3A 4D11A 1JVDA 4EEOA 3OH0A 2MZBA 2D0JA 5C1GA 2Z87A 5JQQA 3SX7A 4Y7TA 1R81A 1FXJA 4IRQA 1VGZA 4HO8A 4B4GA 4MIXA 2WVKA 1JV3A 4Y7UA 5C3BA 2RJ4A 4Y64A 3V0LA 2RJ1A 1H7QA 5C1HA 2ZU8A 3U2WA 2I5KA 2RJ8A 1G2VA 1GQ9A 1HM0A 1VM8A 2D7RA 3CKNA 1LVWA 3DJ4A 4KNXA 1H3MA 3I0KA 4HOCA 1QGQA 4EEGA 1HM9A 3IOIA 1R7YA 5I1FA 5L6VA 3ZF8A 1R7VA 5BXCA 3I0CA 1FR9A 3F1YA 3Q7UA 3TQDA 2QGIA 4FRAA 2A8WA 1O7OA 2ICYA 5C47A 4LW3A 1ZJ2A 2VS5A 3IOHA 1LZ0A 1GQCA 5C4FA 2AESA 4KPZA 1HJJA 4HO2A 3OH2A 1VH3A 2VFZA 1ZJOA 5C3DA 1G95A 2VSHA 3I0GA 4D0TA 5D92A 4J18A 2I7BA 1NF5B 4G3SA 3CKOA 4P00A 1EZIA 1H5TB 1VZUA 1I52A 2Y4LA 3CU0A 1ZJ0A 5CQMX 1INJA 3ZLLA 4AYJA 3V8ZA 4K6RA 1QGSA 4LW6A 3D8VA 4Y6UA 1H7FA 1WT2A 2X5ZA 3SX3A 1V83A 3I0IX 2I5EA 1KWSA 3LW6A 3V0OA 2XMEA 2WAWA 2O1HA 4M4KA 3TZTA 2RJ6A 1ZJPA 3OGZA 2FYDB 2AE7A 4AAWA 4B2XA 4HO9A 1R82A 1H7LA 1H5SC 1G23A 3U2TA 3U2UA 1JVGA 4D0ZA 1S4OA 4C2SA 1VICA 2ZU7A 3POLA 3SXEA 1H4EA 3JUKA 1H5SB 3Q80A 4FROA 2YQJA 4G3QA 3HL3A 3OC9A 4HO5A 1H7HA 2ZU9A 5C4EA 2AM4A 3SXGA 1VGTA 1E5KA 3OKRA 3D5NA 1ZCTA 1FO8A 1H7GA 4B42A 5IDTA 4D48A 3RMVA 1QWJA 1TVYA 2XWLA 2YC5A 2VXMA 1VGWA 2V0HA 4FIYA 3CKJA 2O1FA 1VZTA 5C48A 3E26A 3I0JA 3USQA 1LZJA 2YQHA 1H5RA 4HCQA 3SXDA 3OAMA 3V90A 1ZHJA 5HS2A 4MYBA 2RJ5A 2RITA 5C36A 5AJPA 2Z86A 1S4PA 1O7QA 3CKQA 3T7OA 4B4MA 1MC3A 1IIMA 4FRMA 3ZGGA 2OI7A 2PGVA 2YQCA 1SS9A 4NAIA 2YESA 5C1LA 1JYLA 2GGQA 1Z90A 2YCMA 4KC1A 1VPAA 2AM3A 1G3LA 5IFYA 3JUJA 3FWWA 2OEFA 4ZDQA 1ZI5A 5EJ1A 3PKQA 3V0MA 3R2WA 1S4NA 3IOJA 5C3AA 3RSBA 3SXBA 2JCJA 1G93A 1H4DA 2PGYA 3DUVA 5DDVA 2V0IA 4B3UA 5L6SA 5FU0A 1W55A 1WSZA 2JCLA 1K4VA 2AGDA 4P02A 1WVCA 4HO6A 2JCOA 5AJOA 4O6NA 3I0HA 3I0DA 1XHBA 4Y63A 1ZJ1A 1GWVA 2YC3A 4GBPA 3BRKX 4KXOA 3I0EA 1GWWA 1W77A 3NGWA 1JYKA 2J0AA 3KIAA 4FRPA 4EEMA 5CQNX 2GGOA 5CMHA 1ON8A 4KNRA 4B5BA 3GUEA 4HO4A 5CQOA 2RIZA 4JD0A 5FYEA 4EEAA 3CKVA 1NQIB 2BO8A 4G3PA 2W0WA 5C38A 2WEEA 3OH1A 5CQPA 3O3PA 3Q4SA 1FWYA 2OEGA 1GA8A 2Y4KA 4UEGA 3SXAA 1R7TA 4BQHA 4B4BA 1PZYB 3PKPA 1W57A 1FG5N 2RIXA 2VS3A 4KC4A 2X5SA 1YP3A 1H5TA 2VK9A 5EJZA 1FXOA 2VXLA 1YP4A 1R7XA 3OH3A 2XWMA 4FRLA 5AJNA 4NAKA 3V8YA 4EE4A 3D98A 4M2AA 1VZXA 1TW5A 2V0KA 5FTSA 4KT7A 3U2VA 2RJ7A 2OI6A 1O23B 2WE9A 1ZCVA 2E3DA 4Y9XA 5CMIA 1G8OA 1HJLA 3E25A 4O6MA 4Y62A 3ZGFA 3I0FA 1JV1A 4D11C 1IINA 2VS4A 1NHEB 2X65A 1TW1A 2Q4JA 1OMXA 2V0JA 1ZI4A 3F1CA 1H5SA 1ZCYA 3BCVA 4L41C 4HO0A 1ZJ3A 1FOAA 3FOQA 4AC3A 3SXCA 1XZ6A 3EE5A 1ZDGA 2RJ9A 4Y7VA 5J49A 2UX8A 2VSIA 2P73A 