2X5SA

Crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
333
Chain Sequence
VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDLGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MANNOSE-1-PHOSPHATE GUANYLYLTRANSFERASE
publication title Structural Insights Into the Catalytic Mechanism of Bacterial Guanosine-Diphospho-D-Mannose Pyrophosphorylase and its Regulation by Divalent Ions.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 107
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.7.7.13: Mannose-1-phosphate guanylyltransferase.
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2x5sA00
4HO2A 4AC3A 2FFVA 4M4KA 1MP5A 1JV3A 3I0GA 2FYBA 2JCLA 1G8OA 2Y4MA 4FRAA 1ZJ3A 2WVKA 3CKNA 3OC9A 1WT3A 4NANA 4B3UA 1ZDFA 2I5EA 1XHBA 1VH3A 2V0KA 3LW6A 3U0XA 2D0JA 1HJLA 3V0LA 1VZUA 3JUJA 1R7YA 1H7QA 5EJZA 3RSBA 5C4BA 1QWJA 1HJJA 4B5BA 2GGOA 3E25A 1INJA 5CQMX 1LVWA 1MP4A 4AYLA 3T7OA 4KT7A 4D0ZA 2P72A 1E5KA 1O0RA 3PKQA 4G3PA 1EZIA 4CJCA 1V83A 3NGWA 2I7BA 2QH5A 2VS5A 3I0EA 4EE3A 5FTSA 3V8YA 1LL2A 3O3PA 4B42A 1H7TA 2JCKA 5C8RA 2RJ1A 1S4NA 4FRMA 2Z86A 1H7HA 1H4CA 3SXAA 1LL3A 3DUVA 1VGTA 4HG6A 3JTJA 4KRVA 3T7NA 2V0JA 3ST8A 2XWMA 1S4PA 3V0PA 5CMIA 3TZTA 2XWNA 1R7UA 3SX5A 1G97A 3SX3A 3D5NA 3FWWA 1ZJOA 1LZJA 2AE7A 1LZ7A 1QGSA 1O7OA 2XWLA 2XMEA 2AGDA 2RIYA 2UX8A 4EVWA 4B2XA 1TW1A 2OEFA 4HOCA 2RJ6A 2FFUA 3Q7UA 4HO8A 1FR8A 1MP3A 1NWGB 4HCQA 2ICYA 2VS4A 3CU0A 5DDTA 1INIA 4EEAA 1OMZA 3D98A 2V0HA 5C48A 4B4MA 4Y63A 5EIYA 2CU2A 5IDTA 2BO4A 2PGYA 2X5SA 3OH2A 2RJ5A 3SXEA 1R81A 5C49A 2PGVA 3SX7A 3RMWA 1EYRA 3DJ4A 1ZCYA 2Z87A 5C38A 2BO6A 3U2TA 5C4FA 5CMJA 2YESA 3PNNA 4KC2A 4KQLA 1HV9A 1ZI5A 4HO5A 2V0IA 2OI7A 2ICXA 2RJ7A 4KXOA 3SX8A 1H5SC 2YCMA 1H4EA 2VS3A 1W77A 1LZ0A 1FOAA 5C3BA 2JCOA 5C3AA 3POLA 2FY7A 1WT2A 2QGIA 1FXJA 2E8BA 3USQA 5FV9A 2QKXA 5IDSA 3I0IX 3ZGFA 2ZU9A 3ZF8A 3V0OA 4Y6UA 5C47A 1HM9A 4B4GA 3I0CA 1ZCTA 1NMMB 1IINA 4ASYA 3PKPA 1PZYB 5L6VA 2Y4JA 2FYDB 1GWVA 1WT1A 1FGGA 5J49A 2WAWA 4EE4A 4IRQA 5FU0A 2WVMA 2YQCA 4CJBA 4G87A 1JYKA 3CKOA 4D48A 1FG5N 4BQHA 1OMXA 1VPAA 2XMHA 3ZLKA 4EEOA 4CJ8A 1VH1A 3I0LA 2RJ8A 1W55A 3U2WA 1G2VA 1SS9A 1JYLA 3K8DA 3OAMA 1WT0A 3FOQA 3N9WA 3U2UA 2W0WA 2WE9A 1ZJPA 2O1FA 4HO3A 4FQWA 1TVYA 4KPZA 1R82A 5FUHA 1R7TA 1R7XA 2MZBA 3Q4SA 1ZI3A 3GUEA 2AM5A 2AH9A 2WGZA 1PZTA 1ZJ1A 5IFYA 4LW3A 4FRBA 2D7IA 3OH4A 2RJ0A 3USRA 3F1CA 4G3SA 3T7MA 1H7LA 1V82A 1H5SA 1HM8A 1VZTA 2AESA 3JUKA 5C4CA 4JISA 3SXGA 1FO9A 1G95A 3CKVA 4Y7UA 2Y4KA 3QVBA 1ZIZA 1Z90A 2VFZA 2X5ZA 4L41C 1ZJ0A 1R7VA 1H5SB 1R80A 3CKQA 4FRPA 5JQQA 1FZWA 3V0MA 2YQJA 3SXCA 4KNXA 1O7QA 2VXMA 2P6WA 1ZCUA 1H3MA 1JV1A 4D11C 1GX0A 1ZI4A 5BXCA 3CGXA 1GX4A 5EJ1A 3SPTA 1G0RA 2NXVA 4NAKA 4CVHA 3CKJA 1TZFA 1QG8A 2VD4A 3V90A 2ZU7A 4DE7A 4Y7VA 4P00A 4FREA 3BRKX 3V8ZA 1H7FA 1GQCA 4KNRA 2JCJA 1WSZA 4KPXA 3DK5A 3IOIA 4MYBA 3IOJA 2YQHA 1XZ6A 4ZDQA 1G93A 2BO8A 2AM4A 4ARWA 4E1KA 2APCA 4HO6A 4B2WA 3IOHA 4Y7GA 3U0YA 1GWWA 3V0NA 1H5TA 4NALA 4EE5A 4J18A 2RITA 1JVGA 4FRDA 3R2WA 5C4EA 1JVDA 5DDVA 5FTVA 3V0QA 4ASJA 1ZI1A 2X65A 1H5SD 4Y7TA 1MC3A 5CMGX 1H5TB 4FCUA 1VGWA 3E26A 4Y7FA 5C1GA 2E3DA 2Y7AA 3F1YA 2YC5A 1ZJ2A 2FYAA 2RJ4A 4D11A 2YC3A 3V91A 4FCEA 2OEGA 3I0JA 5CMHA 1VM8A 2RIXA 1FXOA 3EE5A 2GGQA 2A8WA 3K8EA 5CQPA 3OH3A 5C1LA 5CMFX 1KWSA 4MNDA 4HO4A 5CQLX 1IIMA 4D0TA 3ZLLA 1NF5B 3KIAA 5C3DA 4IRPA 1ZCVA 4HO0A 1OQMB 4FRLA 4Y64A 1TW5A 4KC4A 2OI5A 1G9RA 1VICA 2V0LA 3OKRA 4R7PA 3HL3A 4C2SA 1W57A 1FRWA 5C1HA 4Y6NA 4K6RA 1I52A 3SXDA 4FROA 1GA8A 2VSIA 1FGXA 1ZDGA 5C4DA 1YP4A 2A8UA 1FR9A 3TQDA 