3SX7A

Crystal structure of abba+udp+gal with glycerol as the cryoprotectant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
285
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Sequence-dependent effects of cryoprotectants on the active sites of the human ABO(H) blood group A and B glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 285
sequence length 287
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sx7A00
4FCUA 1JYKA 3Q4SA 2YQHA 5C38A 5C3DA 1ZIZA 2FYAA 2RJ6A 1NF5B 1V84A 4CJ8A 2AM3A 2OI5A 2X5SA 1R80A 1G95A 3FOQA 1GWVA 4B4MA 2W0WA 4R7PA 5C4EA 3ST8A 1ZDGA 2GGQA 1K4VA 1ZJOA 4FRMA 2P72A 2O1HA 4JISA 2QH5A 4JD0A 1H7EA 5C48A 3O3PA 2RJ9A 1TW1A 3PNNA 4G3QA 1FZWA 3F1CA 4P00A 1Z90A 2ICYA 2O1FA 3POLA 2QGIA 1JYLA 1R7TA 3DK5A 4CJBA 3I0DA 1HM0A 1MP5A 2P73A 5CMFX 3SX5A 2V0JA 2Y4JA 5CQOA 4GBPA 4EE4A 3LW6A 1TZFA 1VGUA 2Y6PA 3I0GA 5CMJA 2Y4MA 3ZF8A 2Z87A 5BXCA 1S4NA 4M4KA 1ZI3A 5JQQA 3FWWA 2PA4A 1GX0A 1NKHB 1R81A 1IINA 4B4GA 3IOJA 4Y63A 2CU2A 2XMHA 1LL3A 1R7XA 1VZTA 3T7NA 4D48A 1ON8A 1NHEB 4KNXA 5FU8A 4FRAA 1PZTA 1G9RA 4MYBA 1G1LA 5C4DA 3OGZA 1V82A 3V0NA 1H5SC 1VH1A 4Y62A 2OEFA 4Y6UA 3Q80A 2P6WA 5FV9A 1W55A 1JVDA 4HOCA 1R82A 3K8EA 5C3AA 5CQMX 1LZ0A 4AAWA 1VGWA 4ECMA 3SX7A 3IOIA 2RJ0A 2DPWA 2ZU7A 4Y7TA 1PZYB 1ZHJA 3D98A 5AJOA 3USQA 2AE7A 4BMAA 2Y4LA 2D7IA 1VZUA 2VFZA 3USRA 2A8WA 4CJCA 4HO9A 1ZJPA 4G87A 4DE7A 1H7HA 1VH3A 1O7OA 2JCKA 4FCEA 3V0PA 3D8VA 1VICA 4KPXA 5CMGX 3OH0A 1TVYA 4B3UA 4HCQA 2NXVA 3TZTA 5CMHA 4KT7A 3JTJA 2I5EA 2AESA 2Q4JA 4FRBA 4K6RA 3DUVA 4EEOA 3DJ4A 5C4FA 1FGGA 1S4PA 4M28A 1ZJ2A 5FTSA 1G3LA 2WEEA 3CGXA 2UX8A 2V0HA 2XWLA 2AGDA 3HL3A 5AJPA 3I0EA 2AECA 1H4EA 4L41C 5HS2A 4KNRA 1NMMB 2X60A 5EJ1A 5C3BA 2OEGA 4FQWA 2RJ1A 1V83A 5IDSA 1WSZA 3E26A 2YC3A 3TQDA 2AH9A 5FUHA 4HO4A 1H5RA 1ZJ3A 5CMIA 5C4CA 4M2AA 3I0KA 1FOAA 1WT2A 2RJ4A 4HO2A 3CKNA 3OKRA 1R7YA 1FWYA 2RIZA 5CQNX 1MP4A 2AM4A 3I0LA 1G0RA 3U2WA 1INIA 2RIXA 3Q7UA 2PGYA 2YQCA 4HO8A 2WE9A 2X65A 2VXLA 3I0CA 4G3SA 2A8UA 4ZDQA 5J49A 1VM8A 2OI7A 1H7QA 4FRLA 2OI6A 1G93A 3I0IX 4ASJA 3U0XA 4NAIA 1LZ7A 1OQMB 1G23A 1OMXA 2X5ZA 5IFYA 1ZI1A 4ASYA 4KXOA 4EE5A 4DDZA 5FU0A 5CQLX 1NQIB 3V0QA 5L6SA 2BO7A 2VD4A 1FO8A 1G2VA 1G97A 5FYEA 5C4BA 1JV1A 1NWGB 4D0TA 2D0JA 3PKPA 2RITA 3NGWA 3BRKX 3V8YA 4MNDA 2WVMA 2YQSA 4AC3A 4M2BA 4IRQA 1JVGA 4NANA 2XWMA 4EEMA 1GQCA 3U0YA 4EEAA 4AYLA 5C1GA 2Y7AA 4CVHA 4HO0A 5CQPA 4FRHA 3I0JA 1YROB 4E1KA 2WAWA 4HO5A 4FRQA 4B42A 4D11A 2V0KA 1H4DA 1FXOA 2GGOA 1XHBA 1LL0A 3F1YA 5FTVA 4D11C 3SXGA 1LVWA 4P02A 1MP3A 1HJJA 1W77A 1GQ9A 3CKQA 2XMEA 5DDVA 1QG8A 2YC5A 4AYJA 1O7QA 1H7GA 1TW5A 4B2WA 1ZCUA 3BCVA 4FRPA 1ZJ0A 1E5KA 3N9WA 1QGQA 3U2TA 2O1GA 3V90A 1YP3A 4IRPA 1H5RB 1H7FA 1GWWA 1HV9A 4HG6A 1FRWA 1QGSA 3RMWA 2MZBA 2PX7A 3D5NA 3V0MA 3U2VA 1FO9A 5C47A 3ZLKA 1VGTA 2YQJA 2FYCB 4FREA 2PGVA 3V8ZA 1QWJA 3R3IA 3OH2A 3T7MA 4B5BA 4NAKA 1LL2A 1H5TB 4HO3A 1G8OA 1FG5N 1ZI4A 2ZU9A 2FFVA 4ARWA 3CU0A 5IDTA 1ZI5A 4XWIA 2D7RA 3ZLLA 3SXAA 4BQHA 2JCJA 4Y64A 2ZU8A 5EIYA 4KC2A 1FXJA 3EE5A 3JUKA 1I52A 4D0ZA 4Y7GA 3K8DA 2RJ8A 2VSIA 1W57A 2W0VA 1LZIA 2YESA 4UEGA 4EE3A 1ZCTA 2VS5A 4C2SA 1FR9A 1H5TA 1EZIA 2JCOA 3OH4A 1OMZA 2FY7A 2JCLA 3ZGGA 1HM9A 4KPZA 3SPTA 1YP4A 1H5SB 1O0RA 5DDTA 3RSBA 4DECA 5C36A 1LZJA 4LW3A 3U2XA 1HM8A 1R7VA 3U2UA 2Z86A 1VGZA 1VZXA 1FR8A 3RMVA 5L6VA 3V0OA 3GUEA 2XWNA 3SXEA 2BO8A 1INJA 1R7UA 2I5KA 4Y7VA 1H3MA 1ZCVA 3T7OA 1H7LA 1MC3A 4LW6A 5AJNA 4Y7UA 3OC9A 4EEGA 4J18A 2FYDB 3QVBA 1ZDFA 3SX8A 5C1LA 2AM5A 3SXDA 3ZGFA 1YP2A 4Y6NA 3PKQA 1H5SA 