4DE7A 2YQSA 4ECMA 1V82A 4ASJA 1G0RA 1H7EA 1LZIA 4CJ8A 1QG8A 3R3IA 3PNNA 2Y7AA 1MP4A 4FRBA 1R7UA 4EE3A 1G1LA 4KC2A 2NXVA 4DDZA 2C0NA 5CQLX 2JCKA 3N9WA 4G87A 2RJ0A 5FTVA 4YS8A 1WT1A 2P72A 2P6WA 4XWIA 4M28A 2FYBA 3ZLKA 2AM5A 1VH1A 4Y6NA 1O0RA 2Y4JA 2D7IA 1FGXA 2BO6A 2FYAA 1LL0A 1MP3A 4FCUA 3T7MA 5C4DA 1ZI3A 3V0PA 1MP5A 2PA4A 3SX5A 4CVHA 2FYCB 5C4CA 4HO3A 2WGZA 4DECA 4NANA 1OMZA 2WVMA 4R7PA 1ZIZA 1INIA 5C4BA 2CU2A 1ON6A 3V0QA 2XMHA 1HV9A 1YP2A 4HG6A 3JTJA 3SPTA 3USRA 3QVBA 1GX0A 2XWNA 2FFVA 3U0YA 1R80A 1H5SD 4NALA 4BMAA 2APCA 3K8DA 4IRPA 4Y7FA 5C49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIY A;  4ARW A;  1VGU A;  5FV9 A;  5CMG X;  1ZDF A;  2OI5 A;  1ZCU A;  4CJC A;  5C8R A;  3V0N A;  4E1K A;  1NKH B;  1V84 A;  3T7N A;  4MND A;  4FRH A;  2VD4 A;  2AH9 A;  2ICX A;  5FUH A;  3OH4 A;  4M2B A;  1FZW A;  1NWG B;  4EVW A;  1H7T A;  2Y4M A;  4KPX A;  3U2X A;  3CGX A;  3V91 A;  4FCE A;  2E8B A;  1NMM B;  1H4C A;  5EIY A;  4FQW A;  4CJB A;  3K8E A;  3SX8 A;  1TZF A;  2Y6P A;  3RMW A;  2FFU A;  3U0X A;  2O1G A;  1FR8 A;  1WT3 A;  5IDS A;  2DPW A;  4JIS A;  4KQL A;  1YRO B;  4Y7G A;  5FU8 A;  2BO7 A;  2QKX A;  1FO9 A;  1LL2 A;  5DDT A;  4FRE A;  4FRQ A;  5CMJ A;  3ST8 A;  3DK5 A;  1G9R A;  2A8U A;  2PX7 A;  2WVL A;  1FRW A;  1LZ7 A;  1PZT A;  1EYR A;  2V0L A;  2W0V A;  5CMF X;  2QH5 A;  4ASY A;  1G97 A;  1H5R B;  4B2W A;  2AEC A;  2FY7 A;  4KRV A;  3I0L A;  1ZI1 A;  2X60 A;  4EE5 A;  4FRD A;  1GX4 A;  1WT0 A;  1HM8 A;  4AYL A;  1FGG A;  2BO4 A;  1OQM B;  1LL3 A;  4D11 A;  1JVD A;  4EEO A;  3OH0 A;  2MZB A;  2D0J A;  5C1G A;  2Z87 A;  5JQQ A;  3SX7 A;  4Y7T A;  1R81 A;  1FXJ A;  4IRQ A;  1VGZ A;  4HO8 A;  4B4G A;  2WVK A;  1JV3 A;  4Y7U A;  5C3B A;  2RJ4 A;  4Y64 A;  3V0L A;  2RJ1 A;  1H7Q A;  5C1H A;  2ZU8 A;  3U2W A;  2I5K A;  2RJ8 A;  1G2V A;  1GQ9 A;  1HM0 A;  1VM8 A;  2D7R A;  3CKN A;  1LVW A;  3DJ4 A;  4KNX A;  1H3M A;  3I0K A;  4HOC A;  1QGQ A;  4EEG A;  1HM9 A;  3IOI A;  1R7Y A;  5I1F A;  5L6V A;  3ZF8 A;  1R7V A;  5BXC A;  3I0C A;  1FR9 A;  3F1Y A;  3Q7U A;  3TQD A;  2QGI A;  4FRA A;  2A8W A;  1O7O A;  2ICY A;  5C47 A;  4LW3 A;  1ZJ2 A;  2VS5 A;  3IOH A;  1LZ0 A;  1GQC A;  5C4F A;  2AES A;  4KPZ A;  1HJJ A;  4HO2 A;  3OH2 A;  1VH3 A;  2VFZ A;  1ZJO A;  5C3D A;  1G95 A;  2VSH A;  3I0G A;  4D0T A;  4J18 A;  2I7B A;  1NF5 B;  4G3S A;  3CKO A;  4P00 A;  1EZI A;  1H5T B;  1VZU A;  1I52 A;  2Y4L A;  3CU0 A;  1ZJ0 