2WVLA 4HO9A 3U2XA 3ZGGA 1V84A 1G3LA 2AM3A 4UEGA 5FU8A 4Y62A 3OH1A 4G3QA 3SXBA 5FYEA 1VGUA 1LZIA 3Q80A 1VZXA 4AAWA 3OH0A 1NHEB 3I0DA 3R3IA 2ZU8A 2RJ9A 1QGQA 1NKHB 2X60A 4KC1A 5CQNX 4LW6A 4XWIA 2Y4LA 2P73A 2RIZA 1WVCA 2VSHA 3RMVA 2AECA 1ZHJA 3I0FA 2PA4A 4JD0A 4BMAA 2W0VA 3U2VA 1H7EA 2Y6PA 2I5KA 2O1HA 4FRQA 4DECA 4ECMA 2FYCB 3BCVA 4Y9XA 1ON6A 1H7GA 1YP3A 5I1FA 1G1LA 2BO7A 4YS8A 4B4BA 5AJPA 2YQSA 1VGZA 5AJNA 1YROB 1S4OA 1H5RA 4NAIA 4M2AA 1O23B 4EEMA 1G23A 2WEEA 5L6SA 4EEGA 3D8VA 4M28A 1H4DA 4GBPA 1LL0A 4FRHA 1NQIB 1GQ9A 2PX7A 1H5RB 2Q4JA 1YP2A 1FO8A 1K4VA 5C36A 2O1GA 3OGZA 5HS2A 1HM0A 1ON8A 2DPWA 2OI6A 3I0KA 4M2BA 2D7RA 3I0HA 5AJOA 4AYJA 4DDZA 2VXLA 4P02A 1FWYA 5CQOA
chains in the Genus database with same CATH superfamily
4HO2A 4AC3A 2FFVA 4M4KA 1MP5A 1JV3A 3I0GA 2FYBA 2JCLA 1G8OA 2Y4MA 4FRAA 1ZJ3A 2WVKA 3CKNA 3OC9A 1WT3A 4NANA 4B3UA 1ZDFA 2I5EA 1XHBA 1VH3A 2V0KA 3LW6A 2J0AA 3U0XA 2D0JA 1HJLA 3V0LA 1VZUA 3JUJA 1R7YA 1H7QA 5EJZA 3RSBA 5C4BA 1QWJA 1HJJA 4B5BA 2GGOA 3E25A 1INJA 5CQMX 1LVWA 1MP4A 4AYLA 3T7OA 4KT7A 4D0ZA 2P72A 1E5KA 1O0RA 3PKQA 4G3PA 1EZIA 4CJCA 1V83A 3NGWA 2I7BA 2QH5A 2VS5A 3I0EA 4EE3A 5FTSA 3V8YA 1LL2A 3O3PA 4B42A 1H7TA 2JCKA 5C8RA 2RJ1A 1S4NA 4FRMA 2Z86A 1H7HA 1H4CA 3SXAA 1LL3A 3DUVA 1VGTA 4HG6A 3JTJA 4KRVA 3T7NA 2V0JA 3ST8A 2XWMA 1S4PA 3V0PA 5CMIA 3TZTA 2XWNA 1R7UA 3SX5A 1G97A 3SX3A 4FIXA 3D5NA 3FWWA 1ZJOA 1LZJA 2AE7A 4O6NA 1LZ7A 1QGSA 1O7OA 2XWLA 2XMEA 2AGDA 2RIYA 2UX8A 4EVWA 4B2XA 1TW1A 2OEFA 4HOCA 2RJ6A 2FFUA 3Q7UA 4HO8A 1FR8A 1MP3A 1NWGB 4HCQA 2ICYA 2VS4A 3CU0A 5DDTA 1INIA 4EEAA 1OMZA 3D98A 2V0HA 5C48A 4B4MA 4Y63A 5EIYA 2CU2A 5IDTA 2BO4A 2PGYA 2X5SA 3OH2A 2RJ5A 3SXEA 1R81A 5C49A 2PGVA 3SX7A 3RMWA 1EYRA 3DJ4A 1ZCYA 2Z87A 5C38A 2BO6A 3U2TA 5C4FA 5CMJA 2YESA 3PNNA 4KC2A 4KQLA 1HV9A 1ZI5A 4HO5A 2V0IA 2OI7A 2ICXA 2RJ7A 4KXOA 3SX8A 1H5SC 2YCMA 1H4EA 2VS3A 1W77A 1LZ0A 1FOAA 5C3BA 2JCOA 5D91A 3POLA 5C3AA 2FY7A 1WT2A 2QGIA 1FXJA 2E8BA 3USQA 5FV9A 2QKXA 5IDSA 3I0IX 3ZGFA 2ZU9A 3ZF8A 3V0OA 4Y6UA 5C47A 1HM9A 4B4GA 3I0CA 1ZCTA 1NMMB 4O6MA 1IINA 4ASYA 3PKPA 1PZYB 5L6VA 2Y4JA 2FYDB 1GWVA 1WT1A 1FGGA 5J49A 2WAWA 4EE4A 4IRQA 5FU0A 2J0BA 2WVMA 2YQCA 4CJBA 4G87A 1JYKA 3CKOA 4D48A 1FG5N 4BQHA 1OMXA 1VPAA 2XMHA 3ZLKA 4EEOA 4CJ8A 1VH1A 3I0LA 2RJ8A 1W55A 3U2WA 1G2VA 1SS9A 1JYLA 3K8DA 3OAMA 1WT0A 3FOQA 3N9WA 3U2UA 2W0WA 2WE9A 1ZJPA 2O1FA 4HO3A 4FQWA 1TVYA 4KPZA 1R82A 5FUHA 1R7TA 1R7XA 2MZBA 3Q4SA 1ZI3A 3GUEA 2AM5A 2AH9A 2WGZA 1PZTA 1ZJ1A 5IFYA 4LW3A 4FRBA 2D7IA 3OH4A 2RJ0A 3USRA 3F1CA 4G3SA 3T7MA 1H7LA 1V82A 1H5SA 1HM8A 1VZTA 2AESA 3JUKA 5C4CA 4JISA 3SXGA 1FO9A 1G95A 3CKVA 4Y7UA 2Y4KA 3QVBA 1ZIZA 1Z90A 2VFZA 2X5ZA 4L41C 1ZJ0A 1R7VA 1H5SB 1R80A 3CKQA 4FRPA 5JQQA 1FZWA 3V0MA 2YQJA 3SXCA 4KNXA 1O7QA 2VXMA 2P6WA 1ZCUA 1H3MA 1JV1A 4D11C 1GX0A 1ZI4A 5BXCA 3CGXA 1GX4A 5EJ1A 3SPTA 1G0RA 2NXVA 4NAKA 4CVHA 3CKJA 1TZFA 1QG8A 2VD4A 3V90A 2ZU7A 4DE7A 4Y7VA 4P00A 4FREA 3BRKX 3V8ZA 1H7FA 1GQCA 4KNRA 2JCJA 1WSZA 4KPXA 3DK5A 3IOIA 4MYBA 3IOJA 2YQHA 1XZ6A 4ZDQA 1G93A 2BO8A 2AM4A 4ARWA 4E1KA 4FIYA 2APCA 4HO6A 4B2WA 3IOHA 4Y7GA 3U0YA 1GWWA 3V0NA 1H5TA 4NALA 4EE5A 4J18A 2RITA 1JVGA 4FRDA 3R2WA 5C4EA 1JVDA 5DDVA 5FTVA 3V0QA 4ASJA 1ZI1A 2X65A 1H5SD 4Y7TA 1MC3A 4MIXA 5CMGX 1H5TB 4FCUA 1VGWA 3E26A 4Y7FA 5C1GA 2E3DA 2Y7AA 3F1YA 2YC5A 1ZJ2A 2FYAA 2RJ4A 4D11A 2YC3A 3V91A 4FCEA 2OEGA 3I0JA 5CMHA 1VM8A 2RIXA 1FXOA 3EE5A 2GGQA 2A8WA 3K8EA 5CQPA 3OH3A 5C1LA 5CMFX 1KWSA 4MNDA 4HO4A 5CQLX 1IIMA 4D0TA 3ZLLA 1NF5B 3KIAA 5C3DA 4IRPA 1ZCVA 4HO0A 1OQMB 4FRLA 4Y64A 1TW5A 