2X5SA

Crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
333
Chain Sequence
VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDLGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNOSE-1-PHOSPHATE GUANYLYLTRANSFERASE
publication title Structural Insights Into the Catalytic Mechanism of Bacterial Guanosine-Diphospho-D-Mannose Pyrophosphorylase and its Regulation by Divalent Ions.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 107
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.7.7.13: Mannose-1-phosphate guanylyltransferase.
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2x5sA00
2PX7A 2VXMA 3I0CA 3SX3A 5J49A 3SXDA 1O7OA 1VGUA 1FO8A 4FROA 1OMZA 1FOAA 5AJOA 4Y64A 1G23A 1NHEB 2WE9A 3D5NA 4FRAA 4P00A 4Y6NA 1NMMB 2BO4A 1S4PA 1K4VA 5FU0A 2AGDA 1GA8A 2RIXA 4KT7A 4M2BA 1G93A 4KC1A 3U0YA 2WVKA 5IDSA 3V0MA 2RJ5A 4B5BA 2FYAA 4HCQA 3SX8A 2Y7AA 5CMIA 3OH1A 5CMJA 4IRQA 3I0GA 2FFVA 2NXVA 5DDTA 1YP2A 2RIYA 3V91A 4AYLA 1VZUA 1FXOA 1WT1A 1ZI3A 5EIYA 1LL0A 5C49A 1YP4A 1W77A 2YQSA 1VZXA 1WT2A 3I0JA 3V0QA 1E5KA 5IFYA 1FXJA 5CQMX 5C1LA 5CMFX 2DPWA 4HO9A 2MZBA 4BMAA 4LW6A 1YROB 2YC5A 1ZCVA 1R7VA 3Q7UA 5AJNA 5C4DA 5I1FA 3CGXA 3DUVA 4Y6UA 3SX5A 4KPZA 1ZDFA 1H5RA 3EE5A 4IRPA 1H7EA 4MYBA 4AAWA 3Q80A 4B4MA 4DE7A 2PGYA 2PGVA 4G3QA 5FV9A 3IOJA 2FYCB 4LW3A 4BQHA 4Y63A 2XWLA 2VS4A 3I0EA 3SPTA 1O0RA 3T7MA 2OEGA 1G0RA 3ZGFA 3USRA 4D11A 1FG5N 1KWSA 2I5KA 2O1HA 5CQLX 2VS5A 1ZJ2A 1G3LA 1H3MA 2WAWA 1VGWA 4HO4A 2RJ7A 3SXEA 4NALA 1WSZA 3E25A 1ZJPA 1ZJ0A 3V0NA 2X5ZA 1H7HA 2YQCA 1G1LA 4Y9XA 5C1HA 1GQ9A 2BO8A 5CQNX 1MP5A 1ZJOA 4KC2A 4C2SA 3CKNA 2Q4JA 3BCVA 2AESA 2VS3A 5DDVA 2V0JA 2VFZA 2OEFA 2FFUA 3DK5A 3I0IX 1LZ7A 5C36A 1TZFA 1ZCUA 2ICXA 2WGZA 5L6SA 5CMGX 2WVLA 2YESA 4Y7FA 1NWGB 3OH2A 3U0XA 1ZI4A 4KC4A 1XHBA 2BO6A 4KXOA 4FRDA 2Z87A 1WT0A 4ECMA 2WVMA 2W0WA 4DECA 5C47A 4CJCA 5C3BA 1H7QA 4HO3A 1H7TA 4HOCA 4B2XA 3HL3A 2YQHA 2YC3A 1XZ6A 1HM9A 3U2TA 4FRQA 3V0OA 1TW1A 4FREA 1GQCA 1V83A 1HJJA 2V0LA 2JCKA 3PKQA 1JV1A 2D7IA 1YP3A 4EEGA 1EYRA 4EEAA 3V90A 3IOHA 3I0FA 2O1GA 2OI7A 4B2WA 4KNXA 2ZU7A 5FUHA 1G97A 1HJLA 3CKVA 1QG8A 2D0JA 1FGGA 1H7GA 1I52A 3ZGGA 5C4EA 1HV9A 3R2WA 1JVGA 5CQPA 1INJA 3I0HA 2X60A 4L41C 1VH3A 2V0IA 3D98A 5C1GA 2X5SA 4FQWA 4E1KA 5EJZA 1PZYB 2P6WA 2JCJA 2CU2A 2AH9A 2V0HA 4HG6A 3OH3A 3ST8A 2RIZA 1G2VA 1ZJ1A 3OH0A 4KNRA 3SX7A 1V84A 2I5EA 1H4CA 3JTJA 3V0PA 3PNNA 3F1CA 1FO9A 4CJBA 4G3SA 3T7NA 1V82A 2W0VA 3CKOA 2VSIA 2O1FA 5CQOA 5C48A 1O7QA 4FCEA 1G9RA 5BXCA 2FYDB 2FYBA 2I7BA 4KPXA 1JV3A 3JUKA 3POLA 4NANA 1FWYA 1G95A 1H5RB 1MP4A 1W55A 4G3PA 3OGZA 1W57A 4JISA 2Z86A 1ZCYA 2X65A 5FYEA 4R7PA 2RJ8A 1NKHB 1MC3A 3N9WA 3USQA 1QGQA 4M2AA 4D11C 1NQIB 4AC3A 1G8OA 1LVWA 4DDZA 1GX4A 4D0ZA 2JCLA 1MP3A 3V8YA 2YCMA 2RJ9A 3O3PA 1FRWA 5JQQA 3SXCA 2VXLA 3OH4A 4HO8A 3JUJA 4CJ8A 4P02A 1VGZA 5FTVA 3U2XA 2A8WA 2Y4LA 3I0KA 4JD0A 3QVBA 2JCOA 1H5SA 2QGIA 2E3DA 3U2UA 4B42A 2Y4KA 4HO2A 1H5SC 2RJ0A 2A8UA 2APCA 4FRBA 1ZI5A 3TQDA 2RJ4A 3FWWA 4HO6A 3DJ4A 2YQJA 4YS8A 4KQLA 1ZIZA 3GUEA 4EEOA 3I0DA 4CVHA 1H5TA 4ZDQA 2AM5A 2ZU8A 3RSBA 2V0KA 2OI6A 1ZDGA 2Y4JA 1FR9A 1NF5B 1R7XA 1IIMA 1LZJA 5C4BA 2QH5A 2WEEA 1VM8A 1H7FA 1OQMB 2XMEA 4Y7TA 2D7RA 5HS2A 4FRLA 1VICA 2E8BA 5C38A 1R7TA 2XWMA 1ZJ3A 3D8VA 3RMVA 1LZ0A 2GGOA 5EJ1A 2Y4MA 2RITA 1ON6A 4Y62A 1ZHJA 5C4FA 4M28A 2Y6PA 3LW6A 3ZLKA 1R80A 4FRMA 4GBPA 1HM0A 3T7OA 3NGWA 4NAKA 2AM3A 5C3AA 1SS9A 3RMWA 4K6RA 2ICYA 1H7LA 3OC9A 1S4NA 1ZCTA 1JYLA 2XWNA 1LL3A 4Y7VA 3KIAA 5FU8A 3Q4SA 1FR8A 4HO0A 5C3DA 4FRHA 1GWVA 3E26A 2RJ1A 4EE5A 2UX8A 