A;  5CQM X;  1INJ A;  3ZLL A;  4AYJ A;  3V8Z A;  4K6R A;  1QGS A;  4LW6 A;  3D8V A;  4Y6U A;  1H7F A;  1WT2 A;  2X5Z A;  3SX3 A;  1V83 A;  3I0I X;  2I5E A;  1KWS A;  3LW6 A;  3V0O A;  2XME A;  2WAW A;  2O1H A;  4M4K A;  3TZT A;  2RJ6 A;  1ZJP A;  3OGZ A;  2FYD B;  2AE7 A;  4AAW A;  4B2X A;  4HO9 A;  1R82 A;  1H7L A;  1H5S C;  1G23 A;  3U2T A;  3U2U A;  1JVG A;  4D0Z A;  1S4O A;  4C2S A;  1VIC A;  2ZU7 A;  3POL A;  3SXE A;  1H4E A;  3JUK A;  1H5S B;  3Q80 A;  4FRO A;  2YQJ A;  4G3Q A;  3HL3 A;  3OC9 A;  4HO5 A;  1H7H A;  2ZU9 A;  5C4E A;  2AM4 A;  3SXG A;  1VGT A;  1E5K A;  3OKR A;  3D5N A;  1ZCT A;  1FO8 A;  1H7G A;  4B42 A;  5IDT A;  4D48 A;  3RMV A;  1QWJ A;  1TVY A;  2XWL A;  2YC5 A;  2VXM A;  1VGW A;  2V0H A;  3CKJ A;  2O1F A;  1VZT A;  5C48 A;  3E26 A;  3I0J A;  3USQ A;  1LZJ A;  2YQH A;  1H5R A;  4HCQ A;  3SXD A;  3OAM A;  3V90 A;  1ZHJ A;  5HS2 A;  4MYB A;  2RJ5 A;  2RIT A;  5C36 A;  5AJP A;  2Z86 A;  1S4P A;  1O7Q A;  3CKQ A;  3T7O A;  4B4M A;  1MC3 A;  1IIM A;  4FRM A;  3ZGG A;  2OI7 A;  2PGV A;  2YQC A;  1SS9 A;  4NAI A;  2YES A;  5C1L A;  1JYL A;  2GGQ A;  1Z90 A;  2YCM A;  4KC1 A;  1VPA A;  2AM3 A;  1G3L A;  5IFY A;  3JUJ A;  3FWW A;  2OEF A;  4ZDQ A;  1ZI5 A;  5EJ1 A;  3PKQ A;  3V0M A;  3R2W A;  1S4N A;  3IOJ A;  5C3A A;  3RSB A;  3SXB A;  2JCJ A;  1G93 A;  1H4D A;  2PGY A;  3DUV A;  5DDV A;  2V0I A;  4B3U A;  5L6S A;  5FU0 A;  1W55 A;  1WSZ A;  2JCL A;  1K4V A;  2AGD A;  4P02 A;  1WVC A;  4HO6 A;  2JCO A;  5AJO A;  3I0H A;  3I0D A;  1XHB A;  4Y63 A;  1ZJ1 A;  1GWV A;  2YC3 A;  4GBP A;  3BRK X;  4KXO A;  3I0E A;  1GWW A;  1W77 A;  3NGW A;  1JYK A;  3KIA A;  4FRP A;  4EEM A;  5CQN X;  2GGO A;  5CMH A;  1ON8 A;  4KNR A;  4B5B A;  3GUE A;  4HO4 A;  5CQO A;  2RIZ A;  4JD0 A;  5FYE A;  4EEA A;  3CKV A;  1NQI B;  2BO8 A;  4G3P A;  2W0W A;  5C38 A;  2WEE A;  3OH1 A;  5CQP A;  3O3P A;  3Q4S A;  1FWY A;  2OEG A;  1GA8 A;  2Y4K A;  4UEG A;  3SXA A;  1R7T A;  4BQH A;  4B4B A;  1PZY B;  3PKP A;  1W57 A;  1FG5 N;  2RIX A;  2VS3 A;  4KC4 A;  2X5S A;  1YP3 A;  1H5T A;  5EJZ A;  1FXO A;  2VXL A;  1YP4 A;  1R7X A;  3OH3 A;  2XWM A;  4FRL A;  5AJN A;  4NAK A;  3V8Y A;  4EE4 A;  3D98 A;  4M2A A;  1VZX A;  1TW5 A;  2V0K A;  5FTS A;  4KT7 A;  3U2V A;  2RJ7 A;  2OI6 A;  1O23 B;  2WE9 A;  1ZCV A;  2E3D A;  4Y9X A;  5CMI A;  1G8O A;  1HJL A;  3E25 A;  4Y62 A;  3ZGF A;  3I0F A;  1JV1 A;  4D11 C;  1IIN A;  2VS4 A;  1NHE