4KC4A 2OI5A 1G9RA 1VICA 2V0LA 3OKRA 4R7PA 3HL3A 4C2SA 1W57A 1FRWA 5C1HA 4Y6NA 4K6RA 1I52A 3SXDA 4FROA 1GA8A 2VSIA 1FGXA 1ZDGA 5C4DA 1YP4A 2A8UA 1FR9A 3TQDA 2WVLA 4HO9A 3U2XA 3ZGGA 1V84A 1G3LA 2AM3A 4UEGA 5FU8A 4Y62A 3OH1A 4G3QA 3SXBA 5FYEA 1VGUA 1LZIA 3Q80A 1VZXA 4AAWA 3OH0A 1NHEB 3I0DA 3R3IA 2ZU8A 2RJ9A 1QGQA 1NKHB 2X60A 4KC1A 5CQNX 4LW6A 4XWIA 2Y4LA 2P73A 2RIZA 1WVCA 2VSHA 3RMVA 2AECA 1ZHJA 3I0FA 2PA4A 4JD0A 2VK9A 4BMAA 2W0VA 3U2VA 1H7EA 2Y6PA 2I5KA 2O1HA 4FRQA 4DECA 4ECMA 2FYCB 3BCVA 4Y9XA 1ON6A 1H7GA 1YP3A 5I1FA 1G1LA 2BO7A 4YS8A 4B4BA 5AJPA 2YQSA 1VGZA 5AJNA 1YROB 1S4OA 2C0NA 1H5RA 4NAIA 4M2AA 1O23B 4EEMA 1G23A 2WEEA 5L6SA 4EEGA 3D8VA 4M28A 1H4DA 4GBPA 1LL0A 4FRHA 1NQIB 1GQ9A 2PX7A 1H5RB 2Q4JA 1YP2A 1FO8A 1K4VA 5C36A 2O1GA 3OGZA 5HS2A 1HM0A 4Q7CA 1ON8A 2DPWA 2OI6A 3I0KA 4M2BA 2D7RA 3I0HA 5AJOA 4AYJA 5D92A 4DDZA 2VXLA 4P02A 1FWYA 5CQOA
chains in the Genus database with same CATH topology
4HO2A 4AC3A 2FFVA 4M4KA 1MP5A 1JV3A 3I0GA 2FYBA 2JCLA 1G8OA 2Y4MA 4FRAA 1ZJ3A 2WVKA 3CKNA 3OC9A 1WT3A 4NANA 4B3UA 1ZDFA 2I5EA 1XHBA 1VH3A 2V0KA 3LW6A 2J0AA 3U0XA 2D0JA 1HJLA 3V0LA 1VZUA 3JUJA 1R7YA 1H7QA 5EJZA 3RSBA 5C4BA 1QWJA 1HJJA 4B5BA 2GGOA 3E25A 1INJA 5CQMX 1LVWA 1MP4A 4AYLA 3T7OA 4KT7A 4D0ZA 2P72A 1E5KA 1O0RA 3PKQA 4G3PA 1EZIA 4CJCA 1V83A 3NGWA 2I7BA 2QH5A 2VS5A 3I0EA 4EE3A 5FTSA 3V8YA 1LL2A 3O3PA 4B42A 1H7TA 2JCKA 5C8RA 2RJ1A 1S4NA 4FRMA 2Z86A 1H7HA 1H4CA 3SXAA 1LL3A 3DUVA 1VGTA 4HG6A 3JTJA 4KRVA 3T7NA 2V0JA 3ST8A 2XWMA 1S4PA 3V0PA 5CMIA 3TZTA 2XWNA 1R7UA 3SX5A 1G97A 3SX3A 4FIXA 3D5NA 3FWWA 1ZJOA 1LZJA 2AE7A 4O6NA 1LZ7A 1QGSA 1O7OA 2XWLA 2XMEA 2AGDA 2RIYA 2UX8A 4EVWA 4B2XA 1TW1A 2OEFA 4HOCA 2RJ6A 2FFUA 3Q7UA 4HO8A 1FR8A 1MP3A 1NWGB 4HCQA 2ICYA 2VS4A 3CU0A 5DDTA 1INIA 4EEAA 1OMZA 3D98A 2V0HA 5C48A 4B4MA 4Y63A 5EIYA 2CU2A 5IDTA 2BO4A 2PGYA 2X5SA 3OH2A 2RJ5A 3SXEA 1R81A 5C49A 2PGVA 3SX7A 3RMWA 1EYRA 3DJ4A 1ZCYA 2Z87A 5C38A 2BO6A 3U2TA 5C4FA 5CMJA 2YESA 3PNNA 4KC2A 4KQLA 1HV9A 1ZI5A 4HO5A 2V0IA 2OI7A 2ICXA 2RJ7A 4KXOA 3SX8A 1H5SC 2YCMA 1H4EA 2VS3A 1W77A 1LZ0A 1FOAA 5C3BA 2JCOA 5D91A 3POLA 5C3AA 2FY7A 1WT2A 2QGIA 1FXJA 2E8BA 3USQA 5FV9A 2QKXA 5IDSA 3I0IX 3ZGFA 2ZU9A 3ZF8A 3V0OA 4Y6UA 5C47A 1HM9A 4B4GA 3I0CA 1ZCTA 1NMMB 4O6MA 1IINA 4ASYA 3PKPA 1PZYB 5L6VA 2Y4JA 2FYDB 1GWVA 1WT1A 1FGGA 5J49A 2WAWA 4EE4A 4IRQA 5FU0A 2J0BA 2WVMA 2YQCA 4CJBA 4G87A 1JYKA 3CKOA 4D48A 1FG5N 4BQHA 1OMXA 1VPAA 2XMHA 3ZLKA 4EEOA 4CJ8A 1VH1A 3I0LA 2RJ8A 1W55A 3U2WA 1G2VA 1SS9A 1JYLA 3K8DA 3OAMA 1WT0A 3FOQA 3N9WA 3U2UA 2W0WA 2WE9A 1ZJPA 2O1FA 4HO3A 4FQWA 1TVYA 4KPZA 1R82A 5FUHA 1R7TA 1R7XA 2MZBA 3Q4SA 1ZI3A 3GUEA 2AM5A 2AH9A 2WGZA 1PZTA 1ZJ1A 5IFYA 4LW3A 4FRBA 2D7IA 3OH4A 2RJ0A 3USRA 3F1CA 4G3SA 3T7MA 1H7LA 1V82A 1H5SA 1HM8A 1VZTA 2AESA 3JUKA 5C4CA 4JISA 3SXGA 1FO9A 1G95A 3CKVA 4Y7UA 2Y4KA 3QVBA 1ZIZA 1Z90A 2VFZA 2X5ZA 4L41C 1ZJ0A 1R7VA 1H5SB 1R80A 3CKQA 4FRPA 5JQQA 1FZWA 3V0MA 2YQJA 3SXCA 4KNXA 1O7QA 2VXMA 2P6WA 1ZCUA 1H3MA 1JV1A 4D11C 1GX0A 1ZI4A 5BXCA 3CGXA 1GX4A 5EJ1A 3SPTA 1G0RA 2NXVA 4NAKA 4CVHA 3CKJA 1TZFA 1QG8A 2VD4A 3V90A 2ZU7A 4DE7A 4Y7VA 4P00A 4FREA 3BRKX 3V8ZA 1H7FA 1GQCA 4KNRA 2JCJA 1WSZA 4KPXA 3DK5A 3IOIA 4MYBA 3IOJA 2YQHA 1XZ6A 4ZDQA 1G93A 2BO8A 2AM4A 4ARWA 4E1KA 4FIYA 2APCA 4HO6A 4B2WA 3IOHA 4Y7GA 3U0YA 1GWWA 3V0NA 1H5TA 4NALA 4EE5A 4J18A 2RITA 1JVGA 4FRDA 3R2WA 5C4EA 1JVDA 5DDVA 5FTVA 3V0QA 4ASJA 1ZI1A 2X65A 1H5SD 4Y7TA 1MC3A 4MIXA 5CMGX 1H5TB 4FCUA 1VGWA 3E26A 4Y7FA 5C1GA 2E3DA 2Y7AA 3F1YA 2YC5A 1ZJ2A 2FYAA 2RJ4A 4D11A 2YC3A 3V91A 4FCEA 2OEGA 