4D48A 1VPAA 4B4BA 5IDTA 4Y7GA 1GX0A 1LZIA 1QWJA 1EZIA 2BO7A 4MNDA 1H4DA 1JVDA 1WT3A 1R82A 3V0LA 3TZTA 4B4GA 2VD4A 4D0TA 3FOQA 1R7UA 4AYJA 3ZLLA 1TVYA 1Z90A 3ZF8A 2QKXA 3I0LA 3U2WA 2P73A 2FY7A 4ASJA 4J18A 3F1YA 1HM8A 3K8EA 5C8RA 4UEGA 4KRVA 3SXAA 3CU0A 1INIA 4XWIA 1H5SD 4FRPA 4EVWA 4FCUA 2VSHA 3BRKX 1QGSA 1VH1A 1FGXA 3CKJA 3IOIA 3SXGA 3PKPA 3SXBA 2GGQA 4EE4A 5AJPA 4Y7UA 1ZI1A 1VGTA 1S4OA 4EE3A 5C4CA 3U2VA 1R7YA 1R81A 2PA4A 5L6VA 3OAMA 4B3UA 4ASYA 4ARWA 5FTSA 1GWWA 1JYKA 1H4EA 3CKQA 1FZWA 1H5SB 1PZTA 2AM4A 5CMHA 3V8ZA 3R3IA 1O23B 1ON8A 4NAIA 2AE7A 2P72A 2AECA 4EEMA 2ZU9A 2RJ6A 3K8DA 3OKRA 1LL2A 1IINA 1WVCA 4M4KA 1TW5A 2OI5A 1H5TB 1OMXA 2XMHA 4HO5A 4G87A 1VZTA
chains in the Genus database with same CATH superfamily
2PX7A 2VXMA 3I0CA 3SX3A 5J49A 3SXDA 1O7OA 1VGUA 1FO8A 4FROA 1OMZA 1FOAA 5AJOA 4Y64A 1G23A 1NHEB 2WE9A 3D5NA 4FRAA 4P00A 4Y6NA 1NMMB 2BO4A 1S4PA 1K4VA 5FU0A 2AGDA 1GA8A 2RIXA 4KT7A 4M2BA 1G93A 4KC1A 3U0YA 2WVKA 5IDSA 3V0MA 2RJ5A 4B5BA 2FYAA 4HCQA 2J0BA 2Y7AA 3SX8A 5CMIA 3OH1A 5CMJA 4IRQA 3I0GA 2FFVA 2NXVA 5DDTA 1YP2A 2RIYA 3V91A 4AYLA 1VZUA 1FXOA 1WT1A 1ZI3A 5EIYA 1LL0A 5C49A 1YP4A 1W77A 2YQSA 1VZXA 1WT2A 3I0JA 3V0QA 1E5KA 5IFYA 1FXJA 5CQMX 5C1LA 5CMFX 2DPWA 4HO9A 2MZBA 4BMAA 4LW6A 1YROB 2YC5A 1ZCVA 1R7VA 4FIYA 3Q7UA 5AJNA 5C4DA 5I1FA 3CGXA 3DUVA 4Y6UA 3SX5A 4KPZA 1ZDFA 1H5RA 4MIXA 3EE5A 4IRPA 1H7EA 4MYBA 4AAWA 3Q80A 4B4MA 4DE7A 2PGYA 2PGVA 4G3QA 5FV9A 3IOJA 2FYCB 4LW3A 4BQHA 4Y63A 2XWLA 2VS4A 3I0EA 3SPTA 1O0RA 3T7MA 2OEGA 1G0RA 3ZGFA 3USRA 4D11A 1FG5N 1KWSA 2I5KA 2O1HA 5CQLX 2VS5A 1ZJ2A 1G3LA 1H3MA 2WAWA 1VGWA 4HO4A 2RJ7A 3SXEA 4NALA 1WSZA 3E25A 1ZJPA 1ZJ0A 3V0NA 2X5ZA 1H7HA 4FIXA 2YQCA 1G1LA 4Y9XA 5C1HA 1GQ9A 2BO8A 5CQNX 1MP5A 1ZJOA 4KC2A 4C2SA 3CKNA 2Q4JA 3BCVA 2AESA 2VS3A 5DDVA 2V0JA 2VFZA 2OEFA 2FFUA 3DK5A 3I0IX 1LZ7A 5C36A 1TZFA 1ZCUA 2ICXA 2WGZA 5L6SA 5CMGX 2WVLA 2YESA 4Y7FA 1NWGB 2VK9A 3OH2A 3U0XA 1ZI4A 4KC4A 1XHBA 2BO6A 4KXOA 4FRDA 2Z87A 1WT0A 4ECMA 2WVMA 2W0WA 4DECA 5C47A 4CJCA 5C3BA 1H7QA 4HO3A 1H7TA 2C0NA 4HOCA 4B2XA 3HL3A 2YQHA 2YC3A 1XZ6A 1HM9A 3U2TA 4FRQA 3V0OA 1TW1A 4FREA 1GQCA 1V83A 1HJJA 2V0LA 2JCKA 3PKQA 1JV1A 2D7IA 1YP3A 4EEGA 1EYRA 4EEAA 3V90A 3IOHA 3I0FA 2O1GA 2OI7A 4B2WA 4KNXA 2ZU7A 5FUHA 1G97A 1HJLA 3CKVA 1QG8A 2D0JA 1FGGA 1H7GA 1I52A 3ZGGA 5C4EA 1HV9A 3R2WA 1JVGA 5CQPA 1INJA 3I0HA 2X60A 4L41C 1VH3A 2V0IA 3D98A 5C1GA 2X5SA 4FQWA 4E1KA 5EJZA 1PZYB 2P6WA 2JCJA 2CU2A 2AH9A 2V0HA 4HG6A 3OH3A 3ST8A 2RIZA 1G2VA 1ZJ1A 3OH0A 4KNRA 3SX7A 1V84A 2I5EA 1H4CA 5D92A 3JTJA 3V0PA 3PNNA 3F1CA 1FO9A 4CJBA 4G3SA 3T7NA 1V82A 2W0VA 3CKOA 2VSIA 2O1FA 5CQOA 5C48A 1O7QA 4FCEA 1G9RA 5BXCA 2FYDB 2FYBA 2I7BA 4KPXA 1JV3A 3JUKA 3POLA 4NANA 1FWYA 1G95A 1H5RB 1MP4A 1W55A 4G3PA 3OGZA 1W57A 4JISA 2Z86A 1ZCYA 2X65A 5FYEA 4R7PA 2RJ8A 1NKHB 1MC3A 3N9WA 3USQA 1QGQA 4M2AA 4D11C 1NQIB 4AC3A 1G8OA 1LVWA 4DDZA 1GX4A 4D0ZA 2JCLA 1MP3A 3V8YA 2YCMA 2RJ9A 3O3PA 1FRWA 5JQQA 3SXCA 2VXLA 3OH4A 4HO8A 3JUJA 4CJ8A 4P02A 1VGZA 5FTVA 3U2XA 2A8WA 2Y4LA 3I0KA 4JD0A 3QVBA 2JCOA 1H5SA 2QGIA 2E3DA 3U2UA 4B42A 2Y4KA 4HO2A 1H5SC 2RJ0A 2A8UA 2APCA 4FRBA 1ZI5A 3TQDA 2RJ4A 3FWWA 4HO6A 3DJ4A 2YQJA 4YS8A 4KQLA 1ZIZA 3GUEA 4EEOA 4Q7CA 3I0DA 4CVHA 1H5TA 4ZDQA 2AM5A 2ZU8A 3RSBA 2V0KA 2OI6A 1ZDGA 2Y4JA 1FR9A 1NF5B 1R7XA 1IIMA 1LZJA 5C4BA 2QH5A 2WEEA 1VM8A 1H7FA 1OQMB 2XMEA 4Y7TA 2D7RA 5HS2A 4FRLA 1VICA 2E8BA 5C38A 1R7TA 2XWMA 1ZJ3A 3D8VA 3RMVA 1LZ0A 2GGOA 5EJ1A 2Y4MA 2RITA 1ON6A 4Y62A 1ZHJA 5C4FA 4M28A 2Y6PA 3LW6A 3ZLKA 1R80A 4FRMA 4GBPA 1HM0A 3T7OA 3NGWA 