B;  2X65 A;  1TW1 A;  2Q4J A;  1OMX A;  2V0J A;  1ZI4 A;  3F1C A;  1H5S A;  1ZCY A;  3BCV A;  4L41 C;  4HO0 A;  1ZJ3 A;  1FOA A;  3FOQ A;  4AC3 A;  3SXC A;  1XZ6 A;  3EE5 A;  1ZDG A;  2RJ9 A;  4Y7V A;  5J49 A;  2UX8 A;  2VSI A;  2P73 A;  4DE7 A;  2YQS A;  4ECM A;  1V82 A;  4ASJ A;  1G0R A;  1H7E A;  1LZI A;  4CJ8 A;  1QG8 A;  3R3I A;  3PNN A;  2Y7A A;  1MP4 A;  4FRB A;  1R7U A;  4EE3 A;  1G1L A;  4KC2 A;  2NXV A;  4DDZ A;  5CQL X;  2JCK A;  3N9W A;  4G87 A;  2RJ0 A;  5FTV A;  4YS8 A;  1WT1 A;  2P72 A;  2P6W A;  4XWI A;  4M28 A;  2FYB A;  3ZLK A;  2AM5 A;  1VH1 A;  4Y6N A;  1O0R A;  2Y4J A;  2D7I A;  1FGX A;  2BO6 A;  2FYA A;  1LL0 A;  1MP3 A;  4FCU A;  3T7M A;  5C4D A;  1ZI3 A;  3V0P A;  1MP5 A;  2PA4 A;  3SX5 A;  4CVH A;  2FYC B;  5C4C A;  4HO3 A;  2WGZ A;  4DEC A;  4NAN A;  1OMZ A;  2WVM A;  4R7P A;  1ZIZ A;  1INI A;  5C4B A;  2CU2 A;  1ON6 A;  3V0Q A;  2XMH A;  1HV9 A;  1YP2 A;  4HG6 A;  3JTJ A;  3SPT A;  3USR A;  3QVB A;  1GX0 A;  2FFV A;  2XWN A;  3U0Y A;  1R80 A;  1H5S D;  4NAL A;  4BMA A;  2APC A;  3K8D A;  4IRP A;  4Y7F A;  5C49 A; 
#chains in the Genus database with same CATH topology
 2RIY A;  4ARW A;  1VGU A;  5FV9 A;  5CMG X;  1ZDF A;  2OI5 A;  1ZCU A;  4CJC A;  5C8R A;  3V0N A;  4E1K A;  1NKH B;  1V84 A;  3T7N A;  4FIX A;  4MND A;  4FRH A;  2VD4 A;  2AH9 A;  2ICX A;  5FUH A;  3OH4 A;  4M2B A;  2J0B A;  1FZW A;  1NWG B;  4EVW A;  1H7T A;  2Y4M A;  4KPX A;  3U2X A;  3CGX A;  3V91 A;  4FCE A;  2E8B A;  1NMM B;  1H4C A;  5EIY A;  4FQW A;  5D91 A;  4CJB A;  3K8E A;  3SX8 A;  1TZF A;  2Y6P A;  3RMW A;  2FFU A;  3U0X A;  2O1G A;  1FR8 A;  1WT3 A;  5IDS A;  2DPW A;  4JIS A;  4KQL A;  1YRO B;  4Y7G A;  5FU8 A;  2BO7 A;  2QKX A;  1FO9 A;  1LL2 A;  4Q7C A;  5DDT A;  4FRE A;  4FRQ A;  5CMJ A;  3ST8 A;  3DK5 A;  1G9R A;  2A8U A;  2PX7 A;  2WVL A;  1FRW A;  1LZ7 A;  1PZT A;  1EYR A;  2V0L A;  2W0V A;  5CMF X;  2QH5 A;  4ASY A;  1G97 A;  1H5R B;  4B2W A;  2AEC A;  2FY7 A;  4KRV A;  3I0L A;  1ZI1 A;  2X60 A;  4EE5 A;  4FRD A;  1GX4 A;  1WT0 A;  1HM8 A;  4AYL A;  1FGG A;  2BO4 A;  1OQM B;  1LL3 A;  4D11 A;  1JVD A;  4EEO A;  3OH0 A;  2MZB A;  2D0J A;  5C1G A;  2Z87 A;  5JQQ A;  3SX7 A;  4Y7T A;  1R81 A;  1FXJ A;  4IRQ A;  1VGZ A;  4HO8 A;  4B4G A;  4MIX A;  2WVK A;  1JV3 A;  4Y7U A;  5C3B A;  2RJ4 A;  4Y64 A;  3V0L A;  2RJ1 A;  1H7Q A;  5C1H A;  2ZU8 A;  3U2W A;  2I5K A;  2RJ8 A;  1G2V A;  1GQ9 A;  1HM0 A;  1VM8 