1XZ6A 2E3DA 1KWSA 3I0FA 5C49A 2YCMA 4B2XA 2VSHA 4G3PA 1WT3A 3KIAA 3OH1A 3CKJA 3I0HA 1GA8A 2APCA 3E25A 3SXCA 3V0LA 2E8BA 2WVKA 2FYBA 1H4CA 1ZJ1A 1S4OA 3OAMA 3SX3A 4KQLA 2BO4A 2QKXA 1WT0A 2VS3A 1H7TA 2RJ5A 2V0IA 4FROA 4Y9XA 1EYRA 2RIYA 5EJZA 3CKOA 1VPAA 4B4BA 2VXMA 1ZCYA 2VS4A 1IIMA 3OH3A 3V91A 1HJLA 4Y7FA 3R2WA 2FFUA 2WVLA 2WGZA 2I7BA 2BO6A 2Y4KA 1H5SD 1WVCA 1GX4A 2V0LA 3SXBA 1SS9A 1JV3A 3JUJA 3CKVA 5C1HA 5C8RA 4NALA 3IOHA 4HO6A 4KC4A 1WT1A 5I1FA 1ON6A 2ICXA 4FRDA 2RJ7A 4KRVA 4KC1A 1FGXA 4YS8A 4EVWA 1O23B
chains in the Genus database with same CATH superfamily
4FCUA 1JYKA 3Q4SA 2YQHA 5C38A 5C3DA 1ZIZA 2FYAA 2RJ6A 1NF5B 1V84A 4CJ8A 2AM3A 2OI5A 2X5SA 1R80A 1G95A 3FOQA 1GWVA 4B4MA 2W0WA 4R7PA 5C4EA 3ST8A 1ZDGA 2VK9A 2GGQA 1K4VA 1ZJOA 4FRMA 4O6MA 2P72A 2O1HA 4JISA 2QH5A 4JD0A 1H7EA 5C48A 3O3PA 2RJ9A 1TW1A 3PNNA 4G3QA 1FZWA 3F1CA 4P00A 1Z90A 2ICYA 2O1FA 3POLA 2QGIA 1JYLA 1R7TA 3DK5A 4CJBA 3I0DA 1HM0A 1MP5A 2P73A 5CMFX 3SX5A 2V0JA 2Y4JA 5CQOA 2J0AA 4GBPA 4EE4A 3LW6A 1TZFA 1VGUA 2Y6PA 3I0GA 5CMJA 2Y4MA 3ZF8A 2Z87A 5BXCA 1S4NA 4M4KA 1ZI3A 5JQQA 3FWWA 2PA4A 1GX0A 1NKHB 1R81A 1IINA 4B4GA 3IOJA 4Y63A 2CU2A 2XMHA 1LL3A 1R7XA 1VZTA 3T7NA 4D48A 1ON8A 4MIXA 1NHEB 4KNXA 5FU8A 4FRAA 1PZTA 1G9RA 2C0NA 4MYBA 1G1LA 5C4DA 3OGZA 1V82A 3V0NA 1H5SC 1VH1A 4Y62A 2OEFA 4Y6UA 3Q80A 2P6WA 5FV9A 1W55A 1JVDA 4HOCA 1R82A 3K8EA 5C3AA 5CQMX 1LZ0A 4AAWA 1VGWA 4ECMA 3SX7A 3IOIA 2RJ0A 2DPWA 2ZU7A 4Y7TA 1PZYB 1ZHJA 3D98A 5AJOA 3USQA 2AE7A 4BMAA 2Y4LA 2D7IA 1VZUA 2VFZA 3USRA 2A8WA 4CJCA 4HO9A 1ZJPA 4G87A 4DE7A 1H7HA 1VH3A 1O7OA 2JCKA 4FCEA 3V0PA 3D8VA 1VICA 4KPXA 5CMGX 3OH0A 1TVYA 4B3UA 4HCQA 2J0BA 2NXVA 3TZTA 5CMHA 4KT7A 3JTJA 2I5EA 2AESA 2Q4JA 4FRBA 4K6RA 3DUVA 4EEOA 3DJ4A 5C4FA 1FGGA 1S4PA 4M28A 1ZJ2A 4FIYA 5FTSA 1G3LA 2WEEA 3CGXA 2UX8A 2V0HA 2XWLA 2AGDA 3HL3A 5AJPA 3I0EA 2AECA 1H4EA 4L41C 5HS2A 4KNRA 1NMMB 2X60A 5EJ1A 5C3BA 2OEGA 4FQWA 2RJ1A 1V83A 5IDSA 1WSZA 3E26A 2YC3A 3TQDA 2AH9A 5FUHA 4HO4A 1H5RA 1ZJ3A 5CMIA 5C4CA 4M2AA 3I0KA 1FOAA 1WT2A 2RJ4A 4HO2A 3CKNA 3OKRA 1R7YA 1FWYA 2RIZA 5CQNX 1MP4A 2AM4A 3I0LA 1G0RA 3U2WA 1INIA 2RIXA 3Q7UA 2PGYA 2YQCA 4HO8A 2WE9A 2X65A 2VXLA 3I0CA 4G3SA 2A8UA 4ZDQA 5J49A 1VM8A 2OI7A 1H7QA 4FRLA 2OI6A 1G93A 3I0IX 4ASJA 3U0XA 4NAIA 1LZ7A 1OQMB 1G23A 1OMXA 2X5ZA 5IFYA 1ZI1A 4ASYA 4KXOA 4EE5A 4DDZA 5FU0A 5CQLX 1NQIB 3V0QA 5L6SA 2BO7A 2VD4A 1FO8A 1G2VA 1G97A 5FYEA 5C4BA 1JV1A 1NWGB 4Q7CA 2D0JA 3PKPA 4D0TA 2RITA 3NGWA 3BRKX 3V8YA 4MNDA 2WVMA 2YQSA 4AC3A 4M2BA 4IRQA 1JVGA 4NANA 2XWMA 4EEMA 1GQCA 3U0YA 4EEAA 4AYLA 5C1GA 2Y7AA 4CVHA 4HO0A 5CQPA 4FRHA 3I0JA 1YROB 4E1KA 2WAWA 4HO5A 4FRQA 5D92A 4B42A 4D11A 2V0KA 1H4DA 1FXOA 2GGOA 1XHBA 1LL0A 3F1YA 5FTVA 4D11C 3SXGA 1LVWA 4P02A 1MP3A 1HJJA 1W77A 1GQ9A 3CKQA 2XMEA 5DDVA 1QG8A 2YC5A 4AYJA 1O7QA 1H7GA 1TW5A 4B2WA 1ZCUA 5D91A 3BCVA 4FRPA 1ZJ0A 1E5KA 3N9WA 4FIXA 1QGQA 3U2TA 2O1GA 3V90A 1YP3A 4IRPA 1H5RB 1H7FA 1GWWA 1HV9A 4HG6A 1FRWA 1QGSA 3RMWA 2MZBA 2PX7A 3D5NA 3V0MA 3U2VA 1FO9A 5C47A 3ZLKA 1VGTA 2YQJA 2FYCB 4FREA 2PGVA 3V8ZA 1QWJA 3R3IA 3OH2A 3T7MA 4B5BA 4NAKA 1LL2A 1H5TB 4HO3A 1G8OA 1FG5N 1ZI4A 2ZU9A 2FFVA 4ARWA 3CU0A 5IDTA 1ZI5A 4XWIA 2D7RA 3ZLLA 3SXAA 4BQHA 2JCJA 4Y64A 2ZU8A 5EIYA 4KC2A 1FXJA 3EE5A 3JUKA 1I52A 4D0ZA 4Y7GA 3K8DA 2RJ8A 2VSIA 1W57A 2W0VA 1LZIA 2YESA 4UEGA 4EE3A 1ZCTA 2VS5A 4C2SA 1FR9A 1H5TA 1EZIA 2JCOA 3OH4A 1OMZA 2FY7A 2JCLA 3ZGGA 1HM9A 4KPZA 3SPTA 1YP4A 1H5SB 1O0RA 5DDTA 3RSBA 4DECA 5C36A 1LZJA 4LW3A 3U2XA 1HM8A 1R7VA 3U2UA 2Z86A 1VGZA 1VZXA 1FR8A 3RMVA 