2X5SA

Crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
333
Chain Sequence
VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDLGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNOSE-1-PHOSPHATE GUANYLYLTRANSFERASE
publication title Structural Insights Into the Catalytic Mechanism of Bacterial Guanosine-Diphospho-D-Mannose Pyrophosphorylase and its Regulation by Divalent Ions.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 107
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.7.7.13: Mannose-1-phosphate guanylyltransferase.
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2x5sA00
4NANA 1VZXA 4LW3A 2ZU9A 4JD0A 2YQCA 1LZ7A 5JQQA 1FRWA 2P72A 1ZI1A 1VGUA 2X60A 2PGVA 5EIYA 3OH2A 3CKVA 2Z87A 1EZIA 3CGXA 4EEAA 3QVBA 3CKJA 4B5BA 4Y64A 4KC4A 1ZI3A 2AM4A 2XWMA 3D5NA 2VFZA 1FXJA 4IRQA 1H5RB 2GGQA 3IOJA 3TZTA 5BXCA 5C38A 4B4BA 4CVHA 2ZU8A 4FRBA 4AAWA 1R7YA 4G3QA 1FR8A 4D48A 1GA8A 2OI6A 1FGXA 3BCVA 4HG6A 1H7LA 1H4DA 2XWLA 3KIAA 3CKOA 1ZJ0A 4FQWA 4HO4A 4B3UA 1ON8A 2X65A 1E5KA 3K8EA 5IDTA 1FO8A 3I0DA 3I0HA 1VH1A 3D98A 5CQPA 2RIYA 1G2VA 2A8UA 4ZDQA 3V0MA 5C47A 1OMZA 1WSZA 4FRHA 2DPWA 1FG5N 4IRPA 4HOCA 4K6RA 2RJ8A 4AYLA 4P00A 4FRMA 5C4DA 2VXLA 5CQOA 3SXBA 4M4KA 4Y62A 5C8RA 2JCOA 1VZTA 2FFUA 1HJLA 1ON6A 1H5SB 1H5TB 1NMMB 4Y7TA 1IIMA 3ZGFA 5FYEA 1XHBA 3DUVA 2AM3A 3F1YA 4B4GA 3O3PA 4FRQA 1LL3A 5FU8A 2FY7A 1H7EA 3SXEA 2XWNA 2I7BA 4FRPA 1VPAA 2WGZA 5FUHA 3U2XA 4AYJA 4G87A 1R80A 4KRVA 4KT7A 1ZJPA 2PGYA 3I0LA 4DECA 1QGSA 1WT3A 3CU0A 3U0YA 4B2XA 3PNNA 1QG8A 4UEGA 5CQLX 1GX0A 2E3DA 2RJ7A 4HO0A 1FR9A 2V0JA 5CMFX 4FRDA 3CKQA 3Q80A 4FRAA 4KPXA 2RJ4A 2RITA 3DJ4A 4E1KA 4Y63A 1VGTA 1MC3A 1H7GA 1H4EA 2WE9A 2WEEA 4HO9A 1TVYA 3HL3A 3I0JA 4HO5A 3U2TA 2YC3A 4Y7VA 2ICXA 2O1GA 4G3SA 5FU0A 1ZHJA 4JISA 1SS9A 2PA4A 1PZYB 3JUKA 4CJBA 1ZJ3A 3TQDA 5J49A 1V84A 3T7NA 2BO6A 3Q4SA 5IDSA 1ZI5A 3T7OA 1MP3A 4BQHA 3SX8A 2O1HA 3T7MA 4FREA 2WVMA 3SPTA 5C1HA 3OH3A 4ARWA 3K8DA 5L6SA 3SX7A 1WT2A 4HCQA 1G8OA 1R81A 2PX7A 5C1LA 4ECMA 5EJ1A 1ZIZA 1TW5A 3R3IA 3CKNA 3PKQA 2JCLA 5CQMX 2P73A 5C1GA 2O1FA 5FV9A 1ZI4A 1ZCUA 1O7QA 1TZFA 2V0IA 2V0HA 4D0ZA 1JYLA 1FO9A 5DDTA 5CMGX 5CMHA 1ZJ1A 2OI7A 3ZGGA 4M2AA 3LW6A 2I5KA 4R7PA 3V8YA 1LZIA 2QKXA 2VS3A 1VGWA 2RJ0A 1S4NA 2QGIA 2YQJA 2AECA 2VS5A 4J18A 4ASJA 3RMWA 2FYBA 4C2SA 1VH3A 5C36A 2Y7AA 2RIXA 2AGDA 3I0FA 4DE7A 3V8ZA 2ZU7A 1W57A 2V0KA 1NQIB 5C49A 1V82A 2JCJA 2AM5A 1H7TA 2Y4KA 3I0CA 2Q4JA 4KNRA 1NF5B 1H7HA 4EE3A 2X5ZA 1LL0A 1G23A 3GUEA 1JVDA 1JYKA 4EE4A 2YESA 3OKRA 2XMEA 5AJNA 1WT1A 4NALA 2D7IA 3V0PA 5C48A 3ZLLA 5DDVA 4D0TA 1O7OA 1FWYA 1G3LA 2Z86A 1H5SD 1LVWA 4KC1A 3IOHA 4EEOA 2VS4A 5EJZA 1H7QA 3U2WA 1WVCA 1G1LA 1HM9A 2FYDB 4ASYA 1QWJA 3JTJA 1ZCTA 2VD4A 3F1CA 1KWSA 4XWIA 5AJPA 1OMXA 1HM8A 4KXOA 3EE5A 4Y7GA 2WVKA 3SX3A 5C3DA 3I0KA 2A8WA 2E8BA 3SX5A 2D0JA 2RIZA 2RJ9A 1PZTA 1FZWA 4L41C 3R2WA 4KPZA 1TW1A 1R82A 4M28A 3V0OA 1VICA 1G9RA 1H7FA 4EVWA 3SXAA 4Y6NA 3OGZA 5C4BA 3OAMA 1INIA 1S4OA 4MNDA 1QGQA 3U2VA 3D8VA 3N9WA 5CMJA 2FYAA 2AH9A 4Y6UA 5HS2A 4D11C 2AESA 2FFVA 4CJCA 2W0VA 2V0LA 5C4EA 2OEFA 2Y4MA 3ZF8A 2BO7A 3POLA 2WAWA 2W0WA 1FGGA 1H5RA 2X5SA 5IFYA 1G97A 3DK5A 1H5SC 1FOAA 1GWVA 1I52A 1W55A 2NXVA 2ICYA 4FRLA 1EYRA 1H4CA 2YQHA 3OH1A 4B2WA 4KQLA 3U0XA 2VXMA 1ZDGA 2UX8A 5C3BA 3E26A 1W77A 1GX4A 2OI5A 1R7XA 1YP4A 4Y9XA 2Y6PA 4M2BA 1WT0A 1INJA 5AJOA 2VSIA 3USQA 4BMAA 2OEGA 1R7UA 2AE7A 5CQNX 1G95A 1NKHB 1LL2A 4NAIA 4HO6A 5C4FA 1YP2A 2I5EA 1GWWA 4G3PA 2FYCB 1IINA 2YQSA 1YP3A 2P6WA 3SXGA 2RJ1A 4HO8A 2RJ6A 4D11A 1G0RA 3V90A 4YS8A 