A;  2D7R A;  3CKN A;  1LVW A;  3DJ4 A;  4KNX A;  1H3M A;  3I0K A;  4HOC A;  1QGQ A;  4EEG A;  1HM9 A;  3IOI A;  1R7Y A;  5I1F A;  5L6V A;  3ZF8 A;  1R7V A;  5BXC A;  3I0C A;  1FR9 A;  3F1Y A;  3Q7U A;  3TQD A;  2QGI A;  4FRA A;  2A8W A;  1O7O A;  2ICY A;  5C47 A;  4LW3 A;  1ZJ2 A;  2VS5 A;  3IOH A;  1LZ0 A;  1GQC A;  5C4F A;  2AES A;  4KPZ A;  1HJJ A;  4HO2 A;  3OH2 A;  1VH3 A;  2VFZ A;  1ZJO A;  5C3D A;  1G95 A;  2VSH A;  3I0G A;  4D0T A;  5D92 A;  4J18 A;  2I7B A;  1NF5 B;  4G3S A;  3CKO A;  4P00 A;  1EZI A;  1H5T B;  1VZU A;  1I52 A;  2Y4L A;  3CU0 A;  1ZJ0 A;  5CQM X;  1INJ A;  3ZLL A;  4AYJ A;  3V8Z A;  4K6R A;  1QGS A;  4LW6 A;  3D8V A;  4Y6U A;  1H7F A;  1WT2 A;  2X5Z A;  3SX3 A;  1V83 A;  3I0I X;  2I5E A;  1KWS A;  3LW6 A;  3V0O A;  2XME A;  2WAW A;  2O1H A;  4M4K A;  3TZT A;  2RJ6 A;  1ZJP A;  3OGZ A;  2FYD B;  2AE7 A;  4AAW A;  4B2X A;  4HO9 A;  1R82 A;  1H7L A;  1H5S C;  1G23 A;  3U2T A;  3U2U A;  1JVG A;  4D0Z A;  1S4O A;  4C2S A;  1VIC A;  2ZU7 A;  3POL A;  3SXE A;  1H4E A;  3JUK A;  1H5S B;  3Q80 A;  4FRO A;  2YQJ A;  4G3Q A;  3HL3 A;  3OC9 A;  4HO5 A;  1H7H A;  2ZU9 A;  5C4E A;  2AM4 A;  3SXG A;  1VGT A;  1E5K A;  3OKR A;  3D5N A;  1ZCT A;  1FO8 A;  1H7G A;  4B42 A;  5IDT A;  4D48 A;  3RMV A;  1QWJ A;  1TVY A;  2XWL A;  2YC5 A;  2VXM A;  1VGW A;  2V0H A;  4FIY A;  3CKJ A;  2O1F A;  1VZT A;  5C48 A;  3E26 A;  3I0J A;  3USQ A;  1LZJ A;  2YQH A;  1H5R A;  4HCQ A;  3SXD A;  3OAM A;  3V90 A;  1ZHJ A;  5HS2 A;  4MYB A;  2RJ5 A;  2RIT A;  5C36 A;  5AJP A;  2Z86 A;  1S4P A;  1O7Q A;  3CKQ A;  3T7O A;  4B4M A;  1MC3 A;  1IIM A;  4FRM A;  3ZGG A;  2OI7 A;  2PGV A;  2YQC A;  1SS9 A;  4NAI A;  2YES A;  5C1L A;  1JYL A;  2GGQ A;  1Z90 A;  2YCM A;  4KC1 A;  1VPA A;  2AM3 A;  1G3L A;  5IFY A;  3JUJ A;  3FWW A;  2OEF A;  4ZDQ A;  1ZI5 A;  5EJ1 A;  3PKQ A;  3V0M A;  3R2W A;  1S4N A;  3IOJ A;  5C3A A;  3RSB A;  3SXB A;  2JCJ A;  1G93 A;  1H4D A;  2PGY A;  3DUV A;  5DDV A;  2V0I A;  4B3U A;  5L6S A;  5FU0 A;  1W55 A;  1WSZ A;  2JCL A;  1K4V A;  2AGD A;  4P02 A;  1WVC A;  4HO6 A;  2JCO A;  5AJO A;  4O6N A;  3I0H A;  3I0D A;  1XHB A;  4Y63 A;  1ZJ1 A;  1GWV A;  2YC3 A;  4GBP A;  3BRK X;  4KXO A;  3I0E A;  1GWW A;  1W77 A;  3NGW A;  1JYK A;  2J0A A;  3KIA A;  4FRP A;  4EEM A;  5CQN X;  2GGO A;  5CMH A;  1ON8 A;  4KNR A;  4B5B A;  3GUE A;  4HO4 A;  5CQO A;  2RIZ A;  4JD0 A;  5FYE A;  4EEA A;  3CKV A;  1NQI B;  2BO8 