5L6VA 3V0OA 3GUEA 2XWNA 3SXEA 2BO8A 1INJA 1R7UA 2I5KA 4Y7VA 1H3MA 1ZCVA 3T7OA 1H7LA 1MC3A 4LW6A 5AJNA 4Y7UA 3OC9A 4EEGA 4J18A 2FYDB 3QVBA 1ZDFA 3SX8A 5C1LA 2AM5A 3SXDA 3ZGFA 1YP2A 4Y6NA 3PKQA 1H5SA 1XZ6A 2E3DA 1KWSA 3I0FA 5C49A 2YCMA 4B2XA 2VSHA 4G3PA 1WT3A 3KIAA 3OH1A 3CKJA 3I0HA 1GA8A 2APCA 3E25A 3SXCA 3V0LA 4O6NA 2E8BA 2WVKA 2FYBA 1H4CA 1ZJ1A 1S4OA 3OAMA 3SX3A 4KQLA 2BO4A 2QKXA 1WT0A 2VS3A 1H7TA 2RJ5A 2V0IA 4FROA 4Y9XA 1EYRA 2RIYA 5EJZA 3CKOA 1VPAA 4B4BA 2VXMA 1ZCYA 2VS4A 1IIMA 3OH3A 3V91A 1HJLA 4Y7FA 3R2WA 2FFUA 2WVLA 2WGZA 2I7BA 2BO6A 2Y4KA 1H5SD 1WVCA 1GX4A 2V0LA 3SXBA 1SS9A 1JV3A 3JUJA 3CKVA 5C1HA 5C8RA 4NALA 3IOHA 4HO6A 4KC4A 1WT1A 5I1FA 1ON6A 2ICXA 4FRDA 2RJ7A 4KRVA 4KC1A 1FGXA 4YS8A 4EVWA 1O23B
chains in the Genus database with same CATH topology
4FCUA 1JYKA 3Q4SA 2YQHA 5C38A 5C3DA 1ZIZA 2FYAA 2RJ6A 1NF5B 1V84A 4CJ8A 2AM3A 2OI5A 2X5SA 1R80A 1G95A 3FOQA 1GWVA 4B4MA 2W0WA 4R7PA 5C4EA 3ST8A 1ZDGA 2VK9A 2GGQA 1K4VA 1ZJOA 4FRMA 4O6MA 2P72A 2O1HA 4JISA 2QH5A 4JD0A 1H7EA 5C48A 3O3PA 2RJ9A 1TW1A 3PNNA 4G3QA 1FZWA 3F1CA 4P00A 1Z90A 2ICYA 2O1FA 3POLA 2QGIA 1JYLA 1R7TA 3DK5A 4CJBA 3I0DA 1HM0A 1MP5A 2P73A 5CMFX 3SX5A 2V0JA 2Y4JA 5CQOA 2J0AA 4GBPA 4EE4A 3LW6A 1TZFA 1VGUA 2Y6PA 3I0GA 5CMJA 2Y4MA 3ZF8A 2Z87A 5BXCA 1S4NA 4M4KA 1ZI3A 5JQQA 3FWWA 2PA4A 1GX0A 1NKHB 1R81A 1IINA 4B4GA 3IOJA 4Y63A 2CU2A 2XMHA 1LL3A 1R7XA 1VZTA 3T7NA 4D48A 1ON8A 4MIXA 1NHEB 4KNXA 5FU8A 4FRAA 1PZTA 1G9RA 2C0NA 4MYBA 1G1LA 5C4DA 3OGZA 1V82A 3V0NA 1H5SC 1VH1A 4Y62A 2OEFA 4Y6UA 3Q80A 2P6WA 5FV9A 1W55A 1JVDA 4HOCA 1R82A 3K8EA 5C3AA 5CQMX 1LZ0A 4AAWA 1VGWA 4ECMA 3SX7A 3IOIA 2RJ0A 2DPWA 2ZU7A 4Y7TA 1PZYB 1ZHJA 3D98A 5AJOA 3USQA 2AE7A 4BMAA 2Y4LA 2D7IA 1VZUA 2VFZA 3USRA 2A8WA 4CJCA 4HO9A 1ZJPA 4G87A 4DE7A 1H7HA 1VH3A 1O7OA 2JCKA 4FCEA 3V0PA 3D8VA 1VICA 4KPXA 5CMGX 3OH0A 1TVYA 4B3UA 4HCQA 2J0BA 2NXVA 3TZTA 5CMHA 4KT7A 3JTJA 2I5EA 2AESA 2Q4JA 4FRBA 4K6RA 3DUVA 4EEOA 3DJ4A 5C4FA 1FGGA 1S4PA 4M28A 1ZJ2A 4FIYA 5FTSA 1G3LA 2WEEA 3CGXA 2UX8A 2V0HA 2XWLA 2AGDA 3HL3A 5AJPA 3I0EA 2AECA 1H4EA 4L41C 5HS2A 4KNRA 1NMMB 2X60A 5EJ1A 5C3BA 2OEGA 4FQWA 2RJ1A 1V83A 5IDSA 1WSZA 3E26A 2YC3A 3TQDA 2AH9A 5FUHA 4HO4A 1H5RA 1ZJ3A 5CMIA 5C4CA 4M2AA 3I0KA 1FOAA 1WT2A 2RJ4A 4HO2A 3CKNA 3OKRA 1R7YA 1FWYA 2RIZA 5CQNX 1MP4A 2AM4A 3I0LA 1G0RA 3U2WA 1INIA 2RIXA 3Q7UA 2PGYA 2YQCA 4HO8A 2WE9A 2X65A 2VXLA 3I0CA 4G3SA 2A8UA 4ZDQA 5J49A 1VM8A 2OI7A 1H7QA 4FRLA 2OI6A 1G93A 3I0IX 4ASJA 3U0XA 4NAIA 1LZ7A 1OQMB 1G23A 1OMXA 2X5ZA 5IFYA 1ZI1A 4ASYA 4KXOA 4EE5A 4DDZA 5FU0A 5CQLX 1NQIB 3V0QA 5L6SA 2BO7A 2VD4A 1FO8A 1G2VA 1G97A 5FYEA 5C4BA 1JV1A 1NWGB 4Q7CA 2D0JA 3PKPA 4D0TA 2RITA 3NGWA 3BRKX 3V8YA 4MNDA 2WVMA 2YQSA 4AC3A 4M2BA 4IRQA 1JVGA 4NANA 2XWMA 4EEMA 1GQCA 3U0YA 4EEAA 4AYLA 5C1GA 2Y7AA 4CVHA 4HO0A 5CQPA 4FRHA 3I0JA 1YROB 4E1KA 2WAWA 4HO5A 4FRQA 5D92A 4B42A 4D11A 2V0KA 1H4DA 1FXOA 2GGOA 1XHBA 1LL0A 3F1YA 5FTVA 4D11C 3SXGA 1LVWA 4P02A 1MP3A 1HJJA 1W77A 1GQ9A 3CKQA 2XMEA 5DDVA 1QG8A 2YC5A 4AYJA 1O7QA 1H7GA 1TW5A 4B2WA 1ZCUA 5D91A 3BCVA 4FRPA 1ZJ0A 1E5KA 3N9WA 4FIXA 1QGQA 3U2TA 2O1GA 3V90A 1YP3A 4IRPA 1H5RB 1H7FA 1GWWA 1HV9A 4HG6A 1FRWA 1QGSA 3RMWA 2MZBA 2PX7A 3D5NA 3V0MA 3U2VA 1FO9A 5C47A 3ZLKA 1VGTA 2YQJA 2FYCB 4FREA 2PGVA 3V8ZA 1QWJA 3R3IA 3OH2A 3T7MA 4B5BA 4NAKA 1LL2A 1H5TB 4HO3A 1G8OA 1FG5N 1ZI4A 2ZU9A 2FFVA 4ARWA 3CU0A 5IDTA 1ZI5A 4XWIA 2D7RA 3ZLLA 3SXAA 4BQHA 2JCJA 4Y64A 2ZU8A 5EIYA 4KC2A 1FXJA 3EE5A 3JUKA 1I52A 4D0ZA 4Y7GA 3K8DA 2RJ8A 2VSIA 1W57A 2W0VA 1LZIA 2YESA 4UEGA 4EE3A 