3OH0A 1GQCA 2YC5A 3RMVA 4FCEA 1NWGB 5CMIA 1ZCVA 1ZDFA 1ZCYA 3JUJA 1H5SA 1H5TA 1NHEB 1OQMB 2APCA 5L6VA 2QH5A 4CJ8A 2JCKA 1R7VA 1LZ0A 1LZJA 4P02A 4HO2A 4HO3A 4B4MA 4KC2A 3OC9A 1Z90A 1O23B 2RJ5A 2CU2A 2Y4JA 3NGWA 1K4VA 3I0EA 1JV3A 4EEGA 1R7TA 4KNXA 4FCUA 2MZBA 1FXOA 4EE5A 3V0LA 2GGOA 1G93A 3I0IX 5FTVA 4AC3A 4B42A 3OH4A 2VSHA 3PKPA 1VM8A 1HJJA 1VGZA 3Q7UA 3SXDA 4LW6A 3U2UA 3SXCA 1YROB 4NAKA 3ST8A 4Y7UA 2BO8A 3RSBA 3FOQA 2WVLA 3ZLKA 4FROA 2XMHA 4GBPA 1HV9A 3BRKX 1MP5A 4Y7FA 3IOIA 5C4CA 5I1FA 1H3MA 2YCMA 1O0RA 1XZ6A 1ZJ2A 3FWWA 3I0GA 1S4PA 5C3AA 4DDZA 1JV1A 3V91A 1GQ9A 2Y4LA 3E25A 3V0QA 1JVGA 1VZUA 4MYBA 2D7RA 5FTSA 1ZJOA 1V83A 1HM0A 3V0NA 2BO4A 4EEMA 3USRA 1MP4A
chains in the Genus database with same CATH superfamily
4NANA 1VZXA 4LW3A 2ZU9A 4JD0A 2YQCA 1LZ7A 5JQQA 1FRWA 2P72A 1ZI1A 1VGUA 2X60A 2PGVA 5EIYA 3OH2A 3CKVA 2Z87A 1EZIA 3CGXA 4EEAA 3QVBA 3CKJA 4B5BA 4Y64A 4KC4A 1ZI3A 2AM4A 2XWMA 3D5NA 2VFZA 1FXJA 4IRQA 1H5RB 2GGQA 3IOJA 3TZTA 5BXCA 5C38A 4B4BA 4CVHA 2ZU8A 4FRBA 4AAWA 1R7YA 4G3QA 1FR8A 4D48A 1GA8A 2OI6A 1FGXA 3BCVA 4HG6A 1H7LA 1H4DA 2XWLA 3KIAA 3CKOA 2VK9A 1ZJ0A 4FQWA 4HO4A 4B3UA 1ON8A 2X65A 1E5KA 3K8EA 5IDTA 1FO8A 3I0DA 5D91A 3I0HA 1VH1A 3D98A 5CQPA 2RIYA 1G2VA 2A8UA 4ZDQA 3V0MA 5C47A 1OMZA 1WSZA 4FRHA 2DPWA 1FG5N 4IRPA 4HOCA 4K6RA 2RJ8A 4AYLA 4P00A 4FRMA 5C4DA 2VXLA 5CQOA 3SXBA 4M4KA 4Y62A 5C8RA 2JCOA 1VZTA 2FFUA 1HJLA 1ON6A 1H5SB 1H5TB 1NMMB 4Y7TA 1IIMA 3ZGFA 5FYEA 1XHBA 3DUVA 2AM3A 3F1YA 4B4GA 3O3PA 4FRQA 1LL3A 5FU8A 2FY7A 1H7EA 3SXEA 2XWNA 2I7BA 4FRPA 1VPAA 2WGZA 5FUHA 3U2XA 4AYJA 4G87A 4O6MA 1R80A 4KRVA 4KT7A 1ZJPA 2PGYA 3I0LA 4DECA 1QGSA 1WT3A 3CU0A 3U0YA 4B2XA 2J0AA 3PNNA 1QG8A 4UEGA 5CQLX 1GX0A 2E3DA 2RJ7A 4HO0A 1FR9A 2V0JA 5CMFX 4FRDA 3CKQA 3Q80A 4FRAA 4KPXA 2RJ4A 2RITA 3DJ4A 4E1KA 4Y63A 1VGTA 1MC3A 1H7GA 1H4EA 2WE9A 2WEEA 4HO9A 1TVYA 3HL3A 3I0JA 4HO5A 3U2TA 2YC3A 4Y7VA 4O6NA 2ICXA 2O1GA 4G3SA 5FU0A 1ZHJA 4JISA 1SS9A 2PA4A 1PZYB 3JUKA 4CJBA 1ZJ3A 3TQDA 5J49A 1V84A 3T7NA 2BO6A 3Q4SA 5IDSA 4FIXA 1ZI5A 3T7OA 1MP3A 4BQHA 3SX8A 2O1HA 3T7MA 4FREA 2WVMA 3SPTA 5C1HA 3OH3A 4ARWA 3K8DA 5L6SA 3SX7A 1WT2A 4HCQA 1G8OA 1R81A 4MIXA 2PX7A 5C1LA 4ECMA 5EJ1A 1ZIZA 1TW5A 3R3IA 3CKNA 3PKQA 2JCLA 5CQMX 2P73A 5C1GA 2O1FA 5FV9A 1ZI4A 1ZCUA 1O7QA 1TZFA 2V0IA 2V0HA 4D0ZA 1JYLA 1FO9A 5DDTA 5CMGX 5CMHA 1ZJ1A 2OI7A 3ZGGA 4M2AA 3LW6A 2I5KA 2C0NA 4R7PA 3V8YA 1LZIA 2QKXA 2VS3A 1VGWA 2RJ0A 1S4NA 2QGIA 2YQJA 2AECA 2VS5A 4J18A 4ASJA 3RMWA 2FYBA 4C2SA 1VH3A 5C36A 2Y7AA 2RIXA 2AGDA 3I0FA 4DE7A 3V8ZA 2ZU7A 1W57A 2V0KA 1NQIB 5C49A 1V82A 2JCJA 2AM5A 1H7TA 2Y4KA 3I0CA 2Q4JA 4KNRA 1NF5B 1H7HA 4EE3A 2X5ZA 1LL0A 1G23A 3GUEA 1JVDA 1JYKA 4EE4A 2YESA 3OKRA 2XMEA 5AJNA 1WT1A 4NALA 2D7IA 3V0PA 5C48A 3ZLLA 5DDVA 4D0TA 1O7OA 1FWYA 1G3LA 2Z86A 1H5SD 1LVWA 4KC1A 3IOHA 4EEOA 2VS4A 5EJZA 1H7QA 3U2WA 1WVCA 1G1LA 1HM9A 2FYDB 4ASYA 1QWJA 3JTJA 1ZCTA 2VD4A 3F1CA 1KWSA 4XWIA 5AJPA 1OMXA 1HM8A 4KXOA 3EE5A 4Y7GA 2WVKA 3SX3A 5C3DA 3I0KA 2A8WA 2E8BA 3SX5A 2D0JA 2RIZA 2RJ9A 1PZTA 1FZWA 4L41C 3R2WA 4KPZA 1TW1A 1R82A 4M28A 3V0OA 1VICA 1G9RA 1H7FA 4EVWA 3SXAA 4Y6NA 3OGZA 5C4BA 3OAMA 1INIA 1S4OA 4MNDA 1QGQA 3U2VA 3D8VA 3N9WA 5CMJA 2FYAA 2AH9A 4Y6UA 5HS2A 4D11C 2AESA 2FFVA 4CJCA 2W0VA 2V0LA 5C4EA 2OEFA 2Y4MA 3ZF8A 2BO7A 3POLA 4FIYA 2WAWA 2W0WA 1FGGA 1H5RA 2X5SA 5IFYA 1G97A 3DK5A 1H5SC 1FOAA 1GWVA 1I52A 1W55A 2NXVA 2ICYA 4FRLA 1EYRA 1H4CA 2YQHA 3OH1A 4B2WA 4KQLA 3U0XA 2VXMA 1ZDGA 2UX8A 5C3BA 3E26A 1W77A 1GX4A 2OI5A 1R7XA 1YP4A 4Y9XA 2Y6PA 4M2BA 1WT0A 1INJA 5AJOA 2VSIA 3USQA 