3U2UA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese, udp and maltotetraose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u2uA00
4HO0A 1OQMB 2V0KA 1ZI3A 4B2WA 4D0ZA 1R7YA 1G8OA 2YQHA 2ZU8A 3V0NA 5CQOA 1GA8A 1ZJ2A 2X5SA 4B4BA 2VFZA 2XMHA 3PKQA 1LVWA 4Y9XA 2VS4A 3RSBA 3QVBA 3F1YA 4EEGA 2AE7A 1Z90A 4G87A 2YC3A 4Y62A 3SXEA 2Q4JA 2W0WA 2XWMA 5HS2A 5C1HA 2YQJA 3JTJA 1H4CA 1YP2A 1NQIB 4B4MA 3I0IX 3USQA 2Y4MA 1LL2A 2O1GA 1G0RA 5CMFX 1VGWA 2P73A 4NALA 2VXMA 2ZU9A 1VZXA 2OEFA 5CQPA 3U2VA 1H7LA 1VM8A 3IOHA 4MYBA 3T7NA 3CGXA 2NXVA 3V0OA 3SXCA 1LZ0A 2V0LA 4KXOA 1ZI5A 2MZBA 1R7UA 2XMEA 4HCQA 3U2UA 3T7MA 2ZU7A 4E1KA 4CJ8A 1EZIA 2WE9A 1H5SB 1WT1A 3I0EA 4M28A 1FO9A 5DDTA 5CQMX 4LW3A 1FGXA 1H5SD 1VH3A 5IFYA 1FO8A 1O23B 3RMVA 1MP3A 1H7HA 4UEGA 1H5TA 4DE7A 3V0PA 3E26A 1H4EA 2ICXA 3SXAA 3ZF8A 1VZUA 4KC4A 2JCLA 3U2XA 4BQHA 3E25A 4KNRA 2D7RA 5IDTA 1H4DA 1LL0A 3I0CA 2RJ1A 1HV9A 3I0HA 1G97A 4NANA 1GWWA 1V84A 4XWIA 1GWVA 1ZIZA 3JUKA 1ZI1A 4MNDA 1O7QA 3R2WA 2AM5A 1OMXA 3SXGA 1K4VA 2O1FA 4J18A 2OI5A 4CJCA 4EE5A 4NAKA 2AM3A 2WVMA 2QGIA 3I0LA 5C4BA 1H5RA 4HO5A 2RITA 4L41C 1INJA 2V0JA 4Y64A 5C38A 2JCOA 3TZTA 1FRWA 2Y4KA 1H7EA 4JISA 2BO7A 3DK5A 3ZGGA 3SXBA 1G95A 2PGVA 5CMJA 5C8RA 1QG8A 1HJLA 1JVDA 1XZ6A 1ZJ1A 5JQQA 2E8BA 1MP4A 2X5ZA 4HG6A 4HO4A 3K8EA 2FFUA 1R80A 2GGQA 3GUEA 1JYKA 2D0JA 2JCJA 1YP4A 1HJJA 5C47A 4Y7FA 3NGWA 2VS3A 3IOJA 2PA4A 2AECA 3TQDA 2PGYA 1G23A 3SPTA 2RIYA 1WT2A 1ZI4A 4FCUA 5L6VA 2WVKA 1TW1A 1GX4A 2RJ9A 2AGDA 3R3IA 4IRPA 1H7GA 4AYJA 4EEOA 2D7IA 3V8YA 4HO3A 5C4EA 1W77A 5BXCA 4D11C 4FRHA 2I5KA 3DUVA 2UX8A 3PNNA 3D98A 4FRAA 1TZFA 2RJ6A 2YESA 3OH4A 4ASYA 4FRPA 5CQLX 1H5SA 4FCEA 1ZJPA 1PZTA 2RJ8A 4ZDQA 4FRLA 2VS5A 2Y4JA 1JV1A 3I0KA 