3I0JA 5CMHA 1VM8A 2RIXA 1FXOA 3EE5A 2GGQA 2A8WA 3K8EA 5CQPA 3OH3A 5C1LA 5CMFX 1KWSA 4MNDA 4HO4A 5CQLX 1IIMA 4D0TA 3ZLLA 1NF5B 3KIAA 5C3DA 4IRPA 1ZCVA 4HO0A 1OQMB 4FRLA 4Y64A 1TW5A 4KC4A 2OI5A 1G9RA 1VICA 2V0LA 3OKRA 4R7PA 3HL3A 4C2SA 1W57A 1FRWA 5C1HA 4Y6NA 4K6RA 1I52A 3SXDA 4FROA 1GA8A 2VSIA 1FGXA 1ZDGA 5C4DA 1YP4A 2A8UA 1FR9A 3TQDA 2WVLA 4HO9A 3U2XA 3ZGGA 1V84A 1G3LA 2AM3A 4UEGA 5FU8A 4Y62A 3OH1A 4G3QA 3SXBA 5FYEA 1VGUA 1LZIA 3Q80A 1VZXA 4AAWA 3OH0A 1NHEB 3I0DA 3R3IA 2ZU8A 2RJ9A 1QGQA 1NKHB 2X60A 4KC1A 5CQNX 4LW6A 4XWIA 2Y4LA 2P73A 2RIZA 1WVCA 2VSHA 3RMVA 2AECA 1ZHJA 3I0FA 2PA4A 4JD0A 2VK9A 4BMAA 2W0VA 3U2VA 1H7EA 2Y6PA 2I5KA 2O1HA 4FRQA 4DECA 4ECMA 2FYCB 3BCVA 4Y9XA 1ON6A 1H7GA 1YP3A 5I1FA 1G1LA 2BO7A 4YS8A 4B4BA 5AJPA 2YQSA 1VGZA 5AJNA 1YROB 1S4OA 2C0NA 1H5RA 4NAIA 4M2AA 1O23B 4EEMA 1G23A 2WEEA 5L6SA 4EEGA 3D8VA 4M28A 1H4DA 4GBPA 1LL0A 4FRHA 1NQIB 1GQ9A 2PX7A 1H5RB 2Q4JA 1YP2A 1FO8A 1K4VA 5C36A 2O1GA 3OGZA 5HS2A 1HM0A 4Q7CA 1ON8A 2DPWA 2OI6A 3I0KA 4M2BA 2D7RA 3I0HA 5AJOA 4AYJA 5D92A 4DDZA 2VXLA 4P02A 1FWYA 5CQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO2 A;  4AC3 A;  2FFV A;  4M4K A;  1MP5 A;  1JV3 A;  3I0G A;  2FYB A;  2JCL A;  1G8O A;  2Y4M A;  4FRA A;  1ZJ3 A;  2WVK A;  3CKN A;  3OC9 A;  1WT3 A;  4NAN A;  4B3U A;  1ZDF A;  2I5E A;  1XHB A;  1VH3 A;  2V0K A;  3LW6 A;  3U0X A;  2D0J A;  1HJL A;  3V0L A;  1VZU A;  3JUJ A;  1R7Y A;  1H7Q A;  5EJZ A;  3RSB A;  5C4B A;  1QWJ A;  1HJJ A;  4B5B A;  2GGO A;  3E25 A;  1INJ A;  5CQM X;  1LVW A;  1MP4 A;  4AYL A;  3T7O A;  4KT7 A;  4D0Z A;  2P72 A;  1E5K A;  1O0R A;  3PKQ A;  4G3P A;  1EZI A;  4CJC A;  1V83 A;  3NGW A;  2I7B A;  2QH5 A;  2VS5 A;  3I0E A;  4EE3 A;  5FTS A;  3V8Y A;  1LL2 A;  3O3P A;  4B42 A;  1H7T A;  2JCK A;  5C8R A;  2RJ1 A;  1S4N A;  4FRM A;  2Z86 A;  1H7H A;  1H4C A;  3SXA A;  1LL3 A;  3DUV A;  1VGT A;  4HG6 A;  3JTJ A;  4KRV A;  3T7N A;  2V0J A;  3ST8 A;  2XWM A;  1S4P A;  3V0P A;  5CMI A;  3TZT A;  2XWN A;  1R7U A;  3SX5 A;  1G97 A;  3SX3 A;  3D5N A;  3FWW A;  1ZJO A;  1LZJ A;  2AE7 A;  1LZ7 A;  1QGS A;  1O7O A;  2XWL A;  2XME A;  2AGD A;  2RIY A;  2UX8 A;  4EVW A;  4B2X A;  1TW1 A;  2OEF A;  4HOC A;  2RJ6 A;  2FFU A;  3Q7U A;  4HO8 A;  1FR8 A;  1MP3 A;  1NWG B;  4HCQ A;  2ICY A;  2VS4 A;  3CU0 A;  5DDT A;  1INI A;  4EEA A;  1OMZ A;  3D98 A;  2V0H A;  5C48 A;  4B4M A;  4Y63 A;  5EIY A;  2CU2 A;  5IDT A;  2BO4 A;  2PGY A;  2X5S A;  3OH2 A;  2RJ5 A;  3SXE A;  1R81 A;  5C49 A;  2PGV A;  3SX7 A;  3RMW A;  1EYR A;  3DJ4 A;  1ZCY A;  2Z87 A;  5C38 A;  2BO6 A;  3U2T A;  5C4F A;  5CMJ A;  2YES A;  3PNN A;  4KC2 A;  4KQL A;  1HV9 A;  1ZI5 A;  4HO5 A;  2V0I A;  2OI7 A;  2ICX A;  2RJ7 A;  4KXO A;  3SX8 A;  1H5S C;  2YCM A;  1H4E A;  2VS3 A;  1W77 A;  1LZ0 A;  1FOA A;  5C3B A;  2JCO A;  5C3A A;  3POL A;  2FY7 A;  1WT2 A;  2QGI A;  1FXJ A;  2E8B A;  3USQ A;  5FV9 A;  2QKX A;  5IDS A;  3I0I X;  3ZGF A;  2ZU9 A;  3ZF8 A;  3V0O A;  4Y6U A;  5C47 A;  1HM9 A;  4B4G A;  3I0C A;  1ZCT A;  1NMM B;  1IIN A;  4ASY A;  3PKP A;  1PZY B;  5L6V A;  2Y4J A;  2FYD B;  1GWV A;  1WT1 A;  1FGG A;  5J49 A;  2WAW A;  4EE4 A;  4IRQ A;  5FU0 A;  2WVM A;  2YQC A;  4CJB A;  4G87 A;  1JYK A;  3CKO A;  4D48 A;  1FG5 N;  4BQH A;  1OMX A;  1VPA A;  2XMH A;  3ZLK A;  4EEO A;  4CJ8 A;  1VH1 A;  3I0L A;  2RJ8 A;  1W55 A;  3U2W A;  1G2V A;  1SS9 A;  1JYL A;  3K8D A;  3OAM A;  1WT0 A;  3FOQ A;  3N9W A;  3U2U A;  2W0W A;  2WE9 A;  1ZJP A;  2O1F A;  4HO3 A;  4FQW A;  1TVY A;  4KPZ A;  1R82 A;  5FUH