1ZCTA 2VS5A 4C2SA 1FR9A 1H5TA 1EZIA 2JCOA 3OH4A 1OMZA 2FY7A 2JCLA 3ZGGA 1HM9A 4KPZA 3SPTA 1YP4A 1H5SB 1O0RA 5DDTA 3RSBA 4DECA 5C36A 1LZJA 4LW3A 3U2XA 1HM8A 1R7VA 3U2UA 2Z86A 1VGZA 1VZXA 1FR8A 3RMVA 5L6VA 3V0OA 3GUEA 2XWNA 3SXEA 2BO8A 1INJA 1R7UA 2I5KA 4Y7VA 1H3MA 1ZCVA 3T7OA 1H7LA 1MC3A 4LW6A 5AJNA 4Y7UA 3OC9A 4EEGA 4J18A 2FYDB 3QVBA 1ZDFA 3SX8A 5C1LA 2AM5A 3SXDA 3ZGFA 1YP2A 4Y6NA 3PKQA 1H5SA 1XZ6A 2E3DA 1KWSA 3I0FA 5C49A 2YCMA 4B2XA 2VSHA 4G3PA 1WT3A 3KIAA 3OH1A 3CKJA 3I0HA 1GA8A 2APCA 3E25A 3SXCA 3V0LA 4O6NA 2E8BA 2WVKA 2FYBA 1H4CA 1ZJ1A 1S4OA 3OAMA 3SX3A 4KQLA 2BO4A 2QKXA 1WT0A 2VS3A 1H7TA 2RJ5A 2V0IA 4FROA 4Y9XA 1EYRA 2RIYA 5EJZA 3CKOA 1VPAA 4B4BA 2VXMA 1ZCYA 2VS4A 1IIMA 3OH3A 3V91A 1HJLA 4Y7FA 3R2WA 2FFUA 2WVLA 2WGZA 2I7BA 2BO6A 2Y4KA 1H5SD 1WVCA 1GX4A 2V0LA 3SXBA 1SS9A 1JV3A 3JUJA 3CKVA 5C1HA 5C8RA 4NALA 3IOHA 4HO6A 4KC4A 1WT1A 5I1FA 1ON6A 2ICXA 4FRDA 2RJ7A 4KRVA 4KC1A 1FGXA 4YS8A 4EVWA 1O23B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCU A;  1JYK A;  3Q4S A;  2YQH A;  5C38 A;  5C3D A;  1ZIZ A;  2FYA A;  2RJ6 A;  1NF5 B;  1V84 A;  4CJ8 A;  2AM3 A;  2OI5 A;  2X5S A;  1R80 A;  1G95 A;  3FOQ A;  1GWV A;  4B4M A;  2W0W A;  4R7P A;  5C4E A;  3ST8 A;  1ZDG A;  2GGQ A;  1K4V A;  1ZJO A;  4FRM A;  2P72 A;  2O1H A;  4JIS A;  2QH5 A;  4JD0 A;  1H7E A;  5C48 A;  3O3P A;  2RJ9 A;  1TW1 A;  3PNN A;  4G3Q A;  1FZW A;  3F1C A;  4P00 A;  1Z90 A;  2ICY A;  2O1F A;  3POL A;  2QGI A;  1JYL A;  1R7T A;  3DK5 A;  4CJB A;  3I0D A;  1HM0 A;  1MP5 A;  2P73 A;  5CMF X;  3SX5 A;  2V0J A;  2Y4J A;  5CQO A;  4GBP A;  4EE4 A;  3LW6 A;  1TZF A;  1VGU A;  2Y6P A;  3I0G A;  5CMJ A;  2Y4M A;  3ZF8 A;  2Z87 A;  5BXC A;  1S4N A;  4M4K A;  1ZI3 A;  5JQQ A;  3FWW A;  2PA4 A;  1GX0 A;  1NKH B;  1R81 A;  1IIN A;  4B4G A;  3IOJ A;  4Y63 A;  2CU2 A;  2XMH A;  1LL3 A;  1R7X A;  1VZT A;  3T7N A;  4D48 A;  1ON8 A;  1NHE B;  4KNX A;  5FU8 A;  4FRA A;  1PZT A;  1G9R A;  4MYB A;  1G1L A;  5C4D A;  3OGZ A;  1V82 A;  3V0N A;  1H5S C;  1VH1 A;  4Y62 A;  2OEF A;  4Y6U A;  3Q80 A;  2P6W A;  5FV9 A;  1W55 A;  1JVD A;  4HOC A;  1R82 A;  3K8E A;  5C3A A;  5CQM X;  1LZ0 A;  4AAW A;  1VGW A;  4ECM A;  3SX7 A;  3IOI A;  2RJ0 A;  2DPW A;  2ZU7 A;  4Y7T A;  1PZY B;  1ZHJ A;  3D98 A;  5AJO A;  3USQ A;  2AE7 A;  4BMA A;  2Y4L A;  2D7I A;  1VZU A;  2VFZ A;  3USR A;  2A8W A;  4CJC A;  4HO9 A;  1ZJP A;  4G87 A;  4DE7 A;  1H7H A;  1VH3 A;  1O7O A;  2JCK A;  4FCE A;  3V0P A;  3D8V A;  1VIC A;  4KPX A;  5CMG X;  3OH0 A;  1TVY A;  4B3U A;  4HCQ A;  2NXV A;  3TZT A;  5CMH A;  4KT7 A;  3JTJ A;  2I5E A;  2AES A;  2Q4J A;  4FRB A;  4K6R A;  3DUV A;  4EEO A;  3DJ4 A;  5C4F A;  1FGG A;  1S4P A;  4M28 A;  1ZJ2 A;  5FTS A;  1G3L A;  2WEE A;  3CGX A;  2UX8 A;  2V0H A;  2XWL A;  2AGD A;  3HL3 A;  5AJP A;  3I0E A;  2AEC A;  1H4E A;  4L41 C;  5HS2 A;  4KNR A;  1NMM B;  2X60 A;  5EJ1 A;  5C3B A;  2OEG A;  4FQW A;  2RJ1 A;  1V83 A;  5IDS A;  1WSZ A;  3E26 A;  2YC3 A;  3TQD A;  2AH9 A;  5FUH A;  4HO4 A;  1H5R A;  1ZJ3 A;  5CMI A;  5C4C A;  4M2A A;  3I0K A;  1FOA A;  1WT2 A;  2RJ4 A;  4HO2 A;  3CKN A;  3OKR A;  1R7Y A;  1FWY A;  2RIZ A;  5CQN X;  1MP4 A;  2AM4 A;  3I0L A;  1G0R A;  3U2W A;  1INI A;  2RIX A;  3Q7U A;  2PGY A;  2YQC A;  4HO8 A;  2WE9 A;  2X65 A;  2VXL A;  3I0C A;  4G3S A;  2A8U A;  4ZDQ A;  5J49 A;  1VM8 A;  2OI7 A;  1H7Q A;  4FRL A;  2OI6 A;  1G93 A;  3I0I X;  4ASJ A;  3U0X A;  4NAI A;  1LZ7 A;  1OQM B;  1G23 A;  1OMX A;  2X5Z A;  5IFY A;  1ZI1 A;  4ASY