3I0JA 1O0RA 2VSIA 1MP5A 5C36A 4M2BA 4EEAA 3V0MA 3SX3A 4FROA 1PZYB 2V0IA 1QGSA 3I0FA 1W55A 4AYLA 1ON6A 1GQCA 1ZJ0A 5DDVA 4HOCA 5EIYA 5J49A 2PX7A 2YQSA 1ZCYA 1JV3A 3USRA 1HM9A 3FOQA 2Y6PA 2RIXA 3F1CA 1TW5A 1FR9A 2WEEA 1VICA 2DPWA 1FG5N 1ZCVA 4Y7VA 2Y7AA 1WSZA 4Y6NA 1ZCTA 3SX7A 1S4PA 4B3UA 1EYRA 1LL3A 4HO6A 4FRDA 2X65A 2YQCA 1NF5B 1VH1A 4EE3A 4FRBA 3SX5A 1LZJA 3OC9A 5FTSA 5C3AA 3I0GA 4KNXA 2BO6A 2AM4A 4Y7GA 4D11A 1E5KA 2XWLA 1R7VA 2A8WA 1ON8A 1IIMA 4B4GA 3T7OA 3Q4SA 3HL3A 2OI7A 3V90A 1ZDFA 5C3DA 3D8VA 5CMIA 3SX8A 4EVWA 4FRQA 4G3QA 3I0DA 1H5SC 3CKQA 3CKNA 3FWWA 2VXLA 1G93A 1R82A 2VSHA 2P6WA 2I5EA 4EEMA 4K6RA 2FYDB 2Y4LA 1IINA 1FXJA 1ZDGA 1VGZA 1HM8A 1JYLA 2CU2A 3BRKX 1G1LA 4Y7UA 2YC5A 5C1GA 1G2VA 5CMHA 1R81A 5CMGX 4KRVA 3U2TA 1S4OA 4D0TA 4Y7TA 4ARWA 2ICYA 5FU0A 1SS9A 3IOIA 1MC3A 3OH1A 1G9RA 1LZIA 4DECA 5C4CA 4KQLA 1NHEB 1VGTA 2VD4A 5C4FA 3K8DA 2AESA 4FREA 4P00A 1KWSA 1JVGA 5EJ1A 2Z86A 3V0QA 3LW6A 5C1LA 2OI6A 5EJZA 1VGUA 5L6SA 1NWGB 4AC3A 2V0HA 1FGGA 3BCVA 2RJ4A 4R7PA 3CU0A 4NAIA 4D48A 2X60A 3Q80A 4G3PA 2WAWA 2FFVA 4B2XA 1OMZA 1H7FA 4M2AA 3ZLKA 2OEGA 1V82A 5IDSA 1FZWA 4KC2A 5AJPA 4IRQA 1GX0A 2WVLA 3OAMA 5C3BA 4G3SA 5FUHA 1WT3A 2BO4A 2O1HA 3OH3A 3U2WA 4FQWA 5C4DA 2FY7A 2YCMA 4B42A 4CJBA 4BMAA 3RMWA 1GQ9A 1H7QA 4KPZA 5FYEA 4EE4A 2GGOA 3U0YA 4P02A 1ZCUA 5C49A 3SXDA 2Z87A 3POLA 4KC1A 1LZ7A 2XWNA 4KPXA 2FYBA 2FYCB 2RIZA 4FRMA 1FR8A 4AAWA 3CKVA 2BO8A 3DJ4A 2APCA 4CVHA 1YP3A 2FYAA 3ZGFA 1HM0A 5FU8A 1FWYA 1ZJOA 1INIA 1V83A 4C2SA 1O7OA 3V91A 1WT0A 2P72A 4GBPA 1H7TA 1QWJA 1WVCA 1W57A 3N9WA 4B5BA 1QGQA 3OKRA 2QKXA 1H5TB 3D5NA 2RJ5A 4JD0A 2JCKA 2AH9A 1NMMB 3PKPA 5FTVA 4ASJA 3Q7UA 3OGZA 2W0VA 1ZJ3A 3O3PA 3CKJA 5I1FA 4HO9A 1YROB 2RJ7A 3KIAA 1XHBA 