4NAKA 2AM3A 5C3AA 4O6MA 1SS9A 3RMWA 4K6RA 2ICYA 1H7LA 3OC9A 1S4NA 1ZCTA 1JYLA 2XWNA 1LL3A 4Y7VA 3KIAA 5FU8A 3Q4SA 1FR8A 5D91A 4HO0A 5C3DA 4FRHA 1GWVA 3E26A 2RJ1A 4EE5A 2UX8A 4D48A 1VPAA 4B4BA 5IDTA 4Y7GA 1GX0A 1LZIA 1QWJA 1EZIA 2BO7A 4MNDA 1H4DA 1JVDA 1WT3A 1R82A 3V0LA 4O6NA 3TZTA 4B4GA 2VD4A 4D0TA 3FOQA 1R7UA 4AYJA 3ZLLA 1TVYA 1Z90A 3ZF8A 2QKXA 3I0LA 3U2WA 2P73A 2FY7A 4ASJA 4J18A 3F1YA 1HM8A 3K8EA 5C8RA 4UEGA 4KRVA 3SXAA 3CU0A 1INIA 4XWIA 1H5SD 4FRPA 4EVWA 4FCUA 2VSHA 3BRKX 1QGSA 1VH1A 1FGXA 3CKJA 3IOIA 3SXGA 3PKPA 3SXBA 2GGQA 4EE4A 5AJPA 4Y7UA 1ZI1A 1VGTA 1S4OA 4EE3A 5C4CA 3U2VA 1R7YA 1R81A 2PA4A 5L6VA 3OAMA 4B3UA 4ASYA 4ARWA 5FTSA 1GWWA 1JYKA 1H4EA 3CKQA 1FZWA 1H5SB 1PZTA 2AM4A 5CMHA 3V8ZA 3R3IA 1O23B 1ON8A 4NAIA 2AE7A 2P72A 2AECA 4EEMA 2ZU9A 2RJ6A 3K8DA 3OKRA 1LL2A 1IINA 1WVCA 4M4KA 1TW5A 2OI5A 1H5TB 1OMXA 2XMHA 4HO5A 4G87A 1VZTA 2J0AA
chains in the Genus database with same CATH topology
2PX7A 2VXMA 3I0CA 3SX3A 5J49A 3SXDA 1O7OA 1VGUA 1FO8A 4FROA 1OMZA 1FOAA 5AJOA 4Y64A 1G23A 1NHEB 2WE9A 3D5NA 4FRAA 4P00A 4Y6NA 1NMMB 2BO4A 1S4PA 1K4VA 5FU0A 2AGDA 1GA8A 2RIXA 4KT7A 4M2BA 1G93A 4KC1A 3U0YA 2WVKA 5IDSA 3V0MA 2RJ5A 4B5BA 2FYAA 4HCQA 2J0BA 2Y7AA 3SX8A 5CMIA 3OH1A 5CMJA 4IRQA 3I0GA 2FFVA 2NXVA 5DDTA 1YP2A 2RIYA 3V91A 4AYLA 1VZUA 1FXOA 1WT1A 1ZI3A 5EIYA 1LL0A 5C49A 1YP4A 1W77A 2YQSA 1VZXA 1WT2A 3I0JA 3V0QA 1E5KA 5IFYA 1FXJA 5CQMX 5C1LA 5CMFX 2DPWA 4HO9A 2MZBA 4BMAA 4LW6A 1YROB 2YC5A 1ZCVA 1R7VA 4FIYA 3Q7UA 5AJNA 5C4DA 5I1FA 3CGXA 3DUVA 4Y6UA 3SX5A 4KPZA 1ZDFA 1H5RA 4MIXA 3EE5A 4IRPA 1H7EA 4MYBA 4AAWA 3Q80A 4B4MA 4DE7A 2PGYA 2PGVA 4G3QA 5FV9A 3IOJA 2FYCB 4LW3A 4BQHA 4Y63A 2XWLA 2VS4A 3I0EA 3SPTA 1O0RA 3T7MA 2OEGA 1G0RA 3ZGFA 3USRA 4D11A 1FG5N 1KWSA 2I5KA 2O1HA 5CQLX 2VS5A 1ZJ2A 1G3LA 1H3MA 2WAWA 1VGWA 4HO4A 2RJ7A 3SXEA 4NALA 1WSZA 3E25A 1ZJPA 1ZJ0A 3V0NA 2X5ZA 1H7HA 4FIXA 2YQCA 1G1LA 4Y9XA 5C1HA 1GQ9A 2BO8A 5CQNX 1MP5A 1ZJOA 4KC2A 4C2SA 3CKNA 2Q4JA 3BCVA 2AESA 2VS3A 5DDVA 2V0JA 2VFZA 2OEFA 2FFUA 3DK5A 3I0IX 1LZ7A 5C36A 1TZFA 1ZCUA 2ICXA 2WGZA 5L6SA 5CMGX 2WVLA 2YESA 4Y7FA 1NWGB 2VK9A 3OH2A 3U0XA 1ZI4A 4KC4A 1XHBA 2BO6A 4KXOA 4FRDA 2Z87A 1WT0A 4ECMA 2WVMA 2W0WA 4DECA 5C47A 4CJCA 5C3BA 1H7QA 4HO3A 1H7TA 2C0NA 4HOCA 4B2XA 3HL3A 2YQHA 2YC3A 1XZ6A 1HM9A 3U2TA 4FRQA 3V0OA 1TW1A 4FREA 1GQCA 1V83A 1HJJA 2V0LA 2JCKA 3PKQA 1JV1A 2D7IA 1YP3A 4EEGA 1EYRA 4EEAA 3V90A 3IOHA 3I0FA 2O1GA 2OI7A 4B2WA 4KNXA 2ZU7A 5FUHA 1G97A 1HJLA 3CKVA 1QG8A 2D0JA 1FGGA 1H7GA 1I52A 3ZGGA 5C4EA 1HV9A 3R2WA 1JVGA 5CQPA 1INJA 3I0HA 2X60A 4L41C 1VH3A 2V0IA 3D98A 5C1GA 2X5SA 4FQWA 4E1KA 5EJZA 1PZYB 2P6WA 2JCJA 2CU2A 2AH9A 2V0HA 4HG6A 3OH3A 3ST8A 2RIZA 1G2VA 1ZJ1A 3OH0A 4KNRA 3SX7A 1V84A 2I5EA 1H4CA 5D92A 3JTJA 3V0PA 3PNNA 3F1CA 1FO9A 4CJBA 4G3SA 3T7NA 1V82A 2W0VA 3CKOA 2VSIA 2O1FA 5CQOA 5C48A 1O7QA 4FCEA 1G9RA 5BXCA 2FYDB 2FYBA 2I7BA 4KPXA 1JV3A 3JUKA 3POLA 4NANA 1FWYA 1G95A 1H5RB 1MP4A 1W55A 4G3PA 3OGZA 1W57A 4JISA 2Z86A 1ZCYA 2X65A 5FYEA 4R7PA 2RJ8A 1NKHB 1MC3A 3N9WA 3USQA 1QGQA 4M2AA 4D11C 1NQIB 4AC3A 1G8OA 1LVWA 4DDZA 1GX4A 4D0ZA 2JCLA 1MP3A 3V8YA 2YCMA 2RJ9A 3O3PA 1FRWA 5JQQA 3SXCA 2VXLA 3OH4A 4HO8A 3JUJA 4CJ8A 4P02A 1VGZA 5FTVA 3U2XA 2A8WA 2Y4LA 3I0KA 4JD0A 3QVBA 2JCOA 1H5SA 2QGIA 2E3DA 3U2UA 4B42A 2Y4KA 4HO2A 1H5SC 2RJ0A 2A8UA 2APCA 4FRBA 1ZI5A 3TQDA 2RJ4A 3FWWA 4HO6A 3DJ4A 2YQJA 4YS8A 4KQLA 1ZIZA 3GUEA 4EEOA 4Q7CA 3I0DA 4CVHA 1H5TA 4ZDQA 2AM5A 2ZU8A 3RSBA 2V0KA 2OI6A 1ZDGA 2Y4JA 1FR9A 1NF5B 1R7XA 1IIMA 1LZJA 5C4BA 2QH5A 2WEEA 1VM8A 1H7FA 1OQMB 2XMEA 4Y7TA 2D7RA 