4BMAA 2OEGA 1R7UA 2AE7A 5CQNX 1G95A 1NKHB 1LL2A 4NAIA 4HO6A 5C4FA 1YP2A 2I5EA 1GWWA 4G3PA 2FYCB 1IINA 2YQSA 1YP3A 2J0BA 2P6WA 3SXGA 2RJ1A 4HO8A 2RJ6A 4D11A 1G0RA 3V90A 4YS8A 3OH0A 1GQCA 2YC5A 3RMVA 4FCEA 1NWGB 5CMIA 1ZCVA 1ZDFA 1ZCYA 3JUJA 1H5SA 1H5TA 1NHEB 1OQMB 2APCA 5L6VA 2QH5A 4CJ8A 2JCKA 1R7VA 1LZ0A 1LZJA 4P02A 4HO2A 4HO3A 4B4MA 4KC2A 3OC9A 1Z90A 1O23B 2RJ5A 2CU2A 2Y4JA 3NGWA 5D92A 1K4VA 3I0EA 1JV3A 4EEGA 1R7TA 4KNXA 4FCUA 2MZBA 1FXOA 4EE5A 3V0LA 2GGOA 1G93A 3I0IX 5FTVA 4AC3A 4B42A 3OH4A 2VSHA 3PKPA 1VM8A 1HJJA 1VGZA 3Q7UA 3SXDA 4LW6A 3U2UA 3SXCA 1YROB 4NAKA 3ST8A 4Y7UA 2BO8A 3RSBA 3FOQA 2WVLA 3ZLKA 4FROA 2XMHA 4GBPA 1HV9A 3BRKX 1MP5A 4Y7FA 3IOIA 5C4CA 5I1FA 1H3MA 2YCMA 1O0RA 4Q7CA 1XZ6A 1ZJ2A 3FWWA 3I0GA 1S4PA 5C3AA 4DDZA 1JV1A 3V91A 1GQ9A 2Y4LA 3E25A 3V0QA 1JVGA 1VZUA 4MYBA 2D7RA 5FTSA 1ZJOA 1V83A 1HM0A 3V0NA 2BO4A 4EEMA 3USRA 1MP4A
chains in the Genus database with same CATH topology
4NANA 1VZXA 4LW3A 2ZU9A 4JD0A 2YQCA 1LZ7A 5JQQA 1FRWA 2P72A 1ZI1A 1VGUA 2X60A 2PGVA 5EIYA 3OH2A 3CKVA 2Z87A 1EZIA 3CGXA 4EEAA 3QVBA 3CKJA 4B5BA 4Y64A 4KC4A 1ZI3A 2AM4A 2XWMA 3D5NA 2VFZA 1FXJA 4IRQA 1H5RB 2GGQA 3IOJA 3TZTA 5BXCA 5C38A 4B4BA 4CVHA 2ZU8A 4FRBA 4AAWA 1R7YA 4G3QA 1FR8A 4D48A 1GA8A 2OI6A 1FGXA 3BCVA 4HG6A 1H7LA 1H4DA 2XWLA 3KIAA 3CKOA 2VK9A 1ZJ0A 4FQWA 4HO4A 4B3UA 1ON8A 2X65A 1E5KA 3K8EA 5IDTA 1FO8A 3I0DA 5D91A 3I0HA 1VH1A 3D98A 5CQPA 2RIYA 1G2VA 2A8UA 4ZDQA 3V0MA 5C47A 1OMZA 1WSZA 4FRHA 2DPWA 1FG5N 4IRPA 4HOCA 4K6RA 2RJ8A 4AYLA 4P00A 4FRMA 5C4DA 2VXLA 5CQOA 3SXBA 4M4KA 4Y62A 5C8RA 2JCOA 1VZTA 2FFUA 1HJLA 1ON6A 1H5SB 1H5TB 1NMMB 4Y7TA 1IIMA 3ZGFA 5FYEA 1XHBA 3DUVA 2AM3A 3F1YA 4B4GA 3O3PA 4FRQA 1LL3A 5FU8A 2FY7A 1H7EA 3SXEA 2XWNA 2I7BA 4FRPA 1VPAA 2WGZA 5FUHA 3U2XA 4AYJA 4G87A 4O6MA 1R80A 4KRVA 4KT7A 1ZJPA 2PGYA 3I0LA 4DECA 1QGSA 1WT3A 3CU0A 3U0YA 4B2XA 2J0AA 3PNNA 1QG8A 4UEGA 5CQLX 1GX0A 2E3DA 2RJ7A 4HO0A 1FR9A 2V0JA 5CMFX 4FRDA 3CKQA 3Q80A 4FRAA 4KPXA 2RJ4A 2RITA 3DJ4A 4E1KA 4Y63A 1VGTA 1MC3A 1H7GA 1H4EA 2WE9A 2WEEA 4HO9A 1TVYA 3HL3A 3I0JA 4HO5A 3U2TA 2YC3A 4Y7VA 4O6NA 2ICXA 2O1GA 4G3SA 5FU0A 1ZHJA 4JISA 1SS9A 2PA4A 1PZYB 3JUKA 4CJBA 1ZJ3A 3TQDA 5J49A 1V84A 3T7NA 2BO6A 3Q4SA 5IDSA 4FIXA 1ZI5A 3T7OA 1MP3A 4BQHA 3SX8A 2O1HA 3T7MA 4FREA 2WVMA 3SPTA 5C1HA 3OH3A 4ARWA 3K8DA 5L6SA 3SX7A 1WT2A 4HCQA 1G8OA 1R81A 4MIXA 2PX7A 5C1LA 4ECMA 5EJ1A 1ZIZA 1TW5A 3R3IA 3CKNA 3PKQA 2JCLA 5CQMX 2P73A 5C1GA 2O1FA 5FV9A 1ZI4A 1ZCUA 1O7QA 1TZFA 2V0IA 2V0HA 4D0ZA 1JYLA 1FO9A 5DDTA 5CMGX 5CMHA 1ZJ1A 2OI7A 3ZGGA 4M2AA 3LW6A 2I5KA 2C0NA 4R7PA 3V8YA 1LZIA 2QKXA 2VS3A 1VGWA 2RJ0A 1S4NA 2QGIA 2YQJA 2AECA 2VS5A 4J18A 4ASJA 3RMWA 2FYBA 4C2SA 1VH3A 5C36A 2Y7AA 2RIXA 2AGDA 3I0FA 4DE7A 3V8ZA 2ZU7A 1W57A 2V0KA 1NQIB 5C49A 1V82A 2JCJA 2AM5A 1H7TA 2Y4KA 3I0CA 2Q4JA 4KNRA 1NF5B 1H7HA 4EE3A 2X5ZA 1LL0A 1G23A 3GUEA 1JVDA 1JYKA 4EE4A 2YESA 3OKRA 2XMEA 5AJNA 1WT1A 4NALA 2D7IA 3V0PA 5C48A 3ZLLA 5DDVA 4D0TA 1O7OA 1FWYA 1G3LA 2Z86A 1H5SD 1LVWA 4KC1A 3IOHA 4EEOA 2VS4A 5EJZA 1H7QA 3U2WA 1WVCA 1G1LA 1HM9A 2FYDB 4ASYA 1QWJA 3JTJA 1ZCTA 2VD4A 3F1CA 1KWSA 4XWIA 5AJPA 1OMXA 1HM8A 4KXOA 3EE5A 4Y7GA 2WVKA 3SX3A 5C3DA 3I0KA 2A8WA 2E8BA 3SX5A 2D0JA 2RIZA 2RJ9A 1PZTA 1FZWA 4L41C 3R2WA 4KPZA 1TW1A 1R82A 4M28A 3V0OA 1VICA 1G9RA 1H7FA 4EVWA 3SXAA 4Y6NA 3OGZA 5C4BA 3OAMA 1INIA 1S4OA 4MNDA 1QGQA 3U2VA 3D8VA 3N9WA 5CMJA 2FYAA 2AH9A 4Y6UA 5HS2A 4D11C 2AESA 2FFVA 4CJCA 2W0VA 2V0LA 5C4EA 2OEFA 2Y4MA 3ZF8A 2BO7A 3POLA 4FIYA 2WAWA 2W0WA 1FGGA 1H5RA 2X5SA 5IFYA 1G97A 3DK5A 1H5SC 1FOAA 1GWVA 1I52A 