4Y63A 1G3LA 3EE5A 3OH0A 4Y6UA 5C48A 1VPAA 4M4KA 3V0LA 3CKOA 5AJOA 2WGZA 2A8UA 4HO2A 5AJNA 5FV9A 1VZTA 4ECMA 2E3DA 3ZLLA 1TVYA 1R7TA 4DDZA 4HO8A 4YS8A 2I7BA 3JUJA 1S4NA 1I52A 1FOAA 1FXOA 3OH2A 1R7XA 3V8ZA 4KT7A 3ST8A 1NKHB 3U0XA 5CQNX 1H5RB 1H3MA 1ZHJA 4LW6A 2RJ0A 2QH5A
chains in the Genus database with same CATH superfamily
4HO0A 1OQMB 2V0KA 1ZI3A 4B2WA 4D0ZA 1R7YA 1G8OA 2YQHA 2ZU8A 3V0NA 5CQOA 1GA8A 1ZJ2A 2X5SA 4B4BA 2VFZA 2XMHA 3PKQA 1LVWA 4Y9XA 2VS4A 3RSBA 3QVBA 3F1YA 4EEGA 2AE7A 1Z90A 4G87A 2YC3A 4Y62A 3SXEA 2Q4JA 2W0WA 2XWMA 5HS2A 5C1HA 2YQJA 3JTJA 1H4CA 4FIYA 1YP2A 1NQIB 4B4MA 3I0IX 3USQA 2Y4MA 1LL2A 2O1GA 1G0RA 5CMFX 1VGWA 2P73A 4NALA 2VXMA 2ZU9A 1VZXA 2OEFA 4O6MA 5CQPA 3U2VA 1H7LA 1VM8A 3IOHA 4MYBA 3T7NA 3CGXA 2NXVA 3V0OA 3SXCA 1LZ0A 2V0LA 4KXOA 1ZI5A 2MZBA 1R7UA 2XMEA 4HCQA 3U2UA 3T7MA 2ZU7A 4E1KA 4CJ8A 1EZIA 2WE9A 1H5SB 1WT1A 3I0EA 4M28A 1FO9A 5DDTA 5CQMX 4LW3A 1FGXA 1H5SD 1VH3A 5IFYA 1FO8A 1O23B 3RMVA 1MP3A 1H7HA 4UEGA 1H5TA 4DE7A 3V0PA 4Q7CA 3E26A 1H4EA 2ICXA 3SXAA 3ZF8A 1VZUA 4KC4A 2JCLA 3U2XA 4BQHA 3E25A 4KNRA 2D7RA 5IDTA 1H4DA 1LL0A 3I0CA 2RJ1A 1HV9A 3I0HA 1G97A 4NANA 1GWWA 1V84A 4XWIA 1GWVA 1ZIZA 3JUKA 1ZI1A 4MNDA 1O7QA 3R2WA 2AM5A 1OMXA 3SXGA 1K4VA 2O1FA 4J18A 2OI5A 4CJCA 4EE5A 4NAKA 2AM3A 2WVMA 2QGIA 3I0LA 5C4BA 1H5RA 4HO5A 2RITA 4L41C 1INJA 2V0JA 4Y64A 5C38A 2JCOA 3TZTA 1FRWA 2Y4KA 1H7EA 4JISA 2BO7A 3DK5A 3ZGGA 3SXBA 1G95A 2PGVA 5CMJA 5C8RA 1QG8A 1HJLA 1JVDA 1XZ6A 1ZJ1A 5JQQA 2E8BA 1MP4A 2X5ZA 4HG6A 4HO4A 3K8EA 2FFUA 1R80A 2GGQA 3GUEA 1JYKA 2D0JA 2JCJA 1YP4A 1HJJA 5C47A 4Y7FA 3NGWA 2VS3A 3IOJA 2PA4A 2AECA 3TQDA 2PGYA 1G23A 3SPTA 2RIYA 1WT2A 1ZI4A 4FCUA 5L6VA 2WVKA 1TW1A 1GX4A 2RJ9A 2AGDA 3R3IA 4IRPA 1H7GA 4AYJA 