A;  4KXO A;  4EE5 A;  4DDZ A;  5FU0 A;  5CQL X;  1NQI B;  3V0Q A;  5L6S A;  2BO7 A;  2VD4 A;  1FO8 A;  1G2V A;  1G97 A;  5FYE A;  5C4B A;  1JV1 A;  1NWG B;  4D0T A;  2D0J A;  3PKP A;  2RIT A;  3NGW A;  3BRK X;  3V8Y A;  4MND A;  2WVM A;  2YQS A;  4AC3 A;  4M2B A;  4IRQ A;  1JVG A;  4NAN A;  2XWM A;  4EEM A;  1GQC A;  3U0Y A;  4EEA A;  4AYL A;  5C1G A;  2Y7A A;  4CVH A;  4HO0 A;  5CQP A;  4FRH A;  3I0J A;  1YRO B;  4E1K A;  2WAW A;  4HO5 A;  4FRQ A;  4B42 A;  4D11 A;  2V0K A;  1H4D A;  1FXO A;  2GGO A;  1XHB A;  1LL0 A;  3F1Y A;  5FTV A;  4D11 C;  3SXG A;  1LVW A;  4P02 A;  1MP3 A;  1HJJ A;  1W77 A;  1GQ9 A;  3CKQ A;  2XME A;  5DDV A;  1QG8 A;  2YC5 A;  4AYJ A;  1O7Q A;  1H7G A;  1TW5 A;  4B2W A;  1ZCU A;  3BCV A;  4FRP A;  1ZJ0 A;  1E5K A;  3N9W A;  1QGQ A;  3U2T A;  2O1G A;  3V90 A;  1YP3 A;  4IRP A;  1H5R B;  1H7F A;  1GWW A;  1HV9 A;  4HG6 A;  1FRW A;  1QGS A;  3RMW A;  2MZB A;  2PX7 A;  3D5N A;  3V0M A;  3U2V A;  1FO9 A;  5C47 A;  3ZLK A;  1VGT A;  2YQJ A;  2FYC B;  4FRE A;  2PGV A;  3V8Z A;  1QWJ A;  3R3I A;  3OH2 A;  3T7M A;  4B5B A;  4NAK A;  1LL2 A;  1H5T B;  4HO3 A;  1G8O A;  1FG5 N;  1ZI4 A;  2ZU9 A;  2FFV A;  4ARW A;  3CU0 A;  5IDT A;  1ZI5 A;  4XWI A;  2D7R A;  3ZLL A;  3SXA A;  4BQH A;  2JCJ A;  4Y64 A;  2ZU8 A;  5EIY A;  4KC2 A;  1FXJ A;  3EE5 A;  3JUK A;  1I52 A;  4D0Z A;  4Y7G A;  3K8D A;  2RJ8 A;  2VSI A;  1W57 A;  2W0V A;  1LZI A;  2YES A;  4UEG A;  4EE3 A;  1ZCT A;  2VS5 A;  4C2S A;  1FR9 A;  1H5T A;  1EZI A;  2JCO A;  3OH4 A;  1OMZ A;  2FY7 A;  2JCL A;  3ZGG A;  1HM9 A;  4KPZ A;  3SPT A;  1YP4 A;  1H5S B;  1O0R A;  5DDT A;  3RSB A;  4DEC A;  5C36 A;  1LZJ A;  4LW3 A;  3U2X A;  1HM8 A;  1R7V A;  3U2U A;  2Z86 A;  1VGZ A;  1VZX A;  1FR8 A;  3RMV A;  5L6V A;  3V0O A;  3GUE A;  2XWN A;  3SXE A;  2BO8 A;  1INJ A;  1R7U A;  2I5K A;  4Y7V A;  1H3M A;  1ZCV A;  3T7O A;  1H7L A;  1MC3 A;  4LW6 A;  5AJN A;  4Y7U A;  3OC9 A;  4EEG A;  4J18 A;  2FYD B;  3QVB A;  1ZDF A;  3SX8 A;  5C1L A;  2AM5 A;  3SXD A;  3ZGF A;  1YP2 A;  4Y6N A;  3PKQ A;  1H5S A;  1XZ6 A;  2E3D A;  1KWS A;  3I0F A;  5C49 A;  2YCM A;  4B2X A;  2VSH A;  4G3P A;  1WT3 A;  3KIA A;  3OH1 A;  3CKJ A;  3I0H A;  1GA8 A;  2APC A;  3E25 A;  3SXC A;  3V0L A;  2E8B A;  2WVK A;  2FYB A;  1H4C A;  1ZJ1 A;  1S4O A;  3OAM A;  3SX3 A;  4KQL A;  2BO4 A;  2QKX A;  1WT0 A;  2VS3 A;  1H7T A;  2RJ5 A;  2V0I A;  4FRO A;  4Y9X A;  1EYR A;  2RIY A;  5EJZ A;  3CKO A;  1VPA A;  4B4B A;  2VXM A;  1ZCY A;  2VS4 A;  1IIM A;  3OH3 A;  3V91 A;  1HJL A;  4Y7F A;  3R2W A;  2FFU A;  2WVL A;  2WGZ A;  2I7B A;  2BO6 A;  2Y4K A;  1H5S D;  1WVC A;  1GX4 A;  2V0L A;  3SXB A;  1SS9 A;  1JV3 A;  3JUJ A;  3CKV A;  5C1H A;  5C8R A;  4NAL A;  3IOH A;  4HO6 A;  4KC4 A;  1WT1 A;  5I1F A;  1ON6 A;  2ICX A;  4FRD A;  2RJ7 A;  4KRV A;  4KC1 A;  1FGX A;  4YS8 A;  4EVW A;  1O23 B; 
#chains in the Genus database with same CATH topology
 4FCU A;  1JYK A;  3Q4S A;  2YQH A;  5C38 A;  5C3D A;  1ZIZ A;  2FYA A;  2RJ6 A;  1NF5 B;  1V84 A;  4CJ8 A;  2AM3 A;  2OI5 A;  2X5S A;  1R80 A;  1G95 A;  3FOQ A;  1GWV A;  4B4M A;  2W0W A;  4R7P A;  5C4E A;  3ST8 A;  1ZDG A;  2VK9 A;  2GGQ A;  1K4V A;  1ZJO A;  4FRM A;  4O6M A;  2P72 A;  2O1H A;  4JIS A;  2QH5 A;  4JD0 A;  1H7E A;  5C48 A;  3O3P A;  2RJ9 A;  1TW1 A;  3PNN A;  4G3Q A;  1FZW A;  3F1C A;  4P00 A;  1Z90 A;  2ICY A;  2O1F A;  3POL A;  2QGI A;  1JYL A;  1R7T A;  3DK5 A;  4CJB A;  3I0D A;  1HM0 A;  1MP5 A;  2P73 A;  5CMF X;  3SX5 A;  