A;  1R7T A;  1R7X A;  2MZB A;  3Q4S A;  1ZI3 A;  3GUE A;  2AM5 A;  2AH9 A;  2WGZ A;  1PZT A;  1ZJ1 A;  5IFY A;  4LW3 A;  4FRB A;  2D7I A;  3OH4 A;  2RJ0 A;  3USR A;  3F1C A;  4G3S A;  3T7M A;  1H7L A;  1V82 A;  1H5S A;  1HM8 A;  1VZT A;  2AES A;  3JUK A;  5C4C A;  4JIS A;  3SXG A;  1FO9 A;  1G95 A;  3CKV A;  4Y7U A;  2Y4K A;  3QVB A;  1ZIZ A;  1Z90 A;  2VFZ A;  2X5Z A;  4L41 C;  1ZJ0 A;  1R7V A;  1H5S B;  1R80 A;  3CKQ A;  4FRP A;  5JQQ A;  1FZW A;  3V0M A;  2YQJ A;  3SXC A;  4KNX A;  1O7Q A;  2VXM A;  2P6W A;  1ZCU A;  1H3M A;  1JV1 A;  4D11 C;  1GX0 A;  1ZI4 A;  5BXC A;  3CGX A;  1GX4 A;  5EJ1 A;  3SPT A;  1G0R A;  2NXV A;  4NAK A;  4CVH A;  3CKJ A;  1TZF A;  1QG8 A;  2VD4 A;  3V90 A;  2ZU7 A;  4DE7 A;  4Y7V A;  4P00 A;  4FRE A;  3BRK X;  3V8Z A;  1H7F A;  1GQC A;  4KNR A;  2JCJ A;  1WSZ A;  4KPX A;  3DK5 A;  3IOI A;  4MYB A;  3IOJ A;  2YQH A;  1XZ6 A;  4ZDQ A;  1G93 A;  2BO8 A;  2AM4 A;  4ARW A;  4E1K A;  2APC A;  4HO6 A;  4B2W A;  3IOH A;  4Y7G A;  3U0Y A;  1GWW A;  3V0N A;  1H5T A;  4NAL A;  4EE5 A;  4J18 A;  2RIT A;  1JVG A;  4FRD A;  3R2W A;  5C4E A;  1JVD A;  5DDV A;  5FTV A;  3V0Q A;  4ASJ A;  1ZI1 A;  2X65 A;  1H5S D;  4Y7T A;  1MC3 A;  5CMG X;  1H5T B;  4FCU A;  1VGW A;  3E26 A;  4Y7F A;  5C1G A;  2E3D A;  2Y7A A;  3F1Y A;  2YC5 A;  1ZJ2 A;  2FYA A;  2RJ4 A;  4D11 A;  2YC3 A;  3V91 A;  4FCE A;  2OEG A;  3I0J A;  5CMH A;  1VM8 A;  2RIX A;  1FXO A;  3EE5 A;  2GGQ A;  2A8W A;  3K8E A;  5CQP A;  3OH3 A;  5C1L A;  5CMF X;  1KWS A;  4MND A;  4HO4 A;  5CQL X;  1IIM A;  4D0T A;  3ZLL A;  1NF5 B;  3KIA A;  5C3D A;  4IRP A;  1ZCV A;  4HO0 A;  1OQM B;  4FRL A;  4Y64 A;  1TW5 A;  4KC4 A;  2OI5 A;  1G9R A;  1VIC A;  2V0L A;  3OKR A;  4R7P A;  3HL3 A;  4C2S A;  1W57 A;  1FRW A;  5C1H A;  4Y6N A;  4K6R A;  1I52 A;  3SXD A;  4FRO A;  1GA8 A;  2VSI A;  1FGX A;  1ZDG A;  5C4D A;  1YP4 A;  2A8U A;  1FR9 A;  3TQD A;  2WVL A;  4HO9 A;  3U2X A;  3ZGG A;  1V84 A;  1G3L A;  2AM3 A;  4UEG A;  5FU8 A;  4Y62 A;  3OH1 A;  4G3Q A;  3SXB A;  5FYE A;  1VGU A;  1LZI A;  3Q80 A;  1VZX A;  4AAW A;  3OH0 A;  1NHE B;  3I0D A;  3R3I A;  2ZU8 A;  2RJ9 A;  1QGQ A;  1NKH B;  2X60 A;  4KC1 A;  5CQN X;  4LW6 A;  4XWI A;  2Y4L A;  2P73 A;  2RIZ A;  1WVC A;  2VSH A;  3RMV A;  2AEC A;  1ZHJ A;  3I0F A;  2PA4 A;  4JD0 A;  4BMA A;  2W0V A;  3U2V A;  1H7E A;  2Y6P A;  2I5K A;  2O1H A;  4FRQ A;  4DEC A;  4ECM A;  2FYC B;  3BCV A;  4Y9X A;  1ON6 A;  1H7G A;  1YP3 A;  5I1F A;  1G1L A;  2BO7 A;  4YS8 A;  4B4B A;  5AJP A;  2YQS A;  1VGZ A;  5AJN A;  1YRO B;  1S4O A;  1H5R A;  4NAI A;  4M2A A;  1O23 B;  4EEM A;  1G23 A;  2WEE A;  5L6S A;  4EEG A;  3D8V A;  4M28 A;  1H4D A;  4GBP A;  1LL0 A;  4FRH A;  1NQI B;  1GQ9 A;  2PX7 A;  1H5R B;  2Q4J A;  1YP2 A;  1FO8 A;  1K4V A;  5C36 A;  2O1G A;  3OGZ A;  5HS2 A;  1HM0 A;  1ON8 A;  2DPW A;  2OI6 A;  3I0K A;  4M2B A;  2D7R A;  3I0H A;  5AJO A;  4AYJ A;  4DDZ A;  2VXL A;  4P02 A;  1FWY A;  5CQO A; 
#chains in the Genus database with same CATH topology