4EEOA 2D7IA 3V8YA 4HO3A 5C4EA 1W77A 5BXCA 4D11C 4FRHA 2I5KA 3DUVA 2UX8A 3PNNA 3D98A 4FRAA 1TZFA 2RJ6A 2YESA 3OH4A 4ASYA 4FRPA 5CQLX 1H5SA 4FCEA 1ZJPA 1PZTA 2RJ8A 4ZDQA 4FRLA 2VS5A 2Y4JA 1JV1A 3I0KA 3I0JA 1O0RA 2VSIA 1MP5A 5C36A 4M2BA 4EEAA 3V0MA 3SX3A 4FROA 1PZYB 2V0IA 1QGSA 3I0FA 1W55A 4AYLA 1ON6A 1GQCA 1ZJ0A 5DDVA 4HOCA 5EIYA 5J49A 2PX7A 5D91A 2YQSA 1ZCYA 1JV3A 3USRA 1HM9A 3FOQA 2Y6PA 2RIXA 3F1CA 1TW5A 1FR9A 2WEEA 1VICA 2DPWA 1FG5N 1ZCVA 4Y7VA 2Y7AA 1WSZA 4Y6NA 1ZCTA 3SX7A 1S4PA 4B3UA 1EYRA 1LL3A 2C0NA 4FRDA 2X65A 4HO6A 2YQCA 1NF5B 1VH1A 4EE3A 4FRBA 3SX5A 1LZJA 3OC9A 5FTSA 5C3AA 3I0GA 4KNXA 2BO6A 5D92A 2AM4A 4Y7GA 4D11A 1E5KA 2XWLA 1R7VA 2A8WA 1ON8A 1IIMA 4B4GA 3T7OA 3Q4SA 3HL3A 2OI7A 3V90A 1ZDFA 5C3DA 3D8VA 5CMIA 3SX8A 4EVWA 4FRQA 4G3QA 3I0DA 1H5SC 3CKQA 3CKNA 3FWWA 2VXLA 1G93A 1R82A 2VSHA 2P6WA 2I5EA 4EEMA 4K6RA 2VK9A 2FYDB 2Y4LA 1IINA 1FXJA 1ZDGA 1VGZA 1HM8A 2J0AA 1JYLA 2CU2A 3BRKX 1G1LA 4Y7UA 2YC5A 5C1GA 1G2VA 5CMHA 1R81A 5CMGX 4KRVA 3U2TA 1S4OA 4D0TA 4Y7TA 4ARWA 2ICYA 5FU0A 1SS9A 3IOIA 1MC3A 3OH1A 1G9RA 1LZIA 4DECA 5C4CA 4O6NA 4KQLA 1NHEB 1VGTA 2VD4A 5C4FA 3K8DA 2AESA 4FREA 4P00A 1KWSA 1JVGA 5EJ1A 2Z86A 3V0QA 3LW6A 5C1LA 2OI6A 5EJZA 1VGUA 5L6SA 1NWGB 4AC3A 2V0HA 1FGGA 3BCVA 2RJ4A 4R7PA 3CU0A 4NAIA 4D48A 2X60A 3Q80A 4G3PA 2WAWA 2FFVA 4B2XA 1OMZA 1H7FA 4M2AA 3ZLKA 2OEGA 1V82A 5IDSA 1FZWA 4KC2A 5AJPA 4IRQA 1GX0A 2WVLA 3OAMA 5C3BA 4G3SA 5FUHA 1WT3A 2BO4A 2O1HA 4MIXA 3OH3A 3U2WA 4FQWA 5C4DA 2FY7A 2YCMA 4B42A 4CJBA 4BMAA 3RMWA 1GQ9A 1H7QA 4KPZA 5FYEA 4EE4A 2GGOA 3U0YA 4P02A 1ZCUA 5C49A 3SXDA 2Z87A 3POLA 4KC1A 1LZ7A 2XWNA 4KPXA 2FYBA 2FYCB 2RIZA 4FRMA 1FR8A 4AAWA 3CKVA 2BO8A 3DJ4A 2APCA 4CVHA 1YP3A 2FYAA 3ZGFA 1HM0A 5FU8A 1FWYA 