2V0J A;  2Y4J A;  5CQO A;  2J0A A;  4GBP A;  4EE4 A;  3LW6 A;  1TZF A;  1VGU A;  2Y6P A;  3I0G A;  5CMJ A;  2Y4M A;  3ZF8 A;  2Z87 A;  5BXC A;  1S4N A;  4M4K A;  1ZI3 A;  5JQQ A;  3FWW A;  2PA4 A;  1GX0 A;  1NKH B;  1R81 A;  1IIN A;  4B4G A;  3IOJ A;  4Y63 A;  2CU2 A;  2XMH A;  1LL3 A;  1R7X A;  1VZT A;  3T7N A;  4D48 A;  1ON8 A;  4MIX A;  1NHE B;  4KNX A;  5FU8 A;  4FRA A;  1PZT A;  1G9R A;  2C0N A;  4MYB A;  1G1L A;  5C4D A;  3OGZ A;  1V82 A;  3V0N A;  1H5S C;  1VH1 A;  4Y62 A;  2OEF A;  4Y6U A;  3Q80 A;  2P6W A;  5FV9 A;  1W55 A;  1JVD A;  4HOC A;  1R82 A;  3K8E A;  5C3A A;  5CQM X;  1LZ0 A;  4AAW A;  1VGW A;  4ECM A;  3SX7 A;  3IOI A;  2RJ0 A;  2DPW A;  2ZU7 A;  4Y7T A;  1PZY B;  1ZHJ A;  3D98 A;  5AJO A;  3USQ A;  2AE7 A;  4BMA A;  2Y4L A;  2D7I A;  1VZU A;  2VFZ A;  3USR A;  2A8W A;  4CJC A;  4HO9 A;  1ZJP A;  4G87 A;  4DE7 A;  1H7H A;  1VH3 A;  1O7O A;  2JCK A;  4FCE A;  3V0P A;  3D8V A;  1VIC A;  4KPX A;  5CMG X;  3OH0 A;  1TVY A;  4B3U A;  4HCQ A;  2J0B A;  2NXV A;  3TZT A;  5CMH A;  4KT7 A;  3JTJ A;  2I5E A;  2AES A;  2Q4J A;  4FRB A;  4K6R A;  3DUV A;  4EEO A;  3DJ4 A;  5C4F A;  1FGG A;  1S4P A;  4M28 A;  1ZJ2 A;  4FIY A;  5FTS A;  1G3L A;  2WEE A;  3CGX A;  2UX8 A;  2V0H A;  2XWL A;  2AGD A;  3HL3 A;  5AJP A;  3I0E A;  2AEC A;  1H4E A;  4L41 C;  5HS2 A;  4KNR A;  1NMM B;  2X60 A;  5EJ1 A;  5C3B A;  2OEG A;  4FQW A;  2RJ1 A;  1V83 A;  5IDS A;  1WSZ A;  3E26 A;  2YC3 A;  3TQD A;  2AH9 A;  5FUH A;  4HO4 A;  1H5R A;  1ZJ3 A;  5CMI A;  5C4C A;  4M2A A;  3I0K A;  1FOA A;  1WT2 A;  2RJ4 A;  4HO2 A;  3CKN A;  3OKR A;  1R7Y A;  1FWY A;  2RIZ A;  5CQN X;  1MP4 A;  2AM4 A;  3I0L A;  1G0R A;  3U2W A;  1INI A;  2RIX A;  3Q7U A;  2PGY A;  2YQC A;  4HO8 A;  2WE9 A;  2X65 A;  2VXL A;  3I0C A;  4G3S A;  2A8U A;  4ZDQ A;  5J49 A;  1VM8 A;  2OI7 A;  1H7Q A;  4FRL A;  2OI6 A;  1G93 A;  3I0I X;  4ASJ A;  3U0X A;  4NAI A;  1LZ7 A;  1OQM B;  1G23 A;  1OMX A;  2X5Z A;  5IFY A;  1ZI1 A;  4ASY A;  4KXO A;  4EE5 A;  4DDZ A;  5FU0 A;  5CQL X;  1NQI B;  3V0Q A;  5L6S A;  2BO7 A;  2VD4 A;  1FO8 A;  1G2V A;  1G97 A;  5FYE A;  5C4B A;  1JV1 A;  1NWG B;  4Q7C A;  2D0J A;  3PKP A;  4D0T A;  2RIT A;  3NGW A;  3BRK X;  3V8Y A;  4MND A;  2WVM A;  2YQS A;  4AC3 A;  4M2B A;  4IRQ A;  1JVG A;  4NAN A;  2XWM A;  4EEM A;  1GQC A;  3U0Y A;  4EEA A;  4AYL A;  5C1G A;  2Y7A A;  4CVH A;  4HO0 A;  5CQP A;  4FRH A;  3I0J A;  1YRO B;  4E1K A;  2WAW A;  4HO5 A;  4FRQ A;  5D92 A;  4B42 A;  4D11 A;  2V0K A;  1H4D A;  1FXO A;  2GGO A;  1XHB A;  1LL0 A;  3F1Y A;  5FTV A;  4D11 C;  3SXG A;  1LVW A;  4P02 A;  1MP3 A;  1HJJ A;  1W77 A;  1GQ9 A;  3CKQ A;  2XME A;  5DDV A;  1QG8 A;  2YC5 A;  4AYJ A;  1O7Q A;  1H7G A;  1TW5 A;  4B2W A;  1ZCU A;  5D91 A;  3BCV A;  4FRP A;  1ZJ0 A;  1E5K A;  3N9W A;  4FIX A;  1QGQ A;  3U2T A;  2O1G A;  3V90 A;  1YP3 A;  4IRP A;  1H5R B;  1H7F A;  1GWW A;  1HV9 A;  4HG6 A;  1FRW A;  1QGS A;  3RMW A;  2MZB A;  2PX7 A;  3D5N A;  3V0M A;  3U2V A;  1FO9 A;  5C47 A;  3ZLK A;  1VGT A;  2YQJ A;  2FYC B;  4FRE A;  2PGV A;  3V8Z A;  1QWJ A;  3R3I A;  3OH2 A;  3T7M A;  4B5B A;  4NAK A;  1LL2 A;  1H5T B;  4HO3 A;  1G8O A;  1FG5 N;  1ZI4 A;  2ZU9 A;  2FFV A;  4ARW A;  3CU0 A;  5IDT A;  1ZI5 A;  4XWI A;  2D7R A;  3ZLL A;  3SXA A;  4BQH A;  2JCJ A;  4Y64 A;  2ZU8 A;  5EIY A;  4KC2 A;  1FXJ A;  3EE5 A;  3JUK A;  1I52 A;  4D0Z A;  4Y7G A;  3K8D A;  2RJ8 A;  2VSI A;  1W57 A;  2W0V A;  1LZI A;  2YES A;  4UEG A;  4EE3 A;  1ZCT A;  2VS5 