5HS2A 4FRLA 1VICA 2E8BA 5C38A 1R7TA 2XWMA 1ZJ3A 3D8VA 3RMVA 1LZ0A 2GGOA 5EJ1A 2Y4MA 2RITA 1ON6A 4Y62A 1ZHJA 5C4FA 4M28A 2Y6PA 3LW6A 3ZLKA 1R80A 4FRMA 4GBPA 1HM0A 3T7OA 3NGWA 4NAKA 2AM3A 5C3AA 4O6MA 1SS9A 3RMWA 4K6RA 2ICYA 1H7LA 3OC9A 1S4NA 1ZCTA 1JYLA 2XWNA 1LL3A 4Y7VA 3KIAA 5FU8A 3Q4SA 1FR8A 5D91A 4HO0A 5C3DA 4FRHA 1GWVA 3E26A 2RJ1A 4EE5A 2UX8A 4D48A 1VPAA 4B4BA 5IDTA 4Y7GA 1GX0A 1LZIA 1QWJA 1EZIA 2BO7A 4MNDA 1H4DA 1JVDA 1WT3A 1R82A 3V0LA 4O6NA 3TZTA 4B4GA 2VD4A 4D0TA 3FOQA 1R7UA 4AYJA 3ZLLA 1TVYA 1Z90A 3ZF8A 2QKXA 3I0LA 3U2WA 2P73A 2FY7A 4ASJA 4J18A 3F1YA 1HM8A 3K8EA 5C8RA 4UEGA 4KRVA 3SXAA 3CU0A 1INIA 4XWIA 1H5SD 4FRPA 4EVWA 4FCUA 2VSHA 3BRKX 1QGSA 1VH1A 1FGXA 3CKJA 3IOIA 3SXGA 3PKPA 3SXBA 2GGQA 4EE4A 5AJPA 4Y7UA 1ZI1A 1VGTA 1S4OA 4EE3A 5C4CA 3U2VA 1R7YA 1R81A 2PA4A 5L6VA 3OAMA 4B3UA 4ASYA 4ARWA 5FTSA 1GWWA 1JYKA 1H4EA 3CKQA 1FZWA 1H5SB 1PZTA 2AM4A 5CMHA 3V8ZA 3R3IA 1O23B 1ON8A 4NAIA 2AE7A 2P72A 2AECA 4EEMA 2ZU9A 2RJ6A 3K8DA 3OKRA 1LL2A 1IINA 1WVCA 4M4KA 1TW5A 2OI5A 1H5TB 1OMXA 2XMHA 4HO5A 4G87A 1VZTA 2J0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PX7 A;  2VXM A;  3I0C A;  3SX3 A;  5J49 A;  3SXD A;  1O7O A;  1VGU A;  1FO8 A;  4FRO A;  1OMZ A;  1FOA A;  5AJO A;  4Y64 A;  1G23 A;  1NHE B;  2WE9 A;  3D5N A;  4FRA A;  4P00 A;  4Y6N A;  1NMM B;  2BO4 A;  1S4P A;  1K4V A;  5FU0 A;  2AGD A;  1GA8 A;  2RIX A;  4KT7 A;  4M2B A;  1G93 A;  4KC1 A;  3U0Y A;  2WVK A;  5IDS A;  3V0M A;  2RJ5 A;  4B5B A;  2FYA A;  4HCQ A;  3SX8 A;  2Y7A A;  5CMI A;  3OH1 A;  5CMJ A;  4IRQ A;  3I0G A;  2FFV A;  2NXV A;  5DDT A;  1YP2 A;  2RIY A;  3V91 A;  4AYL A;  1VZU A;  1FXO A;  1WT1 A;  1ZI3 A;  5EIY A;  1LL0 A;  5C49 A;  1YP4 A;  1W77 A;  2YQS A;  1VZX A;  1WT2 A;  3I0J A;  3V0Q A;  1E5K A;  5IFY A;  1FXJ A;  5CQM X;  5C1L A;  5CMF X;  2DPW A;  4HO9 A;  2MZB A;  4BMA A;  4LW6 A;  1YRO B;  2YC5 A;  1ZCV A;  1R7V A;  3Q7U A;  5AJN A;  5C4D A;  5I1F A;  3CGX A;  3DUV A;  4Y6U A;  3SX5 A;  4KPZ A;  1ZDF A;  1H5R A;  3EE5 A;  4IRP A;  1H7E A;  4MYB A;  4AAW A;  3Q80 A;  4B4M A;  4DE7 A;  2PGY A;  2PGV A;  4G3Q A;  5FV9 A;  3IOJ A;  2FYC B;  4LW3 A;  4BQH A;  4Y63 A;  2XWL A;  2VS4 A;  3I0E A;  3SPT A;  1O0R A;  3T7M A;  2OEG A;  1G0R A;  3ZGF A;  3USR A;  4D11 A;  1FG5 N;  1KWS A;  2I5K A;  2O1H A;  5CQL X;  2VS5 A;  1ZJ2 A;  1G3L A;  1H3M A;  2WAW A;  1VGW A;  4HO4 A;  2RJ7 A;  3SXE A;  4NAL A;  1WSZ A;  3E25 A;  1ZJP A;  1ZJ0 A;  3V0N A;  2X5Z A;  1H7H A;  2YQC A;  1G1L A;  4Y9X A;  5C1H A;  1GQ9 A;  2BO8 A;  5CQN X;  1MP5 A;  1ZJO A;  4KC2 A;  4C2S A;  3CKN A;  2Q4J A;  3BCV A;  2AES A;  2VS3 A;  5DDV A;  2V0J A;  2VFZ A;  2OEF A;  2FFU A;  3DK5 A;  3I0I X;  1LZ7 A;  5C36 A;  1TZF A;  1ZCU A;  2ICX A;  2WGZ A;  5L6S A;  5CMG X;  2WVL A;  2YES A;  4Y7F A;  1NWG B;  3OH2 A;  3U0X A;  1ZI4 A;  4KC4 A;  1XHB A;  2BO6 A;  4KXO A;  4FRD A;  2Z87 A;  1WT0 A;  4ECM A;  2WVM A;  2W0W A;  4DEC A;  5C47 A;  4CJC A;  5C3B A;  1H7Q A;  4HO3 A;  1H7T A;  4HOC A;  4B2X A;  3HL3 A;  2YQH A;  2YC3 A;  1XZ6 A;  1HM9 A;  3U2T A;  4FRQ A;  3V0O A;  1TW1 A;  4FRE A;  1GQC A;  1V83 A;  1HJJ A;  2V0L A;  2JCK A;  3PKQ A;  1JV1 A;  2D7I A;  1YP3 A;  4EEG A;  1EYR A;  4EEA A;  3V90 A;  3IOH A;  3I0F A;  2O1G A;  2OI7 A;  4B2W A;  4KNX A;  2ZU7 A;  5FUH A;  1G97 A;  1HJL A;  3CKV A;  1QG8 A;  2D0J A;  1FGG A;  1H7G A;  1I52 A;  3ZGG A;  5C4E A;  1HV9 A;  3R2W A;  1JVG A;  5CQP A;  1INJ A;  3I0H A;  2X60 A;  4L41 C;  1VH3 A;  2V0I A;  3D98 A;  5C1G A;  2X5S A;  4FQW