A;  4G3P A;  2W0W A;  5C38 A;  2WEE A;  3OH1 A;  5CQP A;  3O3P A;  3Q4S A;  1FWY A;  2OEG A;  1GA8 A;  2Y4K A;  4UEG A;  3SXA A;  1R7T A;  4BQH A;  4B4B A;  1PZY B;  3PKP A;  1W57 A;  1FG5 N;  2RIX A;  2VS3 A;  4KC4 A;  2X5S A;  1YP3 A;  1H5T A;  2VK9 A;  5EJZ A;  1FXO A;  2VXL A;  1YP4 A;  1R7X A;  3OH3 A;  2XWM A;  4FRL A;  5AJN A;  4NAK A;  3V8Y A;  4EE4 A;  3D98 A;  4M2A A;  1VZX A;  1TW5 A;  2V0K A;  5FTS A;  4KT7 A;  3U2V A;  2RJ7 A;  2OI6 A;  1O23 B;  2WE9 A;  1ZCV A;  2E3D A;  4Y9X A;  5CMI A;  1G8O A;  1HJL A;  3E25 A;  4O6M A;  4Y62 A;  3ZGF A;  3I0F A;  1JV1 A;  4D11 C;  1IIN A;  2VS4 A;  1NHE B;  2X65 A;  1TW1 A;  2Q4J A;  1OMX A;  2V0J A;  1ZI4 A;  3F1C A;  1H5S A;  1ZCY A;  3BCV A;  4L41 C;  4HO0 A;  1ZJ3 A;  1FOA A;  3FOQ A;  4AC3 A;  3SXC A;  1XZ6 A;  3EE5 A;  1ZDG A;  2RJ9 A;  4Y7V A;  5J49 A;  2UX8 A;  2VSI A;  2P73 A;  4DE7 A;  2YQS A;  4ECM A;  1V82 A;  4ASJ A;  1G0R A;  1H7E A;  1LZI A;  4CJ8 A;  1QG8 A;  3R3I A;  3PNN A;  2Y7A A;  1MP4 A;  4FRB A;  1R7U A;  4EE3 A;  1G1L A;  4KC2 A;  2NXV A;  4DDZ A;  2C0N A;  5CQL X;  2JCK A;  3N9W A;  4G87 A;  2RJ0 A;  5FTV A;  4YS8 A;  1WT1 A;  2P72 A;  2P6W A;  4XWI A;  4M28 A;  2FYB A;  3ZLK A;  2AM5 A;  1VH1 A;  4Y6N A;  1O0R A;  2Y4J A;  2D7I A;  1FGX A;  2BO6 A;  2FYA A;  1LL0 A;  1MP3 A;  4FCU A;  3T7M A;  5C4D A;  1ZI3 A;  3V0P A;  1MP5 A;  2PA4 A;  3SX5 A;  4CVH A;  2FYC B;  5C4C A;  4HO3 A;  2WGZ A;  4DEC A;  4NAN A;  1OMZ A;  2WVM A;  4R7P A;  1ZIZ A;  1INI A;  5C4B A;  2CU2 A;  1ON6 A;  3V0Q A;  2XMH A;  1HV9 A;  1YP2 A;  4HG6 A;  3JTJ A;  3SPT A;  3USR A;  3QVB A;  1GX0 A;  2XWN A;  2FFV A;  3U0Y A;  1R80 A;  1H5S D;  4NAL A;  4BMA A;  2APC A;  3K8D A;  4IRP A;  4Y7F A;  5C49 A; 
#chains in the Genus database with same CATH homology
 2RIY A;  4ARW A;  1VGU A;  5FV9 A;  5CMG X;  1ZDF A;  2OI5 A;  1ZCU A;  4CJC A;  5C8R A;  3V0N A;  4E1K A;  1NKH B;  1V84 A;  3T7N A;  4FIX A;  4MND A;  4FRH A;  2VD4 A;  2AH9 A;  2ICX A;  5FUH A;  3OH4 A;  4M2B A;  2J0B A;  1FZW A;  1NWG B;  4EVW A;  1H7T A;  2Y4M A;  4KPX A;  3U2X A;  3CGX A;  3V91 A;  4FCE A;  2E8B A;  1NMM B;  1H4C A;  5EIY A;  4FQW A;  5D91 A;  4CJB A;  3K8E A;  3SX8 A;  1TZF A;  2Y6P A;  3RMW A;  2FFU A;  3U0X A;  2O1G A;  1FR8 A;  1WT3 A;  5IDS A;  2DPW A;  4JIS A;  4KQL A;  1YRO B;  4Y7G A;  5FU8 A;  2BO7 A;  2QKX A;  1FO9 A;  1LL2 A;  4Q7C A;  5DDT A;  4FRE A;  4FRQ A;  5CMJ A;  3ST8 