1ZJOA 1INIA 1V83A 4C2SA 1O7OA 3V91A 1WT0A 2P72A 4GBPA 1H7TA 1QWJA 1WVCA 1W57A 3N9WA 4B5BA 1QGQA 3OKRA 2QKXA 1H5TB 3D5NA 2RJ5A 2J0BA 4JD0A 2JCKA 2AH9A 1NMMB 3PKPA 5FTVA 4ASJA 3Q7UA 3OGZA 2W0VA 1ZJ3A 3O3PA 3CKJA 5I1FA 4HO9A 1YROB 2RJ7A 3KIAA 1XHBA 4Y63A 1G3LA 3EE5A 3OH0A 4Y6UA 5C48A 1VPAA 4M4KA 3V0LA 3CKOA 5AJOA 2WGZA 2A8UA 4HO2A 5AJNA 5FV9A 1VZTA 4ECMA 2E3DA 3ZLLA 1TVYA 1R7TA 4DDZA 4HO8A 4YS8A 2I7BA 3JUJA 1S4NA 1I52A 1FOAA 1FXOA 3OH2A 1R7XA 3V8ZA 4KT7A 4FIXA 3ST8A 1NKHB 3U0XA 5CQNX 1H5RB 1H3MA 1ZHJA 4LW6A 2RJ0A 2QH5A
chains in the Genus database with same CATH topology
4HO0A 1OQMB 2V0KA 1ZI3A 4B2WA 4D0ZA 1R7YA 1G8OA 2YQHA 2ZU8A 3V0NA 5CQOA 1GA8A 1ZJ2A 2X5SA 4B4BA 2VFZA 2XMHA 3PKQA 1LVWA 4Y9XA 2VS4A 3RSBA 3QVBA 3F1YA 4EEGA 2AE7A 1Z90A 4G87A 2YC3A 4Y62A 3SXEA 2Q4JA 2W0WA 2XWMA 5HS2A 5C1HA 2YQJA 3JTJA 1H4CA 4FIYA 1YP2A 1NQIB 4B4MA 3I0IX 3USQA 2Y4MA 1LL2A 2O1GA 1G0RA 5CMFX 1VGWA 2P73A 4NALA 2VXMA 2ZU9A 1VZXA 2OEFA 4O6MA 5CQPA 3U2VA 1H7LA 1VM8A 3IOHA 4MYBA 3T7NA 3CGXA 2NXVA 3V0OA 3SXCA 1LZ0A 2V0LA 4KXOA 1ZI5A 2MZBA 1R7UA 2XMEA 4HCQA 3U2UA 3T7MA 2ZU7A 4E1KA 4CJ8A 1EZIA 2WE9A 1H5SB 1WT1A 3I0EA 4M28A 1FO9A 5DDTA 5CQMX 4LW3A 1FGXA 1H5SD 1VH3A 5IFYA 1FO8A 1O23B 3RMVA 1MP3A 1H7HA 4UEGA 1H5TA 4DE7A 3V0PA 4Q7CA 3E26A 1H4EA 2ICXA 3SXAA 3ZF8A 1VZUA 4KC4A 2JCLA 3U2XA 4BQHA 3E25A 4KNRA 2D7RA 5IDTA 1H4DA 1LL0A 3I0CA 2RJ1A 1HV9A 3I0HA 1G97A 4NANA 1GWWA 1V84A 4XWIA 1GWVA 1ZIZA 3JUKA 1ZI1A 4MNDA 1O7QA 3R2WA 2AM5A 1OMXA 3SXGA 1K4VA 2O1FA 4J18A 2OI5A 4CJCA 4EE5A 4NAKA 2AM3A 2WVMA 2QGIA 3I0LA 5C4BA 1H5RA 4HO5A 2RITA 4L41C 1INJA 2V0JA 4Y64A 5C38A 2JCOA 3TZTA 1FRWA 2Y4KA 1H7EA 4JISA 2BO7A 3DK5A 3ZGGA 3SXBA 1G95A 2PGVA 5CMJA 5C8RA 1QG8A 1HJLA 1JVDA 1XZ6A 1ZJ1A 