1W55A 2NXVA 2ICYA 4FRLA 1EYRA 1H4CA 2YQHA 3OH1A 4B2WA 4KQLA 3U0XA 2VXMA 1ZDGA 2UX8A 5C3BA 3E26A 1W77A 1GX4A 2OI5A 1R7XA 1YP4A 4Y9XA 2Y6PA 4M2BA 1WT0A 1INJA 5AJOA 2VSIA 3USQA 4BMAA 2OEGA 1R7UA 2AE7A 5CQNX 1G95A 1NKHB 1LL2A 4NAIA 4HO6A 5C4FA 1YP2A 2I5EA 1GWWA 4G3PA 2FYCB 1IINA 2YQSA 1YP3A 2J0BA 2P6WA 3SXGA 2RJ1A 4HO8A 2RJ6A 4D11A 1G0RA 3V90A 4YS8A 3OH0A 1GQCA 2YC5A 3RMVA 4FCEA 1NWGB 5CMIA 1ZCVA 1ZDFA 1ZCYA 3JUJA 1H5SA 1H5TA 1NHEB 1OQMB 2APCA 5L6VA 2QH5A 4CJ8A 2JCKA 1R7VA 1LZ0A 1LZJA 4P02A 4HO2A 4HO3A 4B4MA 4KC2A 3OC9A 1Z90A 1O23B 2RJ5A 2CU2A 2Y4JA 3NGWA 5D92A 1K4VA 3I0EA 1JV3A 4EEGA 1R7TA 4KNXA 4FCUA 2MZBA 1FXOA 4EE5A 3V0LA 2GGOA 1G93A 3I0IX 5FTVA 4AC3A 4B42A 3OH4A 2VSHA 3PKPA 1VM8A 1HJJA 1VGZA 3Q7UA 3SXDA 4LW6A 3U2UA 3SXCA 1YROB 4NAKA 3ST8A 4Y7UA 2BO8A 3RSBA 3FOQA 2WVLA 3ZLKA 4FROA 2XMHA 4GBPA 1HV9A 3BRKX 1MP5A 4Y7FA 3IOIA 5C4CA 5I1FA 1H3MA 2YCMA 1O0RA 4Q7CA 1XZ6A 1ZJ2A 3FWWA 3I0GA 1S4PA 5C3AA 4DDZA 1JV1A 3V91A 1GQ9A 2Y4LA 3E25A 3V0QA 1JVGA 1VZUA 4MYBA 2D7RA 5FTSA 1ZJOA 1V83A 1HM0A 3V0NA 2BO4A 4EEMA 3USRA 1MP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAN A;  1VZX A;  4LW3 A;  2ZU9 A;  4JD0 A;  2YQC A;  1LZ7 A;  5JQQ A;  1FRW A;  2P72 A;  1ZI1 A;  1VGU A;  2X60 A;  2PGV A;  5EIY A;  3OH2 A;  3CKV A;  2Z87 A;  1EZI A;  3CGX A;  4EEA A;  3QVB A;  3CKJ A;  4B5B A;  4Y64 A;  4KC4 A;  1ZI3 A;  2AM4 A;  2XWM A;  3D5N A;  2VFZ A;  1FXJ A;  4IRQ A;  1H5R B;  2GGQ A;  3IOJ A;  3TZT A;  5BXC A;  5C38 A;  4B4B A;  4CVH A;  2ZU8 A;  4FRB A;  4AAW A;  1R7Y A;  4G3Q A;  1FR8 A;  4D48 A;  1GA8 A;  2OI6 A;  1FGX A;  3BCV A;  4HG6 A;  1H7L A;  1H4D A;  2XWL A;  3KIA A;  3CKO A;  1ZJ0 A;  4FQW A;  4HO4 A;  4B3U A;  1ON8 A;  2X65 A;  1E5K A;  3K8E A;  5IDT A;  1FO8 A;  3I0D A;  3I0H A;  1VH1 A;  3D98 A;  5CQP A;  2RIY A;  1G2V A;  2A8U A;  4ZDQ A;  3V0M A;  5C47 A;  1OMZ A;  1WSZ A;  4FRH A;  2DPW A;  1FG5 N;  4IRP A;  4HOC A;  4K6R A;  2RJ8 A;  4AYL A;  4P00 A;  4FRM A;  5C4D A;  2VXL A;  5CQO A;  3SXB A;  4M4K A;  4Y62 A;  5C8R A;  2JCO A;  1VZT A;  2FFU A;  1HJL A;  1ON6 A;  1H5S B;  1H5T B;  1NMM B;  4Y7T A;  1IIM A;  3ZGF A;  5FYE A;  1XHB A;  3DUV A;  2AM3 A;  3F1Y A;  4B4G A;  3O3P A;  4FRQ A;  1LL3 A;  5FU8 A;  2FY7 A;  1H7E A;  3SXE A;  2XWN A;  2I7B A;  4FRP A;  1VPA A;  2WGZ A;  5FUH A;  3U2X A;  4AYJ A;  4G87 A;  1R80 A;  4KRV A;  4KT7 A;  1ZJP A;  2PGY A;  3I0L A;  4DEC A;  1QGS A;  1WT3 A;  3CU0 A;  3U0Y A;  4B2X A;  3PNN A;  1QG8 A;  4UEG A;  5CQL X;  1GX0 A;  2E3D A;  2RJ7 A;  4HO0 A;  1FR9 A;  2V0J A;  5CMF X;  4FRD A;  3CKQ A;  3Q80 A;  4FRA A;  4KPX A;  2RJ4 A;  2RIT A;  3DJ4 A;  4E1K A;  4Y63 A;  1VGT A;  1MC3 A;  1H7G A;  1H4E A;  2WE9 A;  2WEE A;  4HO9 A;  1TVY A;  3HL3 A;  3I0J A;  4HO5 A;  3U2T A;  2YC3 A;  4Y7V A;  2ICX A;  2O1G A;  4G3S A;  5FU0 A;  1ZHJ A;  4JIS A;  1SS9 A;  2PA4 A;  1PZY B;  3JUK A;  4CJB A;  1ZJ3 A;  3TQD A;  5J49 A;  1V84 A;  3T7N A;  2BO6 A;  3Q4S A;  5IDS A;  1ZI5 A;  3T7O A;  1MP3 A;  4BQH A;  3SX8 A;  2O1H A;  3T7M A;  4FRE A;  2WVM A;  3SPT A;  5C1H A;  3OH3 A;  4ARW A;  3K8D A;  5L6S A;  3SX7 A;  1WT2 A;  4HCQ A;  1G8O A;  1R81 A;  2PX7 A;  5C1L A;  4ECM A;  5EJ1 A;  1ZIZ A;  1TW5 A;  3R3I A;  3CKN A;  3PKQ A;  2JCL A;  5CQM X;  2P73 A;  5C1G A;  2O1F A;  5FV9 A;  1ZI4 A;  1ZCU A;  1O7Q A;  1TZF A;  2V0I A;  2V0H A;  4D0Z A;  1JYL A;  1FO9 A;  5DDT A;  5CMG X;  5CMH A;  1ZJ1 A;  2OI7 A;  3ZGG A;  4M2A A;  3LW6 A;  2I5K A;  4R7P A;  3V8Y A;  1LZI A;  2QKX A;  2VS3 A;  1VGW A;  2RJ0 