A;  4E1K A;  5EJZ A;  1PZY B;  2P6W A;  2JCJ A;  2CU2 A;  2AH9 A;  2V0H A;  4HG6 A;  3OH3 A;  3ST8 A;  2RIZ A;  1G2V A;  1ZJ1 A;  3OH0 A;  4KNR A;  3SX7 A;  1V84 A;  2I5E A;  1H4C A;  3JTJ A;  3V0P A;  3PNN A;  3F1C A;  1FO9 A;  4CJB A;  4G3S A;  3T7N A;  1V82 A;  2W0V A;  3CKO A;  2VSI A;  2O1F A;  5CQO A;  5C48 A;  1O7Q A;  4FCE A;  1G9R A;  5BXC A;  2FYD B;  2FYB A;  2I7B A;  4KPX A;  1JV3 A;  3JUK A;  3POL A;  4NAN A;  1FWY A;  1G95 A;  1H5R B;  1MP4 A;  1W55 A;  4G3P A;  3OGZ A;  1W57 A;  4JIS A;  2Z86 A;  1ZCY A;  2X65 A;  5FYE A;  4R7P A;  2RJ8 A;  1NKH B;  1MC3 A;  3N9W A;  3USQ A;  1QGQ A;  4M2A A;  4D11 C;  1NQI B;  4AC3 A;  1G8O A;  1LVW A;  4DDZ A;  1GX4 A;  4D0Z A;  2JCL A;  1MP3 A;  3V8Y A;  2YCM A;  2RJ9 A;  3O3P A;  1FRW A;  5JQQ A;  3SXC A;  2VXL A;  3OH4 A;  4HO8 A;  3JUJ A;  4CJ8 A;  4P02 A;  1VGZ A;  5FTV A;  3U2X A;  2A8W A;  2Y4L A;  3I0K A;  4JD0 A;  3QVB A;  2JCO A;  1H5S A;  2QGI A;  2E3D A;  3U2U A;  4B42 A;  2Y4K A;  4HO2 A;  1H5S C;  2RJ0 A;  2A8U A;  2APC A;  4FRB A;  1ZI5 A;  3TQD A;  2RJ4 A;  3FWW A;  4HO6 A;  3DJ4 A;  2YQJ A;  4YS8 A;  4KQL A;  1ZIZ A;  3GUE A;  4EEO A;  3I0D A;  4CVH A;  1H5T A;  4ZDQ A;  2AM5 A;  2ZU8 A;  3RSB A;  2V0K A;  2OI6 A;  1ZDG A;  2Y4J A;  1FR9 A;  1NF5 B;  1R7X A;  1IIM A;  1LZJ A;  5C4B A;  2QH5 A;  2WEE A;  1VM8 A;  1H7F A;  1OQM B;  2XME A;  4Y7T A;  2D7R A;  5HS2 A;  4FRL A;  1VIC A;  2E8B A;  5C38 A;  1R7T A;  2XWM A;  1ZJ3 A;  3D8V A;  3RMV A;  1LZ0 A;  2GGO A;  5EJ1 A;  2Y4M A;  2RIT A;  1ON6 A;  4Y62 A;  1ZHJ A;  5C4F A;  4M28 A;  2Y6P A;  3LW6 A;  3ZLK A;  1R80 A;  4FRM A;  4GBP A;  1HM0 A;  3T7O A;  3NGW A;  4NAK A;  2AM3 A;  5C3A A;  1SS9 A;  3RMW A;  4K6R A;  2ICY A;  1H7L A;  3OC9 A;  1S4N A;  1ZCT A;  1JYL A;  2XWN A;  1LL3 A;  4Y7V A;  3KIA A;  5FU8 A;  3Q4S A;  1FR8 A;  4HO0 A;  5C3D A;  4FRH A;  1GWV A;  3E26 A;  2RJ1 A;  4EE5 A;  2UX8 A;  4D48 A;  1VPA A;  4B4B A;  5IDT A;  4Y7G A;  1GX0 A;  1LZI A;  1QWJ A;  1EZI A;  2BO7 A;  4MND A;  1H4D A;  1JVD A;  1WT3 A;  1R82 A;  3V0L A;  3TZT A;  4B4G A;  2VD4 A;  4D0T A;  3FOQ A;  1R7U A;  4AYJ A;  3ZLL A;  1TVY A;  1Z90 A;  3ZF8 A;  2QKX A;  3I0L A;  3U2W A;  2P73 A;  2FY7 A;  4ASJ A;  4J18 A;  3F1Y A;  1HM8 A;  3K8E A;  5C8R A;  4UEG A;  4KRV A;  3SXA A;  3CU0 A;  1INI A;  4XWI A;  1H5S D;  4FRP A;  4EVW A;  4FCU A;  2VSH A;  3BRK X;  1QGS A;  1VH1 A;  1FGX A;  3CKJ A;  3IOI A;  3SXG A;  3PKP A;  3SXB A;  2GGQ A;  4EE4 A;  5AJP A;  4Y7U A;  1ZI1 A;  1VGT A;  1S4O A;  4EE3 A;  5C4C A;  3U2V A;  1R7Y A;  1R81 A;  2PA4 A;  5L6V A;  3OAM A;  4B3U A;  4ASY A;  4ARW A;  5FTS A;  1GWW A;  1JYK A;  1H4E A;  3CKQ A;  1FZW A;  1H5S B;  1PZT A;  2AM4 A;  5CMH A;  3V8Z A;  3R3I A;  1O23 B;  1ON8 A;  4NAI A;  2AE7 A;  2P72 A;  2AEC A;  4EEM A;  2ZU9 A;  2RJ6 A;  3K8D A;  3OKR A;  1LL2 A;  1IIN A;  1WVC A;  4M4K A;  1TW5 A;  2OI5 A;  1H5T B;  1OMX A;  2XMH A;  4HO5 A;  4G87 A;  1VZT A; 
#chains in the Genus database with same CATH topology