A;  4C2S A;  1FR9 A;  1H5T A;  1EZI A;  2JCO A;  3OH4 A;  1OMZ A;  2FY7 A;  2JCL A;  3ZGG A;  1HM9 A;  4KPZ A;  3SPT A;  1YP4 A;  1H5S B;  1O0R A;  5DDT A;  3RSB A;  4DEC A;  5C36 A;  1LZJ A;  4LW3 A;  3U2X A;  1HM8 A;  1R7V A;  3U2U A;  2Z86 A;  1VGZ A;  1VZX A;  1FR8 A;  3RMV A;  5L6V A;  3V0O A;  3GUE A;  2XWN A;  3SXE A;  2BO8 A;  1INJ A;  1R7U A;  2I5K A;  4Y7V A;  1H3M A;  1ZCV A;  3T7O A;  1H7L A;  1MC3 A;  4LW6 A;  5AJN A;  4Y7U A;  3OC9 A;  4EEG A;  4J18 A;  2FYD B;  3QVB A;  1ZDF A;  3SX8 A;  5C1L A;  2AM5 A;  3SXD A;  3ZGF A;  1YP2 A;  4Y6N A;  3PKQ A;  1H5S A;  1XZ6 A;  2E3D A;  1KWS A;  3I0F A;  5C49 A;  2YCM A;  4B2X A;  2VSH A;  4G3P A;  1WT3 A;  3KIA A;  3OH1 A;  3CKJ A;  3I0H A;  1GA8 A;  2APC A;  3E25 A;  3SXC A;  3V0L A;  4O6N A;  2E8B A;  2WVK A;  2FYB A;  1H4C A;  1ZJ1 A;  1S4O A;  3OAM A;  3SX3 A;  4KQL A;  2BO4 A;  2QKX A;  1WT0 A;  2VS3 A;  1H7T A;  2RJ5 A;  2V0I A;  4FRO A;  4Y9X A;  1EYR A;  2RIY A;  5EJZ A;  3CKO A;  1VPA A;  4B4B A;  2VXM A;  1ZCY A;  2VS4 A;  1IIM A;  3OH3 A;  3V91 A;  1HJL A;  4Y7F A;  3R2W A;  2FFU A;  2WVL A;  2WGZ A;  2I7B A;  2BO6 A;  2Y4K A;  1H5S D;  1WVC A;  1GX4 A;  2V0L A;  3SXB A;  1SS9 A;  1JV3 A;  3JUJ A;  3CKV A;  5C1H A;  5C8R A;  4NAL A;  3IOH A;  4HO6 A;  4KC4 A;  1WT1 A;  5I1F A;  1ON6 A;  2ICX A;  4FRD A;  2RJ7 A;  4KRV A;  4KC1 A;  1FGX A;  4YS8 A;  4EVW A;  1O23 B; 
#chains in the Genus database with same CATH homology
 4FCU A;  1JYK A;  3Q4S A;  2YQH A;  5C38 A;  5C3D A;  1ZIZ A;  2FYA A;  2RJ6 A;  1NF5 B;  1V84 A;  4CJ8 A;  2AM3 A;  2OI5 A;  2X5S A;  1R80 A;  1G95 A;  3FOQ A;  1GWV A;  4B4M A;  2W0W A;  4R7P A;  5C4E A;  3ST8 A;  1ZDG A;  2VK9 A;  2GGQ A;  1K4V A;  1ZJO A;  4FRM A;  4O6M A;  2P72 A;  2O1H A;  4JIS A;  2QH5 A;  4JD0 A;  1H7E A;  5C48 A;  3O3P A;  2RJ9 A;  1TW1 A;  3PNN A;  4G3Q A;  1FZW A;  3F1C A;  4P00 A;  1Z90 A;  2ICY A;  2O1F A;  3POL A;  2QGI A;  1JYL A;  1R7T A;  3DK5 A;  4CJB A;  3I0D A;  1HM0 A;  1MP5 A;  2P73 A;  5CMF X;  3SX5 A;  2V0J A;  2Y4J A;  5CQO A;  2J0A A;  4GBP A;  4EE4 A;  3LW6 A;  1TZF A;  1VGU A;  2Y6P A;  3I0G A;  5CMJ A;  2Y4M A;  3ZF8 A;  2Z87 A;  5BXC A;  1S4N A;  4M4K A;  1ZI3 A;  5JQQ A;  3FWW A;  2PA4 A;  1GX0 A;  1NKH B;  1R81 A;  1IIN A;  4B4G A;  3IOJ A;  4Y63 A;  2CU2 A;  2XMH A;  1LL3 A;  1R7X A;  1VZT A;  3T7N A;  4D48 A;  1ON8 A;  4MIX A;  1NHE B;  4KNX A;  5FU8 A;  4FRA A;  1PZT A;  1G9R A;  2C0N A;  4MYB A;  1G1L A;  5C4D A;  3OGZ A;  1V82 A;  3V0N A;  1H5S C;  1VH1 A;  4Y62 A;  2OEF A;  4Y6U A;  3Q80 A;  2P6W A;  5FV9 A;  1W55 A;  1JVD A;  4HOC A;  1R82 A;  3K8E A;  5C3A A;  5CQM X;  1LZ0 A;  4AAW A;  1VGW A;  4ECM A;  3SX7 A;  3IOI A;  2RJ0 A;  2DPW A;  2ZU7 A;  4Y7T A;  1PZY B;  1ZHJ A;  3D98 A;  5AJO A;  3USQ A;  2AE7 A;  4BMA A;  2Y4L A;  2D7I A;  1VZU A;  2VFZ A;  3USR A;  2A8W A;  4CJC A;  4HO9 A;  1ZJP A;  4G87 A;  4DE7 A;  1H7H A;  1VH3 A;  1O7O A;  2JCK A;  4FCE A;  3V0P A;  3D8V A;  1VIC A;  4KPX A;  5CMG X;  3OH0 A;  1TVY A;  4B3U A;  4HCQ A;  2J0B A;  2NXV A;  3TZT A;  5CMH A;  4KT7 A;  3JTJ A;  2I5E A;  2AES A;  2Q4J A;  4FRB A;  4K6R A;  3DUV A;  4EEO A;  3DJ4 A;  5C4F A;  1FGG A;  1S4P A;  4M28 A;  1ZJ2 A;  4FIY A;  5FTS A;  1G3L A;  2WEE A;  3CGX A;  2UX8 A;  2V0H A;  2XWL A;  2AGD A;  3HL3 A;  5AJP A;  3I0E A;  2AEC A;  1H4E A;  4L41 C;  5HS2 A;  4KNR A;  1NMM B;  2X60 A;  5EJ1 A;  5C3B A;  2OEG A;  4FQW A;  2RJ1 A;  1V83 A;  5IDS A;  1WSZ A;  3E26 A;  2YC3 A;  