A;  1S4N A;  2QGI A;  2YQJ A;  2AEC A;  2VS5 A;  4J18 A;  4ASJ A;  3RMW A;  2FYB A;  4C2S A;  1VH3 A;  5C36 A;  2Y7A A;  2RIX A;  2AGD A;  3I0F A;  4DE7 A;  3V8Z A;  2ZU7 A;  1W57 A;  2V0K A;  1NQI B;  5C49 A;  1V82 A;  2JCJ A;  2AM5 A;  1H7T A;  2Y4K A;  3I0C A;  2Q4J A;  4KNR A;  1NF5 B;  1H7H A;  4EE3 A;  2X5Z A;  1LL0 A;  1G23 A;  3GUE A;  1JVD A;  1JYK A;  4EE4 A;  2YES A;  3OKR A;  2XME A;  5AJN A;  1WT1 A;  4NAL A;  2D7I A;  3V0P A;  5C48 A;  3ZLL A;  5DDV A;  4D0T A;  1O7O A;  1FWY A;  1G3L A;  2Z86 A;  1H5S D;  1LVW A;  4KC1 A;  3IOH A;  4EEO A;  2VS4 A;  5EJZ A;  1H7Q A;  3U2W A;  1WVC A;  1G1L A;  1HM9 A;  2FYD B;  4ASY A;  1QWJ A;  3JTJ A;  1ZCT A;  2VD4 A;  3F1C A;  1KWS A;  4XWI A;  5AJP A;  1OMX A;  1HM8 A;  4KXO A;  3EE5 A;  4Y7G A;  2WVK A;  3SX3 A;  5C3D A;  3I0K A;  2A8W A;  2E8B A;  3SX5 A;  2D0J A;  2RIZ A;  2RJ9 A;  1PZT A;  1FZW A;  4L41 C;  3R2W A;  4KPZ A;  1TW1 A;  1R82 A;  4M28 A;  3V0O A;  1VIC A;  1G9R A;  1H7F A;  4EVW A;  3SXA A;  4Y6N A;  3OGZ A;  5C4B A;  3OAM A;  1INI A;  1S4O A;  4MND A;  1QGQ A;  3U2V A;  3D8V A;  3N9W A;  5CMJ A;  2FYA A;  2AH9 A;  4Y6U A;  5HS2 A;  4D11 C;  2AES A;  2FFV A;  4CJC A;  2W0V A;  2V0L A;  5C4E A;  2OEF A;  2Y4M A;  3ZF8 A;  2BO7 A;  3POL A;  2WAW A;  2W0W A;  1FGG A;  1H5R A;  2X5S A;  5IFY A;  1G97 A;  3DK5 A;  1H5S C;  1FOA A;  1GWV A;  1I52 A;  1W55 A;  2NXV A;  2ICY A;  4FRL A;  1EYR A;  1H4C A;  2YQH A;  3OH1 A;  4B2W A;  4KQL A;  3U0X A;  2VXM A;  1ZDG A;  2UX8 A;  5C3B A;  3E26 A;  1W77 A;  1GX4 A;  2OI5 A;  1R7X A;  1YP4 A;  4Y9X A;  2Y6P A;  4M2B A;  1WT0 A;  1INJ A;  5AJO A;  2VSI A;  3USQ A;  4BMA A;  2OEG A;  1R7U A;  2AE7 A;  5CQN X;  1G95 A;  1NKH B;  1LL2 A;  4NAI A;  4HO6 A;  5C4F A;  1YP2 A;  2I5E A;  1GWW A;  4G3P A;  2FYC B;  1IIN A;  2YQS A;  1YP3 A;  2P6W A;  3SXG A;  2RJ1 A;  4HO8 A;  2RJ6 A;  4D11 A;  1G0R A;  3V90 A;  4YS8 A;  3OH0 A;  1GQC A;  2YC5 A;  3RMV A;  4FCE A;  1NWG B;  5CMI A;  1ZCV A;  1ZDF A;  1ZCY A;  3JUJ A;  1H5S A;  1H5T A;  1NHE B;  1OQM B;  2APC A;  5L6V A;  2QH5 A;  4CJ8 A;  2JCK A;  1R7V A;  1LZ0 A;  1LZJ A;  4P02 A;  4HO2 A;  4HO3 A;  4B4M A;  4KC2 A;  3OC9 A;  1Z90 A;  1O23 B;  2RJ5 A;  2CU2 A;  2Y4J A;  3NGW A;  1K4V A;  3I0E A;  1JV3 A;  4EEG A;  1R7T A;  4KNX A;  4FCU A;  2MZB A;  1FXO A;  4EE5 A;  3V0L A;  2GGO A;  1G93 A;  3I0I X;  5FTV A;  4AC3 A;  4B42 A;  3OH4 A;  2VSH A;  3PKP A;  1VM8 A;  1HJJ A;  1VGZ A;  3Q7U A;  3SXD A;  4LW6 A;  3U2U A;  3SXC A;  1YRO B;  4NAK A;  3ST8 A;  4Y7U A;  2BO8 A;  3RSB A;  3FOQ A;  2WVL A;  3ZLK A;  4FRO A;  2XMH A;  4GBP A;  1HV9 A;  3BRK X;  1MP5 A;  4Y7F A;  3IOI A;  5C4C A;  5I1F A;  1H3M A;  2YCM A;  1O0R A;  1XZ6 A;  1ZJ2 A;  3FWW A;  3I0G A;  1S4P A;  5C3A A;  4DDZ A;  1JV1 A;  3V91 A;  1GQ9 A;  2Y4L A;  3E25 A;  3V0Q A;  1JVG A;  1VZU A;  4MYB A;  2D7R A;  5FTS A;  1ZJO A;  1V83 A;  1HM0 A;  3V0N A;  2BO4 A;  4EEM A;  3USR A;  1MP4 A; 
#chains in the Genus database with same CATH topology