 2PX7 A;  2VXM A;  3I0C A;  3SX3 A;  5J49 A;  3SXD A;  1O7O A;  1VGU A;  1FO8 A;  4FRO A;  1OMZ A;  1FOA A;  5AJO A;  4Y64 A;  1G23 A;  1NHE B;  2WE9 A;  3D5N A;  4FRA A;  4P00 A;  4Y6N A;  1NMM B;  2BO4 A;  1S4P A;  1K4V A;  5FU0 A;  2AGD A;  1GA8 A;  2RIX A;  4KT7 A;  4M2B A;  1G93 A;  4KC1 A;  3U0Y A;  2WVK A;  5IDS A;  3V0M A;  2RJ5 A;  4B5B A;  2FYA A;  4HCQ A;  2J0B A;  2Y7A A;  3SX8 A;  5CMI A;  3OH1 A;  5CMJ A;  4IRQ A;  3I0G A;  2FFV A;  2NXV A;  5DDT A;  1YP2 A;  2RIY A;  3V91 A;  4AYL A;  1VZU A;  1FXO A;  1WT1 A;  1ZI3 A;  5EIY A;  1LL0 A;  5C49 A;  1YP4 A;  1W77 A;  2YQS A;  1VZX A;  1WT2 A;  3I0J A;  3V0Q A;  1E5K A;  5IFY A;  1FXJ A;  5CQM X;  5C1L A;  5CMF X;  2DPW A;  4HO9 A;  2MZB A;  4BMA A;  4LW6 A;  1YRO B;  2YC5 A;  1ZCV A;  1R7V A;  4FIY A;  3Q7U A;  5AJN A;  5C4D A;  5I1F A;  3CGX A;  3DUV A;  4Y6U A;  3SX5 A;  4KPZ A;  1ZDF A;  1H5R A;  4MIX A;  3EE5 A;  4IRP A;  1H7E A;  4MYB A;  4AAW A;  3Q80 A;  4B4M A;  4DE7 A;  2PGY A;  2PGV A;  4G3Q A;  5FV9 A;  3IOJ A;  2FYC B;  4LW3 A;  4BQH A;  4Y63 A;  2XWL A;  2VS4 A;  3I0E A;  3SPT A;  1O0R A;  3T7M A;  2OEG A;  1G0R A;  3ZGF A;  3USR A;  4D11 A;  1FG5 N;  1KWS A;  2I5K A;  2O1H A;  5CQL X;  2VS5 A;  1ZJ2 A;  1G3L A;  1H3M A;  2WAW A;  1VGW A;  4HO4 A;  2RJ7 A;  3SXE A;  4NAL A;  1WSZ A;  3E25 A;  1ZJP A;  1ZJ0 A;  3V0N A;  2X5Z A;  1H7H A;  4FIX A;  2YQC A;  1G1L A;  4Y9X A;  5C1H A;  1GQ9 A;  2BO8 A;  5CQN X;  1MP5 A;  1ZJO A;  4KC2 A;  4C2S A;  3CKN A;  2Q4J A;  3BCV A;  2AES A;  2VS3 A;  5DDV A;  2V0J A;  2VFZ A;  2OEF A;  2FFU A;  3DK5 A;  3I0I X;  1LZ7 A;  5C36 A;  1TZF A;  1ZCU A;  2ICX A;  2WGZ A;  5L6S A;  5CMG X;  2WVL A;  2YES A;  4Y7F A;  1NWG B;  2VK9 A;  3OH2 A;  3U0X A;  1ZI4 A;  4KC4 A;  1XHB A;  2BO6 A;  4KXO A;  4FRD A;  2Z87 A;  1WT0 A;  4ECM A;  2WVM A;  2W0W A;  4DEC A;  5C47 A;  4CJC A;  5C3B A;  1H7Q A;  4HO3 A;  1H7T A;  2C0N A;  4HOC A;  4B2X A;  3HL3 A;  2YQH A;  2YC3 A;  1XZ6 A;  1HM9 A;  3U2T A;  4FRQ A;  3V0O A;  1TW1 A;  4FRE A;  1GQC A;  1V83 A;  1HJJ A;  2V0L A;  2JCK A;  3PKQ A;  1JV1 A;  2D7I A;  1YP3 A;  4EEG A;  1EYR A;  4EEA A;  3V90 A;  3IOH A;  3I0F A;  2O1G A;  2OI7 A;  4B2W A;  4KNX A;  2ZU7 A;  5FUH A;  1G97 A;  1HJL A;  3CKV A;  1QG8 A;  2D0J A;  1FGG A;  1H7G A;  1I52 A;  3ZGG A;  5C4E A;  1HV9 A;  3R2W A;  1JVG A;  5CQP A;  1INJ A;  3I0H A;  2X60 A;  4L41 C;  1VH3 A;  2V0I A;  3D98 A;  5C1G A;  2X5S A;  4FQW A;  4E1K A;  5EJZ A;  1PZY B;  2P6W A;  2JCJ A;  2CU2 A;  2AH9 A;  2V0H A;  4HG6 A;  3OH3 A;  3ST8 A;  2RIZ A;  1G2V A;  1ZJ1 A;  3OH0 A;  4KNR A;  3SX7 A;  1V84 A;  2I5E A;  1H4C A;  5D92 A;  3JTJ A;  3V0P A;  3PNN A;  3F1C A;  1FO9 A;  4CJB A;  4G3S A;  3T7N A;  1V82 A;  2W0V A;  3CKO A;  2VSI A;  2O1F A;  5CQO A;  5C48 A;  1O7Q A;  4FCE A;  1G9R A;  5BXC A;  2FYD B;  2FYB A;  2I7B A;  4KPX A;  1JV3 A;  3JUK A;  3POL A;  4NAN A;  1FWY A;  1G95 A;  1H5R B;  1MP4 A;  1W55 A;  4G3P A;  3OGZ A;  1W57 A;  4JIS A;  2Z86 A;  1ZCY A;  2X65 A;  5FYE A;  4R7P A;  2RJ8 A;  1NKH B;  1MC3 A;  3N9W A;  3USQ A;  1QGQ A;  4M2A A;  4D11 C;  1NQI B;  4AC3 A;  1G8O A;  1LVW A;  4DDZ A;  1GX4 A;  4D0Z A;  2JCL A;  1MP3 A;  3V8Y A;  2YCM A;  2RJ9 A;  3O3P A;  1FRW A;  5JQQ A;  3SXC A;  2VXL A;  3OH4 A;  4HO8 A;  3JUJ A;  4CJ8 A;  4P02 A;  1VGZ A;  5FTV A;  3U2X A;  2A8W A;  2Y4L A;  3I0K A;  4JD0 A;  3QVB A;  2JCO A;  1H5S A;  2QGI A;  2E3D A;  3U2U A;  4B42 A;  2Y4K A;  4HO2 A;  1H5S C;  2RJ0 A;  2A8U A;  2APC A;  4FRB A;  1ZI5 A;  3TQD A;  2RJ4 A;  3FWW A;  4HO6 A;  3DJ4 A;  2YQJ A;  4YS8 A;  4KQL A;  1ZIZ A;  3GUE A;  4EEO A;  4Q7C A;  3I0D A;  4CVH A;  1H5T A;  4ZDQ A;  2AM5 A;  2ZU8 A;  3RSB A;  2V0K A;  2OI6 A;  1ZDG A;  2Y4J A;  1FR9 A;  1NF5 B;  1R7X A;  1IIM A;  1LZJ A;  5C4B A;  2QH5 A;  2WEE A;  1VM8 A;  1H7F A;  1OQM B;  2XME A;  4Y7T A;  2D7R A;  5HS2 A;  4FRL A;  1VIC A;  2E8B A;  5C38 A;  1R7T A;  2XWM A;  1ZJ3 A;  3D8V A;  3RMV A;  1LZ0 A;  2GGO A;  5EJ1 A;  2Y4M A;  2RIT A;  1ON6 