5JQQA 2E8BA 1MP4A 2X5ZA 4HG6A 4HO4A 3K8EA 2FFUA 1R80A 2GGQA 3GUEA 1JYKA 2D0JA 2JCJA 1YP4A 1HJJA 5C47A 4Y7FA 3NGWA 2VS3A 3IOJA 2PA4A 2AECA 3TQDA 2PGYA 1G23A 3SPTA 2RIYA 1WT2A 1ZI4A 4FCUA 5L6VA 2WVKA 1TW1A 1GX4A 2RJ9A 2AGDA 3R3IA 4IRPA 1H7GA 4AYJA 4EEOA 2D7IA 3V8YA 4HO3A 5C4EA 1W77A 5BXCA 4D11C 4FRHA 2I5KA 3DUVA 2UX8A 3PNNA 3D98A 4FRAA 1TZFA 2RJ6A 2YESA 3OH4A 4ASYA 4FRPA 5CQLX 1H5SA 4FCEA 1ZJPA 1PZTA 2RJ8A 4ZDQA 4FRLA 2VS5A 2Y4JA 1JV1A 3I0KA 3I0JA 1O0RA 2VSIA 1MP5A 5C36A 4M2BA 4EEAA 3V0MA 3SX3A 4FROA 1PZYB 2V0IA 1QGSA 3I0FA 1W55A 4AYLA 1ON6A 1GQCA 1ZJ0A 5DDVA 4HOCA 5EIYA 5J49A 2PX7A 5D91A 2YQSA 1ZCYA 1JV3A 3USRA 1HM9A 3FOQA 2Y6PA 2RIXA 3F1CA 1TW5A 1FR9A 2WEEA 1VICA 2DPWA 1FG5N 1ZCVA 4Y7VA 2Y7AA 1WSZA 4Y6NA 1ZCTA 3SX7A 1S4PA 4B3UA 1EYRA 1LL3A 2C0NA 4FRDA 2X65A 4HO6A 2YQCA 1NF5B 1VH1A 4EE3A 4FRBA 3SX5A 1LZJA 3OC9A 5FTSA 5C3AA 3I0GA 4KNXA 2BO6A 5D92A 2AM4A 4Y7GA 4D11A 1E5KA 2XWLA 1R7VA 2A8WA 1ON8A 1IIMA 4B4GA 3T7OA 3Q4SA 3HL3A 2OI7A 3V90A 1ZDFA 5C3DA 3D8VA 5CMIA 3SX8A 4EVWA 4FRQA 4G3QA 3I0DA 1H5SC 3CKQA 3CKNA 3FWWA 2VXLA 1G93A 1R82A 2VSHA 2P6WA 2I5EA 4EEMA 4K6RA 2VK9A 2FYDB 2Y4LA 1IINA 1FXJA 1ZDGA 1VGZA 1HM8A 2J0AA 1JYLA 2CU2A 3BRKX 1G1LA 4Y7UA 2YC5A 5C1GA 1G2VA 5CMHA 1R81A 5CMGX 4KRVA 3U2TA 1S4OA 4D0TA 4Y7TA 4ARWA 2ICYA 5FU0A 1SS9A 3IOIA 1MC3A 3OH1A 1G9RA 1LZIA 4DECA 5C4CA 4O6NA 4KQLA 1NHEB 1VGTA 2VD4A 5C4FA 3K8DA 2AESA 4FREA 4P00A 1KWSA 1JVGA 5EJ1A 2Z86A 3V0QA 3LW6A 5C1LA 2OI6A 5EJZA 1VGUA 5L6SA 1NWGB 4AC3A 2V0HA 1FGGA 3BCVA 2RJ4A 4R7PA 3CU0A 4NAIA 4D48A 2X60A 3Q80A 4G3PA 2WAWA 2FFVA 4B2XA 1OMZA 1H7FA 4M2AA 3ZLKA 2OEGA 1V82A 5IDSA 1FZWA 4KC2A 5AJPA 4IRQA 1GX0A 2WVLA 3OAMA 5C3BA 4G3SA 5FUHA 1WT3A 2BO4A 2O1HA 4MIXA 3OH3A 3U2WA 4FQWA 