 4NAN A;  1VZX A;  4LW3 A;  2ZU9 A;  4JD0 A;  2YQC A;  1LZ7 A;  5JQQ A;  1FRW A;  2P72 A;  1ZI1 A;  1VGU A;  2X60 A;  2PGV A;  5EIY A;  3OH2 A;  3CKV A;  2Z87 A;  1EZI A;  3CGX A;  4EEA A;  3QVB A;  3CKJ A;  4B5B A;  4Y64 A;  4KC4 A;  1ZI3 A;  2AM4 A;  2XWM A;  3D5N A;  2VFZ A;  1FXJ A;  4IRQ A;  1H5R B;  2GGQ A;  3IOJ A;  3TZT A;  5BXC A;  5C38 A;  4B4B A;  4CVH A;  2ZU8 A;  4FRB A;  4AAW A;  1R7Y A;  4G3Q A;  1FR8 A;  4D48 A;  1GA8 A;  2OI6 A;  1FGX A;  3BCV A;  4HG6 A;  1H7L A;  1H4D A;  2XWL A;  3KIA A;  3CKO A;  2VK9 A;  1ZJ0 A;  4FQW A;  4HO4 A;  4B3U A;  1ON8 A;  2X65 A;  1E5K A;  3K8E A;  5IDT A;  1FO8 A;  3I0D A;  5D91 A;  3I0H A;  1VH1 A;  3D98 A;  5CQP A;  2RIY A;  1G2V A;  2A8U A;  4ZDQ A;  3V0M A;  5C47 A;  1OMZ A;  1WSZ A;  4FRH A;  2DPW A;  1FG5 N;  4IRP A;  4HOC A;  4K6R A;  2RJ8 A;  4AYL A;  4P00 A;  4FRM A;  5C4D A;  2VXL A;  5CQO A;  3SXB A;  4M4K A;  4Y62 A;  5C8R A;  2JCO A;  1VZT A;  2FFU A;  1HJL A;  1ON6 A;  1H5S B;  1H5T B;  1NMM B;  4Y7T A;  1IIM A;  3ZGF A;  5FYE A;  1XHB A;  3DUV A;  2AM3 A;  3F1Y A;  4B4G A;  3O3P A;  4FRQ A;  1LL3 A;  5FU8 A;  2FY7 A;  1H7E A;  3SXE A;  2XWN A;  2I7B A;  4FRP A;  1VPA A;  2WGZ A;  5FUH A;  3U2X A;  4AYJ A;  4G87 A;  4O6M A;  1R80 A;  4KRV A;  4KT7 A;  1ZJP A;  2PGY A;  3I0L A;  4DEC A;  1QGS A;  1WT3 A;  3CU0 A;  3U0Y A;  4B2X A;  2J0A A;  3PNN A;  1QG8 A;  4UEG A;  5CQL X;  1GX0 A;  2E3D A;  2RJ7 A;  4HO0 A;  1FR9 A;  2V0J A;  5CMF X;  4FRD A;  3CKQ A;  3Q80 A;  4FRA A;  4KPX A;  2RJ4 A;  2RIT A;  3DJ4 A;  4E1K A;  4Y63 A;  1VGT A;  1MC3 A;  1H7G A;  1H4E A;  2WE9 A;  2WEE A;  4HO9 A;  1TVY A;  3HL3 A;  3I0J A;  4HO5 A;  3U2T A;  2YC3 A;  4Y7V A;  4O6N A;  2ICX A;  2O1G A;  4G3S A;  5FU0 A;  1ZHJ A;  4JIS A;  1SS9 A;  2PA4 A;  1PZY B;  3JUK A;  4CJB A;  1ZJ3 A;  3TQD A;  5J49 A;  1V84 A;  3T7N A;  2BO6 A;  3Q4S A;  5IDS A;  4FIX A;  1ZI5 A;  3T7O A;  1MP3 A;  4BQH A;  3SX8 A;  2O1H A;  3T7M A;  4FRE A;  2WVM A;  3SPT A;  5C1H A;  3OH3 A;  4ARW A;  3K8D A;  5L6S A;  3SX7 A;  1WT2 A;  4HCQ A;  1G8O A;  1R81 A;  4MIX A;  2PX7 A;  5C1L A;  4ECM A;  5EJ1 A;  1ZIZ A;  1TW5 A;  3R3I A;  3CKN A;  3PKQ A;  2JCL A;  5CQM X;  2P73 A;  5C1G A;  2O1F A;  5FV9 A;  1ZI4 A;  1ZCU A;  1O7Q A;  1TZF A;  2V0I A;  2V0H A;  4D0Z A;  1JYL A;  1FO9 A;  5DDT A;  5CMG X;  5CMH A;  1ZJ1 A;  2OI7 A;  3ZGG A;  4M2A A;  3LW6 A;  2I5K A;  2C0N A;  4R7P A;  3V8Y A;  1LZI A;  2QKX A;  2VS3 A;  1VGW A;  2RJ0 A;  1S4N A;  2QGI A;  2YQJ A;  2AEC A;  2VS5 A;  4J18 A;  4ASJ A;  3RMW A;  2FYB A;  4C2S A;  1VH3 A;  5C36 A;  2Y7A A;  2RIX A;  2AGD A;  3I0F A;  4DE7 A;  3V8Z A;  2ZU7 A;  1W57 A;  2V0K A;  1NQI B;  5C49 A;  1V82 A;  2JCJ A;  2AM5 A;  1H7T A;  2Y4K A;  3I0C A;  2Q4J A;  4KNR A;  1NF5 B;  1H7H A;  4EE3 A;  2X5Z A;  1LL0 A;  1G23 A;  3GUE A;  1JVD A;  1JYK A;  4EE4 A;  2YES A;  3OKR A;  2XME A;  5AJN A;  1WT1 A;  4NAL A;  2D7I A;  3V0P A;  5C48 A;  3ZLL A;  5DDV A;  4D0T A;  1O7O A;  1FWY A;  1G3L A;  2Z86 A;  1H5S D;  1LVW A;  4KC1 A;  3IOH A;  4EEO A;  2VS4 A;  5EJZ A;  1H7Q A;  3U2W A;  1WVC A;  1G1L A;  1HM9 A;  2FYD B;  4ASY A;  1QWJ A;  3JTJ A;  1ZCT A;  2VD4 A;  3F1C A;  1KWS A;  4XWI A;  5AJP A;  1OMX A;  1HM8 A;  4KXO A;  3EE5 A;  4Y7G A;  2WVK A;  3SX3 A;  5C3D A;  3I0K A;  2A8W A;  2E8B A;  3SX5 A;  2D0J A;  2RIZ A;  2RJ9 A;  1PZT A;  1FZW A;  4L41 C;  3R2W A;  4KPZ A;  1TW1 A;  1R82 A;  4M28 A;  3V0O A;  1VIC A;  1G9R A;  1H7F A;  4EVW A;  3SXA A;  4Y6N A;  3OGZ A;  5C4B A;  3OAM A;  1INI A;  1S4O A;  4MND A;  1QGQ A;  3U2V A;  3D8V A;  3N9W A;  5CMJ A;  2FYA A;  2AH9 A;  4Y6U A;  5HS2 A;  4D11 C;  2AES A;  2FFV A;  4CJC A;  2W0V A;  2V0L A;  5C4E A;  2OEF A;  2Y4M A;  3ZF8 A;  2BO7 A;  3POL A;  4FIY A;  2WAW A;  2W0W A;  1FGG A;  1H5R A;  2X5S A;  5IFY A;  1G97 A;  3DK5 A;  1H5S C;  1FOA A;  1GWV A;  1I52 A;  1W55 A;  2NXV A;  2ICY A;  4FRL A;  1EYR A;  1H4C A;  2YQH A;  3OH1 A;  4B2W A;  4KQL A;  3U0X A;  2VXM A;  1ZDG A;  2UX8 A;  5C3B A;  3E26 