A;  4Y62 A;  1ZHJ A;  5C4F A;  4M28 A;  2Y6P A;  3LW6 A;  3ZLK A;  1R80 A;  4FRM A;  4GBP A;  1HM0 A;  3T7O A;  3NGW A;  4NAK A;  2AM3 A;  5C3A A;  4O6M A;  1SS9 A;  3RMW A;  4K6R A;  2ICY A;  1H7L A;  3OC9 A;  1S4N A;  1ZCT A;  1JYL A;  2XWN A;  1LL3 A;  4Y7V A;  3KIA A;  5FU8 A;  3Q4S A;  1FR8 A;  5D91 A;  4HO0 A;  5C3D A;  4FRH A;  1GWV A;  3E26 A;  2RJ1 A;  4EE5 A;  2UX8 A;  4D48 A;  1VPA A;  4B4B A;  5IDT A;  4Y7G A;  1GX0 A;  1LZI A;  1QWJ A;  1EZI A;  2BO7 A;  4MND A;  1H4D A;  1JVD A;  1WT3 A;  1R82 A;  3V0L A;  4O6N A;  3TZT A;  4B4G A;  2VD4 A;  4D0T A;  3FOQ A;  1R7U A;  4AYJ A;  3ZLL A;  1TVY A;  1Z90 A;  3ZF8 A;  2QKX A;  3I0L A;  3U2W A;  2P73 A;  2FY7 A;  4ASJ A;  4J18 A;  3F1Y A;  1HM8 A;  3K8E A;  5C8R A;  4UEG A;  4KRV A;  3SXA A;  3CU0 A;  1INI A;  4XWI A;  1H5S D;  4FRP A;  4EVW A;  4FCU A;  2VSH A;  3BRK X;  1QGS A;  1VH1 A;  1FGX A;  3CKJ A;  3IOI A;  3SXG A;  3PKP A;  3SXB A;  2GGQ A;  4EE4 A;  5AJP A;  4Y7U A;  1ZI1 A;  1VGT A;  1S4O A;  4EE3 A;  5C4C A;  3U2V A;  1R7Y A;  1R81 A;  2PA4 A;  5L6V A;  3OAM A;  4B3U A;  4ASY A;  4ARW A;  5FTS A;  1GWW A;  1JYK A;  1H4E A;  3CKQ A;  1FZW A;  1H5S B;  1PZT A;  2AM4 A;  5CMH A;  3V8Z A;  3R3I A;  1O23 B;  1ON8 A;  4NAI A;  2AE7 A;  2P72 A;  2AEC A;  4EEM A;  2ZU9 A;  2RJ6 A;  3K8D A;  3OKR A;  1LL2 A;  1IIN A;  1WVC A;  4M4K A;  1TW5 A;  2OI5 A;  1H5T B;  1OMX A;  2XMH A;  4HO5 A;  4G87 A;  1VZT A;  2J0A A; 
#chains in the Genus database with same CATH homology
 2PX7 A;  2VXM A;  3I0C A;  3SX3 A;  5J49 A;  3SXD A;  1O7O A;  1VGU A;  1FO8 A;  4FRO A;  1OMZ A;  1FOA A;  5AJO A;  4Y64 A;  1G23 A;  1NHE B;  2WE9 A;  3D5N A;  4FRA A;  4P00 A;  4Y6N A;  1NMM B;  2BO4 A;  1S4P A;  1K4V A;  5FU0 A;  2AGD A;  1GA8 A;  2RIX A;  4KT7 A;  4M2B A;  1G93 A;  4KC1 A;  3U0Y A;  2WVK A;  5IDS A;  3V0M A;  2RJ5 A;  4B5B A;  2FYA A;  4HCQ A;  2J0B A;  2Y7A A;  3SX8 A;  5CMI A;  3OH1 A;  5CMJ A;  4IRQ A;  3I0G A;  2FFV A;  2NXV A;  5DDT A;  1YP2 A;  2RIY A;  3V91 A;  4AYL A;  1VZU A;  1FXO A;  1WT1 A;  1ZI3 A;  5EIY A;  1LL0 A;  5C49 A;  1YP4 A;  1W77 A;  2YQS A;  1VZX A;  1WT2 A;  3I0J A;  3V0Q A;  1E5K A;  5IFY A;  1FXJ A;  5CQM X;  5C1L A;  5CMF X;  2DPW A;  4HO9 A;  2MZB A;  4BMA A;  4LW6 A;  1YRO B;  2YC5 A;  1ZCV A;  1R7V A;  4FIY A;  3Q7U A;  5AJN A;  5C4D A;  5I1F A;  3CGX A;  3DUV A;  4Y6U A;  3SX5 A;  4KPZ A;  1ZDF A;  1H5R A;  4MIX A;  3EE5 A;  4IRP A;  1H7E A;  4MYB A;  4AAW A;  3Q80 A;  4B4M A;  4DE7 A;  2PGY A;  2PGV A;  4G3Q A;  5FV9 A;  3IOJ A;  2FYC B;  4LW3 A;  4BQH A;  4Y63 A;  2XWL A;  2VS4 A;  3I0E A;  3SPT A;  1O0R A;  3T7M A;  2OEG A;  1G0R A;  3ZGF A;  3USR A;  4D11 A;  1FG5 N;  1KWS A;  2I5K A;  2O1H A;  5CQL X;  2VS5 A;  1ZJ2 A;  1G3L A;  1H3M A;  2WAW A;  1VGW A;  4HO4 A;  2RJ7 A;  3SXE A;  4NAL A;  1WSZ A;  3E25 A;  1ZJP A;  1ZJ0 A;  3V0N A;  2X5Z A;  1H7H A;  4FIX A;  2YQC A;  1G1L A;  4Y9X A;  5C1H A;  1GQ9 A;  2BO8 A;  5CQN X;  1MP5 A;  1ZJO A;  4KC2 A;  4C2S A;  3CKN A;  2Q4J A;  3BCV A;  2AES A;  2VS3 A;  5DDV A;  2V0J A;  2VFZ A;  2OEF A;  2FFU A;  3DK5 A;  3I0I X;  1LZ7 A;  5C36 A;  1TZF A;  1ZCU A;  2ICX A;  2WGZ A;  5L6S A;  5CMG X;  2WVL A;  2YES A;  4Y7F A;  1NWG B;  2VK9 A;  3OH2 A;  3U0X A;  1ZI4 A;  4KC4 A;  1XHB A;  2BO6 A;  4KXO A;  4FRD A;  2Z87 A;  1WT0 A;  4ECM A;  2WVM A;  2W0W A;  4DEC A;  5C47 A;  4CJC A;  5C3B A;  1H7Q A;  4HO3 A;  1H7T A;  2C0N A;  4HOC A;  4B2X A;  3HL3 A;  2YQH A;  2YC3 A;  1XZ6 A;  1HM9 A;  3U2T A;  4FRQ A;  3V0O A;  1TW1 A;  4FRE A;  1GQC A;  1V83 A;  1HJJ A;  2V0L A;  2JCK A;  3PKQ A;  1JV1 A;  2D7I A;  1YP3 A;  4EEG A;  1EYR A;  4EEA A;  3V90 A;  3IOH A;  3I0F A;  2O1G A;  2OI7 A;  4B2W A;  4KNX A;  2ZU7 A;  5FUH A;  1G97 A;  1HJL A;  3CKV A;  1QG8 A;  2D0J A;  1FGG A;  1H7G A;  1I52 A;  3ZGG A;  5C4E A;  1HV9 A;  3R2W A;  1JVG A;  5CQP A;  1INJ A;  3I0H A;  2X60 A;  4L41 C;  1VH3 A;  2V0I A;  3D98 A;  5C1G A;  2X5S A;  4FQW A;  4E1K A;  5EJZ A;  1PZY B;  2P6W A;  2JCJ A;  2CU2 A;  2AH9 A;  2V0H A;  4HG6 A;  3OH3 A;  3ST8 A;  2RIZ A;  1G2V A;  1ZJ1 A;  3OH0 A;  4KNR A;  3SX7 A;  1V84 A;  2I5E A;  1H4C A;  5D92 A;  3JTJ A;  3V0P A;  3PNN A;  3F1C A;  1FO9 A;  4CJB A;  4G3S A;  3T7N A;  1V82 A;  2W0V A;  3CKO A;  2VSI A;  2O1F A;  5CQO A;  5C48 A;  1O7Q A;  4FCE A;  1G9R A;  5BXC A;  2FYD B;  2FYB A;  2I7B A;  4KPX A;  1JV3 A;  3JUK A;  3POL A;  4NAN A;  1FWY A;  1G95 A;  1H5R B;  1MP4 A;  1W55 A;  4G3P A;  3OGZ A;  1W57 A;  4JIS A;  2Z86 A;  1ZCY A;  2X65 A;  5FYE A;  4R7P A;  2RJ8 A;  1NKH B;  1MC3 A;  3N9W A;  3USQ A;  1QGQ A;  4M2A A;  4D11 C;  1NQI B;  4AC3 A;  1G8O A;  1LVW A;  4DDZ A;  1GX4 A;  4D0Z A;  2JCL A;  1MP3 A;  3V8Y A;  2YCM A;  2RJ9 A;  3O3P A;  1FRW A;  5JQQ A;  3SXC A;  2VXL A;  3OH4 A;  4HO8 A;  3JUJ A;  4CJ8 A;  4P02 A;  1VGZ A;  5FTV A;  3U2X A;  2A8W A;  2Y4L A;  3I0K A;  4JD0 A;  3QVB A;  2JCO A;  1H5S A;  2QGI A;  2E3D A;  3U2U A;  4B42 A;  2Y4K A;  4HO2 A;  1H5S C;  2RJ0 A;  2A8U A;  2APC A;  4FRB A;  1ZI5 A;  3TQD A;  2RJ4 A;  3FWW A;  4HO6 A;  3DJ4 A;  2YQJ A;  4YS8 A;  4KQL A;  1ZIZ A;  3GUE A;  4EEO A;  4Q7C A;  3I0D A;  4CVH A;  1H5T A;  4ZDQ A;  2AM5 A;  2ZU8 A;  3RSB A;  2V0K A;  2OI6 A;  1ZDG A;  2Y4J A;  1FR9 A;  1NF5 B;  1R7X A;  1IIM A;  1LZJ A;  5C4B A;  2QH5 A;  2WEE A;  1VM8 A;  1H7F A;  1OQM B;  2XME A;  4Y7T A;  2D7R A;  5HS2 A;  4FRL A;  1VIC A;  2E8B A;  5C38 A;  1R7T A;  2XWM A;  1ZJ3 A;  3D8V A;  3RMV A;  1LZ0 A;  2GGO A;  5EJ1 A;  2Y4M A;  2RIT A;  1ON6 A;  4Y62 A;  1ZHJ A;  5C4F A;  4M28 A;  2Y6P A;  3LW6 A;  3ZLK A;  1R80 A;  4FRM A;  4GBP A;  1HM0 A;  3T7O A;  3NGW A;  4NAK A;  2AM3 A;  5C3A A;  4O6M A;  1SS9 A;  3RMW A;  4K6R A;  2ICY A;  1H7L A;  3OC9 A;  1S4N A;  1ZCT A;  1JYL A;  2XWN A;  1LL3 A;  4Y7V A;  3KIA A;  5FU8 A;  3Q4S A;  1FR8 A;  5D91 A;  4HO0 A;  5C3D A;  4FRH A;  1GWV A;  3E26 A;  2RJ1 A;  4EE5 A;  2UX8 A;  4D48 A;  1VPA A;  4B4B A;  5IDT A;  4Y7G A;  1GX0 A;  1LZI A;  1QWJ A;  1EZI A;  2BO7 A;  4MND A;  1H4D A;  1JVD A;  1WT3 A;  1R82 A;  3V0L A;  4O6N A;  3TZT A;  4B4G A;  2VD4 A;  4D0T A;  3FOQ A;  1R7U A;  4AYJ A;  3ZLL A;  1TVY A;  1Z90 A;  3ZF8 A;  2QKX A;  3I0L A;  3U2W A;  2P73 A;  2FY7 A;  4ASJ A;  4J18 A;  3F1Y A;  1HM8 A;  3K8E A;  5C8R A;  4UEG A;  4KRV A;  3SXA A;  3CU0 A;  1INI A;  4XWI A;  1H5S D;  4FRP A;  4EVW A;  4FCU A;  2VSH A;  3BRK X;  1QGS A;  1VH1 A;  1FGX A;  3CKJ A;  3IOI A;  3SXG A;  3PKP A;  3SXB A;  2GGQ A;  4EE4 A;  5AJP A;  4Y7U A;  1ZI1 A;  1VGT A;  1S4O A;  4EE3 A;  5C4C A;  3U2V A;  1R7Y A;  1R81 A;  2PA4 A;  5L6V A;  3OAM A;  4B3U A;  4ASY A;  4ARW A;  5FTS A;  1GWW A;  1JYK A;  1H4E A;  3CKQ A;  1FZW A;  1H5S B;  1PZT A;  2AM4 A;  5CMH A;  3V8Z A;  3R3I A;  1O23 B;  1ON8 A;  4NAI A;  2AE7 A;  2P72 A;  2AEC A;  4EEM A;  2ZU9 A;  2RJ6 A;  3K8D A;  3OKR A;  1LL2 A;  1IIN A;  1WVC A;  4M4K A;  1TW5 A;  2OI5 A;  1H5T B;  1OMX A;  2XMH A;  4HO5 A;  4G87 A;  1VZT A;  2J0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...