 4HO2 A;  4AC3 A;  2FFV A;  4M4K A;  1MP5 A;  1JV3 A;  3I0G A;  2FYB A;  2JCL A;  1G8O A;  2Y4M A;  4FRA A;  1ZJ3 A;  2WVK A;  3CKN A;  3OC9 A;  1WT3 A;  4NAN A;  4B3U A;  1ZDF A;  2I5E A;  1XHB A;  1VH3 A;  2V0K A;  3LW6 A;  2J0A A;  3U0X A;  2D0J A;  1HJL A;  3V0L A;  1VZU A;  3JUJ A;  1R7Y A;  1H7Q A;  5EJZ A;  3RSB A;  5C4B A;  1QWJ A;  1HJJ A;  4B5B A;  2GGO A;  3E25 A;  1INJ A;  5CQM X;  1LVW A;  1MP4 A;  4AYL A;  3T7O A;  4KT7 A;  4D0Z A;  2P72 A;  1E5K A;  1O0R A;  3PKQ A;  4G3P A;  1EZI A;  4CJC A;  1V83 A;  3NGW A;  2I7B A;  2QH5 A;  2VS5 A;  3I0E A;  4EE3 A;  5FTS A;  3V8Y A;  1LL2 A;  3O3P A;  4B42 A;  1H7T A;  2JCK A;  5C8R A;  2RJ1 A;  1S4N A;  4FRM A;  2Z86 A;  1H7H A;  1H4C A;  3SXA A;  1LL3 A;  3DUV A;  1VGT A;  4HG6 A;  3JTJ A;  4KRV A;  3T7N A;  2V0J A;  3ST8 A;  2XWM A;  1S4P A;  3V0P A;  5CMI A;  3TZT A;  2XWN A;  1R7U A;  3SX5 A;  1G97 A;  3SX3 A;  4FIX A;  3D5N A;  3FWW A;  1ZJO A;  1LZJ A;  2AE7 A;  4O6N A;  1LZ7 A;  1QGS A;  1O7O A;  2XWL A;  2XME A;  2AGD A;  2RIY A;  2UX8 A;  4EVW A;  4B2X A;  1TW1 A;  2OEF A;  4HOC A;  2RJ6 A;  2FFU A;  3Q7U A;  4HO8 A;  1FR8 A;  1MP3 A;  1NWG B;  4HCQ A;  2ICY A;  2VS4 A;  3CU0 A;  5DDT A;  1INI A;  4EEA A;  1OMZ A;  3D98 A;  2V0H A;  5C48 A;  4B4M A;  4Y63 A;  5EIY A;  2CU2 A;  5IDT A;  2BO4 A;  2PGY A;  2X5S A;  3OH2 A;  2RJ5 A;  3SXE A;  1R81 A;  5C49 A;  2PGV A;  3SX7 A;  3RMW A;  1EYR A;  3DJ4 A;  1ZCY A;  2Z87 A;  5C38 A;  2BO6 A;  3U2T A;  5C4F A;  5CMJ A;  2YES A;  3PNN A;  4KC2 A;  4KQL A;  1HV9 A;  1ZI5 A;  4HO5 A;  2V0I A;  2OI7 A;  2ICX A;  2RJ7 A;  4KXO A;  3SX8 A;  1H5S C;  2YCM A;  1H4E A;  2VS3 A;  1W77 A;  1LZ0 A;  1FOA A;  5C3B A;  2JCO A;  5D91 A;  3POL A;  5C3A A;  2FY7 A;  1WT2 A;  2QGI A;  1FXJ A;  2E8B A;  3USQ A;  5FV9 A;  2QKX A;  5IDS A;  3I0I X;  3ZGF A;  2ZU9 A;  3ZF8 A;  3V0O A;  4Y6U A;  5C47 A;  1HM9 A;  4B4G A;  3I0C A;  1ZCT A;  1NMM B;  4O6M A;  1IIN A;  4ASY A;  3PKP A;  1PZY B;  5L6V A;  2Y4J A;  2FYD B;  1GWV A;  1WT1 A;  1FGG A;  5J49 A;  2WAW A;  4EE4 A;  4IRQ A;  5FU0 A;  2J0B A;  2WVM A;  2YQC A;  4CJB A;  4G87 A;  1JYK A;  3CKO A;  4D48 A;  1FG5 N;  4BQH A;  1OMX A;  1VPA A;  2XMH A;  3ZLK A;  4EEO A;  4CJ8 A;  1VH1 A;  3I0L A;  2RJ8 A;  1W55 A;  3U2W A;  1G2V A;  1SS9 A;  1JYL A;  3K8D A;  3OAM A;  1WT0 A;  3FOQ A;  3N9W A;  3U2U A;  2W0W A;  2WE9 A;  1ZJP A;  2O1F A;  4HO3 A;  4FQW A;  1TVY A;  4KPZ A;  1R82 A;  5FUH A;  1R7T A;  1R7X A;  2MZB A;  3Q4S A;  1ZI3 A;  3GUE A;  2AM5 A;  2AH9 A;  2WGZ A;  1PZT A;  1ZJ1 A;  5IFY A;  4LW3 A;  4FRB A;  2D7I A;  3OH4 A;  2RJ0 A;  3USR A;  3F1C A;  4G3S A;  3T7M A;  1H7L A;  1V82 A;  1H5S A;  1HM8 A;  1VZT A;  2AES A;  3JUK A;  5C4C A;  4JIS A;  3SXG A;  1FO9 A;  1G95 A;  3CKV A;  4Y7U A;  2Y4K A;  3QVB A;  1ZIZ A;  1Z90 A;  2VFZ A;  2X5Z A;  4L41 C;  1ZJ0 A;  1R7V A;  1H5S B;  1R80 A;  3CKQ A;  4FRP A;  5JQQ A;  1FZW A;  3V0M A;  2YQJ A;  3SXC A;  4KNX A;  1O7Q A;  2VXM A;  2P6W A;  1ZCU A;  1H3M A;  1JV1 A;  4D11 C;  1GX0 A;  1ZI4 A;  5BXC A;  3CGX A;  1GX4 A;  5EJ1 A;  3SPT A;  1G0R A;  2NXV A;  4NAK A;  4CVH A;  3CKJ A;  1TZF A;  1QG8 A;  2VD4 A;  3V90 A;  2ZU7 A;  4DE7 A;  4Y7V A;  4P00 A;  4FRE A;  3BRK X;  3V8Z A;  1H7F A;  1GQC A;  4KNR A;  2JCJ A;  1WSZ A;  4KPX A;  3DK5 A;  3IOI A;  4MYB A;  3IOJ A;  2YQH A;  1XZ6 A;  4ZDQ A;  1G93 A;  2BO8 A;  2AM4 A;  4ARW A;  4E1K A;  4FIY A;  2APC A;  4HO6 A;  4B2W A;  3IOH A;  4Y7G A;  3U0Y A;  1GWW A;  3V0N A;  1H5T A;  4NAL A;  4EE5 A;  4J18 A;  2RIT A;  1JVG A;  4FRD A;  3R2W A;  5C4E A;  1JVD A;  5DDV A;  5FTV A;  3V0Q A;  4ASJ A;  1ZI1 A;  2X65 A;  1H5S D;  4Y7T A;  1MC3 A;  4MIX A;  5CMG X;  1H5T B;  4FCU A;  1VGW A;  3E26 A;  4Y7F A;  5C1G A;  2E3D A;  2Y7A A;  3F1Y A;  2YC5 A;  1ZJ2 A;  2FYA A;  2RJ4 A;  4D11 A;  2YC3 A;  3V91 A;  4FCE A;  2OEG A;  3I0J A;  5CMH A;  1VM8 A;  2RIX A;  1FXO A;  3EE5 A;  2GGQ A;  2A8W A;  3K8E A;  5CQP A;  3OH3 A;  5C1L A;  5CMF X;  1KWS A;  4MND A;  4HO4 A;  5CQL X;  1IIM A;  4D0T A;  3ZLL A;  1NF5 B;  3KIA A;  5C3D A;  4IRP A;  1ZCV A;  4HO0 A;  1OQM B;  4FRL A;  4Y64 A;  1TW5 A;  4KC4 A;  2OI5 A;  1G9R A;  1VIC A;  2V0L A;  3OKR A;  4R7P A;  3HL3 A;  4C2S A;  1W57 A;  1FRW A;  5C1H A;  4Y6N A;  4K6R A;  1I52 A;  3SXD A;  4FRO A;  1GA8 A;  2VSI A;  1FGX A;  1ZDG A;  5C4D A;  1YP4 A;  2A8U A;  1FR9 A;  3TQD A;  2WVL A;  4HO9 A;  3U2X A;  3ZGG A;  1V84 A;  1G3L A;  2AM3 A;  4UEG A;  5FU8 A;  4Y62 A;  3OH1 A;  4G3Q A;  3SXB A;  5FYE A;  1VGU A;  1LZI A;  3Q80 A;  1VZX A;  4AAW A;  3OH0 A;  1NHE B;  3I0D A;  3R3I A;  2ZU8 A;  2RJ9 A;  1QGQ A;  1NKH B;  2X60 A;  4KC1 A;  5CQN X;  4LW6 A;  4XWI A;  2Y4L A;  2P73 A;  2RIZ A;  1WVC A;  2VSH A;  3RMV A;  2AEC A;  1ZHJ A;  3I0F A;  2PA4 A;  4JD0 A;  2VK9 A;  4BMA A;  2W0V A;  3U2V A;  1H7E A;  2Y6P A;  2I5K A;  2O1H A;  4FRQ A;  4DEC A;  4ECM A;  2FYC B;  3BCV A;  4Y9X A;  1ON6 A;  1H7G A;  1YP3 A;  5I1F A;  1G1L A;  2BO7 A;  4YS8 A;  4B4B A;  5AJP A;  2YQS A;  1VGZ A;  5AJN A;  1YRO B;  1S4O A;  2C0N A;  1H5R A;  4NAI A;  4M2A A;  1O23 B;  4EEM A;  1G23 A;  2WEE A;  5L6S A;  4EEG A;  3D8V A;  4M28 A;  1H4D A;  4GBP A;  1LL0 A;  4FRH A;  1NQI B;  1GQ9 A;  2PX7 A;  1H5R B;  2Q4J A;  1YP2 A;  1FO8 A;  1K4V A;  5C36 A;  2O1G A;  3OGZ A;  5HS2 A;  1HM0 A;  4Q7C A;  1ON8 A;  2DPW A;  2OI6 A;  3I0K A;  4M2B A;  2D7R A;  3I0H A;  5AJO A;  4AYJ A;  5D92 A;  4DDZ A;  2VXL A;  4P02 A;  1FWY A;  5CQO A; 
#chains in the Genus database with same CATH homology
 4HO2 A;  4AC3 A;  2FFV A;  4M4K A;  1MP5 A;  1JV3 A;  3I0G A;  2FYB A;  2JCL A;  1G8O A;  2Y4M A;  4FRA A;  1ZJ3 A;  2WVK A;  3CKN A;  3OC9 A;  1WT3 A;  4NAN A;  4B3U A;  1ZDF A;  2I5E A;  1XHB A;  1VH3 A;  2V0K A;  3LW6 A;  2J0A A;  3U0X A;  2D0J A;  1HJL A;  3V0L A;  1VZU A;  3JUJ A;  1R7Y A;  1H7Q A;  5EJZ A;  3RSB A;  5C4B A;  1QWJ A;  1HJJ A;  4B5B A;  2GGO A;  3E25 A;  1INJ A;  5CQM X;  1LVW A;  1MP4 A;  4AYL A;  3T7O A;  4KT7 A;  4D0Z A;  2P72 A;  1E5K A;  1O0R A;  3PKQ A;  4G3P A;  1EZI A;  4CJC A;  1V83 A;  3NGW A;  2I7B A;  2QH5 A;  2VS5 A;  3I0E A;  4EE3 A;  5FTS A;  3V8Y A;  1LL2 A;  3O3P A;  4B42 A;  1H7T A;  2JCK A;  5C8R A;  2RJ1 A;  1S4N A;  4FRM A;  2Z86 A;  1H7H A;  1H4C A;  3SXA A;  1LL3 A;  3DUV A;  1VGT A;  4HG6 A;  3JTJ A;  4KRV A;  3T7N A;  2V0J A;  3ST8 A;  2XWM A;  1S4P A;  3V0P A;  5CMI A;  3TZT A;  2XWN A;  1R7U A;  3SX5 A;  1G97 A;  3SX3 A;  4FIX A;  3D5N A;  3FWW A;  1ZJO A;  1LZJ A;  2AE7 A;  4O6N A;  1LZ7 A;  1QGS A;  1O7O A;  2XWL A;  2XME A;  2AGD A;  2RIY A;  2UX8 A;  4EVW A;  4B2X A;  1TW1 A;  2OEF A;  4HOC A;  2RJ6 A;  2FFU A;  3Q7U A;  4HO8 A;  1FR8 A;  1MP3 A;  1NWG B;  4HCQ A;  2ICY A;  2VS4 A;  3CU0 A;  5DDT A;  1INI A;  4EEA A;  1OMZ A;  3D98 A;  2V0H A;  5C48 A;  4B4M A;  4Y63 A;  5EIY A;  2CU2 A;  5IDT A;  2BO4 A;  2PGY A;  2X5S A;  3OH2 A;  2RJ5 A;  3SXE A;  1R81 A;  5C49 A;  2PGV A;  3SX7 A;  3RMW A;  1EYR A;  3DJ4 A;  1ZCY A;  2Z87 A;  5C38 A;  2BO6 A;  3U2T A;  5C4F A;  5CMJ A;  2YES A;  3PNN A;  4KC2 A;  4KQL A;  1HV9 A;  1ZI5 A;  4HO5 A;  2V0I A;  2OI7 A;  2ICX A;  2RJ7 A;  4KXO A;  3SX8 A;  1H5S C;  2YCM A;  1H4E A;  2VS3 A;  1W77 A;  1LZ0 A;  1FOA A;  5C3B A;  2JCO A;  5D91 A;  3POL A;  5C3A A;  2FY7 A;  1WT2 A;  2QGI A;  1FXJ A;  2E8B A;  3USQ A;  5FV9 A;  2QKX A;  5IDS A;  3I0I X;  3ZGF A;  2ZU9 A;  3ZF8 A;  3V0O A;  4Y6U A;  5C47 A;  1HM9 A;  4B4G A;  3I0C A;  1ZCT A;  1NMM B;  4O6M A;  1IIN A;  4ASY A;  3PKP A;  1PZY B;  5L6V A;  2Y4J A;  2FYD B;  1GWV A;  1WT1 A;  1FGG A;  5J49 A;  2WAW A;  4EE4 A;  4IRQ A;  5FU0 A;  2J0B A;  2WVM A;  2YQC A;  4CJB A;  4G87 A;  1JYK A;  3CKO A;  4D48 A;  1FG5 N;  4BQH A;  1OMX A;  1VPA A;  2XMH A;  3ZLK A;  4EEO A;  4CJ8 A;  1VH1 A;  3I0L A;  2RJ8 A;  1W55 A;  3U2W A;  1G2V A;  1SS9 A;  1JYL A;  3K8D A;  3OAM A;  1WT0 A;  3FOQ A;  3N9W A;  3U2U A;  2W0W A;  2WE9 A;  1ZJP A;  2O1F A;  4HO3 A;  4FQW A;  1TVY A;  4KPZ A;  1R82 A;  5FUH A;  1R7T A;  1R7X A;  2MZB A;  3Q4S A;  1ZI3 A;  3GUE A;  2AM5 A;  2AH9 A;  2WGZ A;  1PZT A;  1ZJ1 A;  5IFY A;  4LW3 A;  4FRB A;  2D7I A;  3OH4 A;  2RJ0 A;  3USR A;  3F1C A;  4G3S A;  3T7M A;  1H7L A;  1V82 A;  1H5S A;  1HM8 A;  1VZT A;  2AES A;  3JUK A;  5C4C A;  4JIS A;  3SXG A;  1FO9 A;  1G95 A;  3CKV A;  4Y7U A;  2Y4K A;  3QVB A;  1ZIZ A;  1Z90 A;  2VFZ A;  2X5Z A;  4L41 C;  1ZJ0 A;  1R7V A;  1H5S B;  1R80 A;  3CKQ A;  4FRP A;  5JQQ A;  1FZW A;  3V0M A;  2YQJ A;  3SXC A;  4KNX A;  1O7Q A;  2VXM A;  2P6W A;  1ZCU A;  1H3M A;  1JV1 A;  4D11 C;  1GX0 A;  1ZI4 A;  5BXC A;  3CGX A;  1GX4 A;  5EJ1 A;  3SPT A;  1G0R A;  2NXV A;  4NAK A;  4CVH A;  3CKJ A;  1TZF A;  1QG8 A;  2VD4 A;  3V90 A;  2ZU7 A;  4DE7 A;  4Y7V A;  4P00 A;  4FRE A;  3BRK X;  3V8Z A;  1H7F A;  1GQC A;  4KNR A;  2JCJ A;  1WSZ A;  4KPX A;  3DK5 A;  3IOI A;  4MYB A;  3IOJ A;  2YQH A;  1XZ6 A;  4ZDQ A;  1G93 A;  2BO8 A;  2AM4 A;  4ARW A;  4E1K A;  4FIY A;  2APC A;  4HO6 A;  4B2W A;  3IOH A;  4Y7G A;  3U0Y A;  1GWW A;  3V0N A;  1H5T A;  4NAL A;  4EE5 A;  4J18 A;  2RIT A;  1JVG A;  4FRD A;  3R2W A;  5C4E A;  1JVD A;  5DDV A;  5FTV A;  3V0Q A;  4ASJ A;  1ZI1 A;  2X65 A;  1H5S D;  4Y7T A;  1MC3 A;  4MIX A;  5CMG X;  1H5T B;  4FCU A;  1VGW A;  3E26 A;  4Y7F A;  5C1G A;  2E3D A;  2Y7A A;  3F1Y A;  2YC5 A;  1ZJ2 A;  2FYA A;  2RJ4 A;  4D11 A;  2YC3 A;  3V91 A;  4FCE A;  2OEG A;  3I0J A;  5CMH A;  1VM8 A;  2RIX A;  1FXO A;  3EE5 A;  2GGQ A;  2A8W A;  3K8E A;  5CQP A;  3OH3 A;  5C1L A;  5CMF X;  1KWS A;  4MND A;  4HO4 A;  5CQL X;  1IIM A;  4D0T A;  3ZLL A;  1NF5 B;  3KIA A;  5C3D A;  4IRP A;  1ZCV A;  4HO0 A;  1OQM B;  4FRL A;  4Y64 A;  1TW5 A;  4KC4 A;  2OI5 A;  1G9R A;  1VIC A;  2V0L A;  3OKR A;  4R7P A;  3HL3 A;  4C2S A;  1W57 A;  1FRW A;  5C1H A;  4Y6N A;  4K6R A;  1I52 A;  3SXD A;  4FRO A;  1GA8 A;  2VSI A;  1FGX A;  1ZDG A;  5C4D A;  1YP4 A;  2A8U A;  1FR9 A;  3TQD A;  2WVL A;  4HO9 A;  3U2X A;  3ZGG A;  1V84 A;  1G3L A;  2AM3 A;  4UEG A;  5FU8 A;  4Y62 A;  3OH1 A;  4G3Q A;  3SXB A;  5FYE A;  1VGU A;  1LZI A;  3Q80 A;  1VZX A;  4AAW A;  3OH0 A;  1NHE B;  3I0D A;  3R3I A;  2ZU8 A;  2RJ9 A;  1QGQ A;  1NKH B;  2X60 A;  4KC1 A;  5CQN X;  4LW6 A;  4XWI A;  2Y4L A;  2P73 A;  2RIZ A;  1WVC A;  2VSH A;  3RMV A;  2AEC A;  1ZHJ A;  3I0F A;  2PA4 A;  4JD0 A;  2VK9 A;  4BMA A;  2W0V A;  3U2V A;  1H7E A;  2Y6P A;  2I5K A;  2O1H A;  4FRQ A;  4DEC A;  4ECM A;  2FYC B;  3BCV A;  4Y9X A;  1ON6 A;  1H7G A;  1YP3 A;  5I1F A;  1G1L A;  2BO7 A;  4YS8 A;  4B4B A;  5AJP A;  2YQS A;  1VGZ A;  5AJN A;  1YRO B;  1S4O A;  2C0N A;  1H5R A;  4NAI A;  4M2A A;  1O23 B;  4EEM A;  1G23 A;  2WEE A;  5L6S A;  4EEG A;  3D8V A;  4M28 A;  1H4D A;  4GBP A;  1LL0 A;  4FRH A;  1NQI B;  1GQ9 A;  2PX7 A;  1H5R B;  2Q4J A;  1YP2 A;  1FO8 A;  1K4V A;  5C36 A;  2O1G A;  3OGZ A;  5HS2 A;  1HM0 A;  4Q7C A;  1ON8 A;  2DPW A;  2OI6 A;  3I0K A;  4M2B A;  2D7R A;  3I0H A;  5AJO A;  4AYJ A;  5D92 A;  4DDZ A;  2VXL A;  4P02 A;  1FWY A;  5CQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...