3TQD A;  2AH9 A;  5FUH A;  4HO4 A;  1H5R A;  1ZJ3 A;  5CMI A;  5C4C A;  4M2A A;  3I0K A;  1FOA A;  1WT2 A;  2RJ4 A;  4HO2 A;  3CKN A;  3OKR A;  1R7Y A;  1FWY A;  2RIZ A;  5CQN X;  1MP4 A;  2AM4 A;  3I0L A;  1G0R A;  3U2W A;  1INI A;  2RIX A;  3Q7U A;  2PGY A;  2YQC A;  4HO8 A;  2WE9 A;  2X65 A;  2VXL A;  3I0C A;  4G3S A;  2A8U A;  4ZDQ A;  5J49 A;  1VM8 A;  2OI7 A;  1H7Q A;  4FRL A;  2OI6 A;  1G93 A;  3I0I X;  4ASJ A;  3U0X A;  4NAI A;  1LZ7 A;  1OQM B;  1G23 A;  1OMX A;  2X5Z A;  5IFY A;  1ZI1 A;  4ASY A;  4KXO A;  4EE5 A;  4DDZ A;  5FU0 A;  5CQL X;  1NQI B;  3V0Q A;  5L6S A;  2BO7 A;  2VD4 A;  1FO8 A;  1G2V A;  1G97 A;  5FYE A;  5C4B A;  1JV1 A;  1NWG B;  4Q7C A;  2D0J A;  3PKP A;  4D0T A;  2RIT A;  3NGW A;  3BRK X;  3V8Y A;  4MND A;  2WVM A;  2YQS A;  4AC3 A;  4M2B A;  4IRQ A;  1JVG A;  4NAN A;  2XWM A;  4EEM A;  1GQC A;  3U0Y A;  4EEA A;  4AYL A;  5C1G A;  2Y7A A;  4CVH A;  4HO0 A;  5CQP A;  4FRH A;  3I0J A;  1YRO B;  4E1K A;  2WAW A;  4HO5 A;  4FRQ A;  5D92 A;  4B42 A;  4D11 A;  2V0K A;  1H4D A;  1FXO A;  2GGO A;  1XHB A;  1LL0 A;  3F1Y A;  5FTV A;  4D11 C;  3SXG A;  1LVW A;  4P02 A;  1MP3 A;  1HJJ A;  1W77 A;  1GQ9 A;  3CKQ A;  2XME A;  5DDV A;  1QG8 A;  2YC5 A;  4AYJ A;  1O7Q A;  1H7G A;  1TW5 A;  4B2W A;  1ZCU A;  5D91 A;  3BCV A;  4FRP A;  1ZJ0 A;  1E5K A;  3N9W A;  4FIX A;  1QGQ A;  3U2T A;  2O1G A;  3V90 A;  1YP3 A;  4IRP A;  1H5R B;  1H7F A;  1GWW A;  1HV9 A;  4HG6 A;  1FRW A;  1QGS A;  3RMW A;  2MZB A;  2PX7 A;  3D5N A;  3V0M A;  3U2V A;  1FO9 A;  5C47 A;  3ZLK A;  1VGT A;  2YQJ A;  2FYC B;  4FRE A;  2PGV A;  3V8Z A;  1QWJ A;  3R3I A;  3OH2 A;  3T7M A;  4B5B A;  4NAK A;  1LL2 A;  1H5T B;  4HO3 A;  1G8O A;  1FG5 N;  1ZI4 A;  2ZU9 A;  2FFV A;  4ARW A;  3CU0 A;  5IDT A;  1ZI5 A;  4XWI A;  2D7R A;  3ZLL A;  3SXA A;  4BQH A;  2JCJ A;  4Y64 A;  2ZU8 A;  5EIY A;  4KC2 A;  1FXJ A;  3EE5 A;  3JUK A;  1I52 A;  4D0Z A;  4Y7G A;  3K8D A;  2RJ8 A;  2VSI A;  1W57 A;  2W0V A;  1LZI A;  2YES A;  4UEG A;  4EE3 A;  1ZCT A;  2VS5 A;  4C2S A;  1FR9 A;  1H5T A;  1EZI A;  2JCO A;  3OH4 A;  1OMZ A;  2FY7 A;  2JCL A;  3ZGG A;  1HM9 A;  4KPZ A;  3SPT A;  1YP4 A;  1H5S B;  1O0R A;  5DDT A;  3RSB A;  4DEC A;  5C36 A;  1LZJ A;  4LW3 A;  3U2X A;  1HM8 A;  1R7V A;  3U2U A;  2Z86 A;  1VGZ A;  1VZX A;  1FR8 A;  3RMV A;  5L6V A;  3V0O A;  3GUE A;  2XWN A;  3SXE A;  2BO8 A;  1INJ A;  1R7U A;  2I5K A;  4Y7V A;  1H3M A;  1ZCV A;  3T7O A;  1H7L A;  1MC3 A;  4LW6 A;  5AJN A;  4Y7U A;  3OC9 A;  4EEG A;  4J18 A;  2FYD B;  3QVB A;  1ZDF A;  3SX8 A;  5C1L A;  2AM5 A;  3SXD A;  3ZGF A;  1YP2 A;  4Y6N A;  3PKQ A;  1H5S A;  1XZ6 A;  2E3D A;  1KWS A;  3I0F A;  5C49 A;  2YCM A;  4B2X A;  2VSH A;  4G3P A;  1WT3 A;  3KIA A;  3OH1 A;  3CKJ A;  3I0H A;  1GA8 A;  2APC A;  3E25 A;  3SXC A;  3V0L A;  4O6N A;  2E8B A;  2WVK A;  2FYB A;  1H4C A;  1ZJ1 A;  1S4O A;  3OAM A;  3SX3 A;  4KQL A;  2BO4 A;  2QKX A;  1WT0 A;  2VS3 A;  1H7T A;  2RJ5 A;  2V0I A;  4FRO A;  4Y9X A;  1EYR A;  2RIY A;  5EJZ A;  3CKO A;  1VPA A;  4B4B A;  2VXM A;  1ZCY A;  2VS4 A;  1IIM A;  3OH3 A;  3V91 A;  1HJL A;  4Y7F A;  3R2W A;  2FFU A;  2WVL A;  2WGZ A;  2I7B A;  2BO6 A;  2Y4K A;  1H5S D;  1WVC A;  1GX4 A;  2V0L A;  3SXB A;  1SS9 A;  1JV3 A;  3JUJ A;  3CKV A;  5C1H A;  5C8R A;  4NAL A;  3IOH A;  4HO6 A;  4KC4 A;  1WT1 A;  5I1F A;  1ON6 A;  2ICX A;  4FRD A;  2RJ7 A;  4KRV A;  4KC1 A;  1FGX A;  4YS8 A;  4EVW A;  1O23 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...