A;  1W77 A;  1GX4 A;  2OI5 A;  1R7X A;  1YP4 A;  4Y9X A;  2Y6P A;  4M2B A;  1WT0 A;  1INJ A;  5AJO A;  2VSI A;  3USQ A;  4BMA A;  2OEG A;  1R7U A;  2AE7 A;  5CQN X;  1G95 A;  1NKH B;  1LL2 A;  4NAI A;  4HO6 A;  5C4F A;  1YP2 A;  2I5E A;  1GWW A;  4G3P A;  2FYC B;  1IIN A;  2YQS A;  1YP3 A;  2J0B A;  2P6W A;  3SXG A;  2RJ1 A;  4HO8 A;  2RJ6 A;  4D11 A;  1G0R A;  3V90 A;  4YS8 A;  3OH0 A;  1GQC A;  2YC5 A;  3RMV A;  4FCE A;  1NWG B;  5CMI A;  1ZCV A;  1ZDF A;  1ZCY A;  3JUJ A;  1H5S A;  1H5T A;  1NHE B;  1OQM B;  2APC A;  5L6V A;  2QH5 A;  4CJ8 A;  2JCK A;  1R7V A;  1LZ0 A;  1LZJ A;  4P02 A;  4HO2 A;  4HO3 A;  4B4M A;  4KC2 A;  3OC9 A;  1Z90 A;  1O23 B;  2RJ5 A;  2CU2 A;  2Y4J A;  3NGW A;  5D92 A;  1K4V A;  3I0E A;  1JV3 A;  4EEG A;  1R7T A;  4KNX A;  4FCU A;  2MZB A;  1FXO A;  4EE5 A;  3V0L A;  2GGO A;  1G93 A;  3I0I X;  5FTV A;  4AC3 A;  4B42 A;  3OH4 A;  2VSH A;  3PKP A;  1VM8 A;  1HJJ A;  1VGZ A;  3Q7U A;  3SXD A;  4LW6 A;  3U2U A;  3SXC A;  1YRO B;  4NAK A;  3ST8 A;  4Y7U A;  2BO8 A;  3RSB A;  3FOQ A;  2WVL A;  3ZLK A;  4FRO A;  2XMH A;  4GBP A;  1HV9 A;  3BRK X;  1MP5 A;  4Y7F A;  3IOI A;  5C4C A;  5I1F A;  1H3M A;  2YCM A;  1O0R A;  4Q7C A;  1XZ6 A;  1ZJ2 A;  3FWW A;  3I0G A;  1S4P A;  5C3A A;  4DDZ A;  1JV1 A;  3V91 A;  1GQ9 A;  2Y4L A;  3E25 A;  3V0Q A;  1JVG A;  1VZU A;  4MYB A;  2D7R A;  5FTS A;  1ZJO A;  1V83 A;  1HM0 A;  3V0N A;  2BO4 A;  4EEM A;  3USR A;  1MP4 A; 
#chains in the Genus database with same CATH homology
 4NAN A;  1VZX A;  4LW3 A;  2ZU9 A;  4JD0 A;  2YQC A;  1LZ7 A;  5JQQ A;  1FRW A;  2P72 A;  1ZI1 A;  1VGU A;  2X60 A;  2PGV A;  5EIY A;  3OH2 A;  3CKV A;  2Z87 A;  1EZI A;  3CGX A;  4EEA A;  3QVB A;  3CKJ A;  4B5B A;  4Y64 A;  4KC4 A;  1ZI3 A;  2AM4 A;  2XWM A;  3D5N A;  2VFZ A;  1FXJ A;  4IRQ A;  1H5R B;  2GGQ A;  3IOJ A;  3TZT A;  5BXC A;  5C38 A;  4B4B A;  4CVH A;  2ZU8 A;  4FRB A;  4AAW A;  1R7Y A;  4G3Q A;  1FR8 A;  4D48 A;  1GA8 A;  2OI6 A;  1FGX A;  3BCV A;  4HG6 A;  1H7L A;  1H4D A;  2XWL A;  3KIA A;  3CKO A;  2VK9 A;  1ZJ0 A;  4FQW A;  4HO4 A;  4B3U A;  1ON8 A;  2X65 A;  1E5K A;  3K8E A;  5IDT A;  1FO8 A;  3I0D A;  5D91 A;  3I0H A;  1VH1 A;  3D98 A;  5CQP A;  2RIY A;  1G2V A;  2A8U A;  4ZDQ A;  3V0M A;  5C47 A;  1OMZ A;  1WSZ A;  4FRH A;  2DPW A;  1FG5 N;  4IRP A;  4HOC A;  4K6R A;  2RJ8 A;  4AYL A;  4P00 A;  4FRM A;  5C4D A;  2VXL A;  5CQO A;  3SXB A;  4M4K A;  4Y62 A;  5C8R A;  2JCO A;  1VZT A;  2FFU A;  1HJL A;  1ON6 A;  1H5S B;  1H5T B;  1NMM B;  4Y7T A;  1IIM A;  3ZGF A;  5FYE A;  1XHB A;  3DUV A;  2AM3 A;  3F1Y A;  4B4G A;  3O3P A;  4FRQ A;  1LL3 A;  5FU8 A;  2FY7 A;  1H7E A;  3SXE A;  2XWN A;  2I7B A;  4FRP A;  1VPA A;  2WGZ A;  5FUH A;  3U2X A;  4AYJ A;  4G87 A;  4O6M A;  1R80 A;  4KRV A;  4KT7 A;  1ZJP A;  2PGY A;  3I0L A;  4DEC A;  1QGS A;  1WT3 A;  3CU0 A;  3U0Y A;  4B2X A;  2J0A A;  3PNN A;  1QG8 A;  4UEG A;  5CQL X;  1GX0 A;  2E3D A;  2RJ7 A;  4HO0 A;  1FR9 A;  2V0J A;  5CMF X;  4FRD A;  3CKQ A;  3Q80 A;  4FRA A;  4KPX A;  2RJ4 A;  2RIT A;  3DJ4 A;  4E1K A;  4Y63 A;  1VGT A;  1MC3 A;  1H7G A;  1H4E A;  2WE9 A;  2WEE A;  4HO9 A;  1TVY A;  3HL3 A;  3I0J A;  4HO5 A;  3U2T A;  2YC3 A;  4Y7V A;  4O6N A;  2ICX A;  2O1G A;  4G3S A;  5FU0 A;  1ZHJ A;  4JIS A;  1SS9 A;  2PA4 A;  1PZY B;  3JUK A;  4CJB A;  1ZJ3 A;  3TQD A;  5J49 A;  1V84 A;  3T7N A;  2BO6 A;  3Q4S A;  5IDS A;  4FIX A;  1ZI5 A;  3T7O A;  1MP3 A;  4BQH A;  3SX8 A;  2O1H A;  3T7M A;  4FRE A;  2WVM A;  3SPT A;  5C1H A;  3OH3 