5C4DA 2FY7A 2YCMA 4B42A 4CJBA 4BMAA 3RMWA 1GQ9A 1H7QA 4KPZA 5FYEA 4EE4A 2GGOA 3U0YA 4P02A 1ZCUA 5C49A 3SXDA 2Z87A 3POLA 4KC1A 1LZ7A 2XWNA 4KPXA 2FYBA 2FYCB 2RIZA 4FRMA 1FR8A 4AAWA 3CKVA 2BO8A 3DJ4A 2APCA 4CVHA 1YP3A 2FYAA 3ZGFA 1HM0A 5FU8A 1FWYA 1ZJOA 1INIA 1V83A 4C2SA 1O7OA 3V91A 1WT0A 2P72A 4GBPA 1H7TA 1QWJA 1WVCA 1W57A 3N9WA 4B5BA 1QGQA 3OKRA 2QKXA 1H5TB 3D5NA 2RJ5A 2J0BA 4JD0A 2JCKA 2AH9A 1NMMB 3PKPA 5FTVA 4ASJA 3Q7UA 3OGZA 2W0VA 1ZJ3A 3O3PA 3CKJA 5I1FA 4HO9A 1YROB 2RJ7A 3KIAA 1XHBA 4Y63A 1G3LA 3EE5A 3OH0A 4Y6UA 5C48A 1VPAA 4M4KA 3V0LA 3CKOA 5AJOA 2WGZA 2A8UA 4HO2A 5AJNA 5FV9A 1VZTA 4ECMA 2E3DA 3ZLLA 1TVYA 1R7TA 4DDZA 4HO8A 4YS8A 2I7BA 3JUJA 1S4NA 1I52A 1FOAA 1FXOA 3OH2A 1R7XA 3V8ZA 4KT7A 4FIXA 3ST8A 1NKHB 3U0XA 5CQNX 1H5RB 1H3MA 1ZHJA 4LW6A 2RJ0A 2QH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO0 A;  1OQM B;  2V0K A;  1ZI3 A;  4B2W A;  4D0Z A;  1R7Y A;  1G8O A;  2YQH A;  2ZU8 A;  3V0N A;  5CQO A;  1GA8 A;  1ZJ2 A;  2X5S A;  4B4B A;  2VFZ A;  2XMH A;  3PKQ A;  1LVW A;  4Y9X A;  2VS4 A;  3RSB A;  3QVB A;  3F1Y A;  4EEG A;  2AE7 A;  1Z90 A;  4G87 A;  2YC3 A;  4Y62 A;  3SXE A;  2Q4J A;  2W0W A;  2XWM A;  5HS2 A;  5C1H A;  2YQJ A;  3JTJ A;  1H4C A;  1YP2 A;  1NQI B;  4B4M A;  3I0I X;  3USQ A;  2Y4M A;  1LL2 A;  2O1G A;  1G0R A;  5CMF X;  1VGW A;  2P73 A;  4NAL A;  2VXM A;  2ZU9 A;  1VZX A;  2OEF A;  5CQP A;  3U2V A;  1H7L A;  1VM8 A;  3IOH A;  4MYB A;  3T7N A;  3CGX A;  2NXV A;  3V0O A;  3SXC A;  1LZ0 A;  2V0L A;  4KXO A;  1ZI5 A;  2MZB A;  1R7U A;  2XME A;  4HCQ A;  3U2U A;  3T7M A;  2ZU7 A;  4E1K A;  4CJ8 A;  1EZI A;  2WE9 A;  1H5S B;  1WT1 A;  3I0E A;  4M28 A;  1FO9 A;  5DDT A;  5CQM X;  4LW3 A;  1FGX A;  1H5S D;  1VH3 