A;  3DK5 A;  1G9R A;  2A8U A;  2PX7 A;  2WVL A;  1FRW A;  1LZ7 A;  1PZT A;  1EYR A;  2V0L A;  2W0V A;  5CMF X;  2QH5 A;  4ASY A;  1G97 A;  1H5R B;  4B2W A;  2AEC A;  2FY7 A;  4KRV A;  3I0L A;  1ZI1 A;  2X60 A;  4EE5 A;  4FRD A;  1GX4 A;  1WT0 A;  1HM8 A;  4AYL A;  1FGG A;  2BO4 A;  1OQM B;  1LL3 A;  4D11 A;  1JVD A;  4EEO A;  3OH0 A;  2MZB A;  2D0J A;  5C1G A;  2Z87 A;  5JQQ A;  3SX7 A;  4Y7T A;  1R81 A;  1FXJ A;  4IRQ A;  1VGZ A;  4HO8 A;  4B4G A;  4MIX A;  2WVK A;  1JV3 A;  4Y7U A;  5C3B A;  2RJ4 A;  4Y64 A;  3V0L A;  2RJ1 A;  1H7Q A;  5C1H A;  2ZU8 A;  3U2W A;  2I5K A;  2RJ8 A;  1G2V A;  1GQ9 A;  1HM0 A;  1VM8 A;  2D7R A;  3CKN A;  1LVW A;  3DJ4 A;  4KNX A;  1H3M A;  3I0K A;  4HOC A;  1QGQ A;  4EEG A;  1HM9 A;  3IOI A;  1R7Y A;  5I1F A;  5L6V A;  3ZF8 A;  1R7V A;  5BXC A;  3I0C A;  1FR9 A;  3F1Y A;  3Q7U A;  3TQD A;  2QGI A;  4FRA A;  2A8W A;  1O7O A;  2ICY A;  5C47 A;  4LW3 A;  1ZJ2 A;  2VS5 A;  3IOH A;  1LZ0 A;  1GQC A;  5C4F A;  2AES A;  4KPZ A;  1HJJ A;  4HO2 A;  3OH2 A;  1VH3 A;  2VFZ A;  1ZJO A;  5C3D A;  1G95 A;  2VSH A;  3I0G A;  4D0T A;  5D92 A;  4J18 A;  2I7B A;  1NF5 B;  4G3S A;  3CKO A;  4P00 A;  1EZI A;  1H5T B;  1VZU A;  1I52 A;  2Y4L A;  3CU0 A;  1ZJ0 A;  5CQM X;  1INJ A;  3ZLL A;  4AYJ A;  3V8Z A;  4K6R A;  1QGS A;  4LW6 A;  3D8V A;  4Y6U A;  1H7F A;  1WT2 A;  2X5Z A;  3SX3 A;  1V83 A;  3I0I X;  2I5E A;  1KWS A;  3LW6 A;  3V0O A;  2XME A;  2WAW A;  2O1H A;  4M4K A;  3TZT A;  2RJ6 A;  1ZJP A;  3OGZ A;  2FYD B;  2AE7 A;  4AAW A;  4B2X A;  4HO9 A;  1R82 A;  1H7L A;  1H5S C;  1G23 A;  3U2T A;  3U2U A;  1JVG A;  4D0Z A;  1S4O A;  4C2S A;  1VIC A;  2ZU7 A;  3POL A;  3SXE A;  1H4E A;  3JUK A;  1H5S B;  3Q80 A;  4FRO A;  2YQJ A;  4G3Q A;  3HL3 A;  3OC9 A;  4HO5 A;  1H7H A;  2ZU9 A;  5C4E A;  2AM4 A;  3SXG A;  1VGT A;  1E5K A;  3OKR A;  3D5N A;  1ZCT A;  1FO8 A;  1H7G A;  4B42 A;  5IDT A;  4D48 A;  3RMV A;  1QWJ A;  1TVY A;  2XWL A;  2YC5 A;  2VXM A;  1VGW A;  2V0H A;  4FIY A;  3CKJ A;  2O1F A;  1VZT A;  5C48 A;  3E26 A;  3I0J A;  3USQ A;  1LZJ A;  2YQH A;  1H5R A;  4HCQ A;  3SXD A;  3OAM A;  3V90 A;  1ZHJ A;  5HS2 A;  4MYB A;  2RJ5 A;  2RIT A;  5C36 A;  5AJP A;  2Z86 A;  1S4P A;  1O7Q A;  3CKQ A;  3T7O A;  4B4M A;  1MC3 A;  1IIM A;  4FRM A;  3ZGG A;  2OI7 A;  2PGV A;  2YQC A;  1SS9 A;  4NAI A;  2YES A;  5C1L A;  1JYL A;  2GGQ A;  1Z90 A;  2YCM A;  4KC1 A;  1VPA A;  2AM3 A;  1G3L A;  5IFY A;  3JUJ A;  3FWW A;  2OEF A;  4ZDQ A;  1ZI5 A;  5EJ1 A;  3PKQ A;  3V0M A;  3R2W A;  1S4N A;  3IOJ A;  5C3A A;  3RSB A;  3SXB A;  2JCJ A;  1G93 A;  1H4D A;  2PGY A;  3DUV A;  5DDV A;  2V0I A;  4B3U A;  5L6S A;  5FU0 A;  1W55 A;  1WSZ A;  2JCL A;  1K4V A;  2AGD A;  4P02 A;  1WVC A;  4HO6 A;  2JCO A;  5AJO A;  4O6N A;  3I0H A;  3I0D A;  1XHB A;  4Y63 A;  1ZJ1 A;  1GWV A;  2YC3 A;  4GBP A;  3BRK X;  4KXO A;  3I0E A;  1GWW A;  1W77 A;  3NGW A;  1JYK A;  2J0A A;  3KIA A;  4FRP A;  4EEM A;  5CQN X;  2GGO A;  5CMH A;  1ON8 A;  4KNR A;  4B5B A;  3GUE A;  4HO4 A;  5CQO A;  2RIZ A;  4JD0 A;  5FYE A;  4EEA A;  3CKV A;  1NQI B;  2BO8 A;  4G3P A;  2W0W A;  5C38 A;  2WEE A;  3OH1 A;  5CQP A;  3O3P A;  3Q4S A;  1FWY A;  2OEG A;  1GA8 A;  2Y4K A;  4UEG A;  3SXA A;  1R7T A;  4BQH A;  4B4B A;  1PZY B;  3PKP A;  1W57 A;  1FG5 N;  2RIX A;  2VS3 A;  4KC4 A;  2X5S A;  1YP3 A;  1H5T A;  2VK9 A;  5EJZ A;  1FXO A;  2VXL A;  1YP4 A;  1R7X A;  3OH3 A;  2XWM A;  4FRL A;  5AJN A;  4NAK A;  3V8Y A;  4EE4 A;  3D98 A;  4M2A A;  1VZX A;  1TW5 A;  2V0K A;  5FTS A;  4KT7 A;  3U2V A;  2RJ7 A;  2OI6 A;  1O23 B;  2WE9 A;  1ZCV A;  2E3D A;  4Y9X A;  5CMI A;  1G8O A;  1HJL A;  3E25 A;  4O6M A;  4Y62 A;  3ZGF A;  3I0F A;  1JV1 A;  4D11 C;  1IIN A;  2VS4 A;  1NHE B;  2X65 A;  1TW1 A;  2Q4J A;  1OMX A;  2V0J A;  1ZI4 A;  3F1C A;  1H5S A;  1ZCY A;  3BCV A;  4L41 C;  4HO0 A;  1ZJ3 A;  1FOA A;  3FOQ A;  4AC3 A;  3SXC A;  1XZ6 A;  3EE5 A;  1ZDG A;  2RJ9 A;  4Y7V A;  5J49 A;  2UX8 A;  2VSI A;  2P73 A;  4DE7 A;  2YQS A;  4ECM A;  1V82 A;  4ASJ A;  1G0R A;  1H7E A;  1LZI A;  4CJ8 A;  1QG8 A;  3R3I A;  3PNN A;  2Y7A A;  1MP4 A;  4FRB A;  1R7U A;  4EE3 A;  1G1L A;  4KC2 A;  2NXV A;  4DDZ A;  2C0N A;  5CQL X;  2JCK A;  3N9W A;  4G87 A;  2RJ0 A;  5FTV A;  4YS8 A;  1WT1 A;  2P72 A;  2P6W A;  4XWI A;  4M28 A;  2FYB A;  3ZLK A;  2AM5 A;  1VH1 A;  4Y6N A;  1O0R A;  2Y4J A;  2D7I A;  1FGX A;  2BO6 A;  2FYA A;  1LL0 A;  1MP3 A;  4FCU A;  3T7M A;  5C4D A;  1ZI3 A;  3V0P A;  1MP5 A;  2PA4 A;  3SX5 A;  4CVH A;  2FYC B;  5C4C A;  4HO3 A;  2WGZ A;  4DEC A;  4NAN A;  1OMZ A;  2WVM A;  4R7P A;  1ZIZ A;  1INI A;  5C4B A;  2CU2 A;  1ON6 A;  3V0Q A;  2XMH A;  1HV9 A;  1YP2 A;  4HG6 A;  3JTJ A;  3SPT A;  3USR A;  3QVB A;  1GX0 A;  2XWN A;  2FFV A;  3U0Y A;  1R80 A;  1H5S D;  4NAL A;  4BMA A;  2APC A;  3K8D A;  4IRP A;  4Y7F A;  5C49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...