A;  4ARW A;  3K8D A;  5L6S A;  3SX7 A;  1WT2 A;  4HCQ A;  1G8O A;  1R81 A;  4MIX A;  2PX7 A;  5C1L A;  4ECM A;  5EJ1 A;  1ZIZ A;  1TW5 A;  3R3I A;  3CKN A;  3PKQ A;  2JCL A;  5CQM X;  2P73 A;  5C1G A;  2O1F A;  5FV9 A;  1ZI4 A;  1ZCU A;  1O7Q A;  1TZF A;  2V0I A;  2V0H A;  4D0Z A;  1JYL A;  1FO9 A;  5DDT A;  5CMG X;  5CMH A;  1ZJ1 A;  2OI7 A;  3ZGG A;  4M2A A;  3LW6 A;  2I5K A;  2C0N A;  4R7P A;  3V8Y A;  1LZI A;  2QKX A;  2VS3 A;  1VGW A;  2RJ0 A;  1S4N A;  2QGI A;  2YQJ A;  2AEC A;  2VS5 A;  4J18 A;  4ASJ A;  3RMW A;  2FYB A;  4C2S A;  1VH3 A;  5C36 A;  2Y7A A;  2RIX A;  2AGD A;  3I0F A;  4DE7 A;  3V8Z A;  2ZU7 A;  1W57 A;  2V0K A;  1NQI B;  5C49 A;  1V82 A;  2JCJ A;  2AM5 A;  1H7T A;  2Y4K A;  3I0C A;  2Q4J A;  4KNR A;  1NF5 B;  1H7H A;  4EE3 A;  2X5Z A;  1LL0 A;  1G23 A;  3GUE A;  1JVD A;  1JYK A;  4EE4 A;  2YES A;  3OKR A;  2XME A;  5AJN A;  1WT1 A;  4NAL A;  2D7I A;  3V0P A;  5C48 A;  3ZLL A;  5DDV A;  4D0T A;  1O7O A;  1FWY A;  1G3L A;  2Z86 A;  1H5S D;  1LVW A;  4KC1 A;  3IOH A;  4EEO A;  2VS4 A;  5EJZ A;  1H7Q A;  3U2W A;  1WVC A;  1G1L A;  1HM9 A;  2FYD B;  4ASY A;  1QWJ A;  3JTJ A;  1ZCT A;  2VD4 A;  3F1C A;  1KWS A;  4XWI A;  5AJP A;  1OMX A;  1HM8 A;  4KXO A;  3EE5 A;  4Y7G A;  2WVK A;  3SX3 A;  5C3D A;  3I0K A;  2A8W A;  2E8B A;  3SX5 A;  2D0J A;  2RIZ A;  2RJ9 A;  1PZT A;  1FZW A;  4L41 C;  3R2W A;  4KPZ A;  1TW1 A;  1R82 A;  4M28 A;  3V0O A;  1VIC A;  1G9R A;  1H7F A;  4EVW A;  3SXA A;  4Y6N A;  3OGZ A;  5C4B A;  3OAM A;  1INI A;  1S4O A;  4MND A;  1QGQ A;  3U2V A;  3D8V A;  3N9W A;  5CMJ A;  2FYA A;  2AH9 A;  4Y6U A;  5HS2 A;  4D11 C;  2AES A;  2FFV A;  4CJC A;  2W0V A;  2V0L A;  5C4E A;  2OEF A;  2Y4M A;  3ZF8 A;  2BO7 A;  3POL A;  4FIY A;  2WAW A;  2W0W A;  1FGG A;  1H5R A;  2X5S A;  5IFY A;  1G97 A;  3DK5 A;  1H5S C;  1FOA A;  1GWV A;  1I52 A;  1W55 A;  2NXV A;  2ICY A;  4FRL A;  1EYR A;  1H4C A;  2YQH A;  3OH1 A;  4B2W A;  4KQL A;  3U0X A;  2VXM A;  1ZDG A;  2UX8 A;  5C3B A;  3E26 A;  1W77 A;  1GX4 A;  2OI5 A;  1R7X A;  1YP4 A;  4Y9X A;  2Y6P A;  4M2B A;  1WT0 A;  1INJ A;  5AJO A;  2VSI A;  3USQ A;  4BMA A;  2OEG A;  1R7U A;  2AE7 A;  5CQN X;  1G95 A;  1NKH B;  1LL2 A;  4NAI A;  4HO6 A;  5C4F A;  1YP2 A;  2I5E A;  1GWW A;  4G3P A;  2FYC B;  1IIN A;  2YQS A;  1YP3 A;  2J0B A;  2P6W A;  3SXG A;  2RJ1 A;  4HO8 A;  2RJ6 A;  4D11 A;  1G0R A;  3V90 A;  4YS8 A;  3OH0 A;  1GQC A;  2YC5 A;  3RMV A;  4FCE A;  1NWG B;  5CMI A;  1ZCV A;  1ZDF A;  1ZCY A;  3JUJ A;  1H5S A;  1H5T A;  1NHE B;  1OQM B;  2APC A;  5L6V A;  2QH5 A;  4CJ8 A;  2JCK A;  1R7V A;  1LZ0 A;  1LZJ A;  4P02 A;  4HO2 A;  4HO3 A;  4B4M A;  4KC2 A;  3OC9 A;  1Z90 A;  1O23 B;  2RJ5 A;  2CU2 A;  2Y4J A;  3NGW A;  5D92 A;  1K4V A;  3I0E A;  1JV3 A;  4EEG A;  1R7T A;  4KNX A;  4FCU A;  2MZB A;  1FXO A;  4EE5 A;  3V0L A;  2GGO A;  1G93 A;  3I0I X;  5FTV A;  4AC3 A;  4B42 A;  3OH4 A;  2VSH A;  3PKP A;  1VM8 A;  1HJJ A;  1VGZ A;  3Q7U A;  3SXD A;  4LW6 A;  3U2U A;  3SXC A;  1YRO B;  4NAK A;  3ST8 A;  4Y7U A;  2BO8 A;  3RSB A;  3FOQ A;  2WVL A;  3ZLK A;  4FRO A;  2XMH A;  4GBP A;  1HV9 A;  3BRK X;  1MP5 A;  4Y7F A;  3IOI A;  5C4C A;  5I1F A;  1H3M A;  2YCM A;  1O0R A;  4Q7C A;  1XZ6 A;  1ZJ2 A;  3FWW A;  3I0G A;  1S4P A;  5C3A A;  4DDZ A;  1JV1 A;  3V91 A;  1GQ9 A;  2Y4L A;  3E25 A;  3V0Q A;  1JVG A;  1VZU A;  4MYB A;  2D7R A;  5FTS A;  1ZJO A;  1V83 A;  1HM0 A;  3V0N A;  2BO4 A;  4EEM A;  3USR A;  1MP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...