A;  5IFY A;  1FO8 A;  1O23 B;  3RMV A;  1MP3 A;  1H7H A;  4UEG A;  1H5T A;  4DE7 A;  3V0P A;  3E26 A;  1H4E A;  2ICX A;  3SXA A;  3ZF8 A;  1VZU A;  4KC4 A;  2JCL A;  3U2X A;  4BQH A;  3E25 A;  4KNR A;  2D7R A;  5IDT A;  1H4D A;  1LL0 A;  3I0C A;  2RJ1 A;  1HV9 A;  3I0H A;  1G97 A;  4NAN A;  1GWW A;  1V84 A;  4XWI A;  1GWV A;  1ZIZ A;  3JUK A;  1ZI1 A;  4MND A;  1O7Q A;  3R2W A;  2AM5 A;  1OMX A;  3SXG A;  1K4V A;  2O1F A;  4J18 A;  2OI5 A;  4CJC A;  4EE5 A;  4NAK A;  2AM3 A;  2WVM A;  2QGI A;  3I0L A;  5C4B A;  1H5R A;  4HO5 A;  2RIT A;  4L41 C;  1INJ A;  2V0J A;  4Y64 A;  5C38 A;  2JCO A;  3TZT A;  1FRW A;  2Y4K A;  1H7E A;  4JIS A;  2BO7 A;  3DK5 A;  3ZGG A;  3SXB A;  1G95 A;  2PGV A;  5CMJ A;  5C8R A;  1QG8 A;  1HJL A;  1JVD A;  1XZ6 A;  1ZJ1 A;  5JQQ A;  2E8B A;  1MP4 A;  2X5Z A;  4HG6 A;  4HO4 A;  3K8E A;  2FFU A;  1R80 A;  2GGQ A;  3GUE A;  1JYK A;  2D0J A;  2JCJ A;  1YP4 A;  1HJJ A;  5C47 A;  4Y7F A;  3NGW A;  2VS3 A;  3IOJ A;  2PA4 A;  2AEC A;  3TQD A;  2PGY A;  1G23 A;  3SPT A;  2RIY A;  1WT2 A;  1ZI4 A;  4FCU A;  5L6V A;  2WVK A;  1TW1 A;  1GX4 A;  2RJ9 A;  2AGD A;  3R3I A;  4IRP A;  1H7G A;  4AYJ A;  4EEO A;  2D7I A;  3V8Y A;  4HO3 A;  5C4E A;  1W77 A;  5BXC A;  4D11 C;  4FRH A;  2I5K A;  3DUV A;  2UX8 A;  3PNN A;  3D98 A;  4FRA A;  1TZF A;  2RJ6 A;  2YES A;  3OH4 A;  4ASY A;  4FRP A;  5CQL X;  1H5S A;  4FCE A;  1ZJP A;  1PZT A;  2RJ8 A;  4ZDQ A;  4FRL A;  2VS5 A;  2Y4J A;  1JV1 A;  3I0K A;  3I0J A;  1O0R A;  2VSI A;  1MP5 A;  5C36 A;  4M2B A;  4EEA A;  3V0M A;  3SX3 A;  4FRO A;  1PZY B;  2V0I A;  1QGS A;  3I0F A;  1W55 A;  4AYL A;  1ON6 A;  1GQC A;  1ZJ0 A;  5DDV A;  4HOC A;  5EIY A;  5J49 A;  2PX7 A;  2YQS A;  1ZCY A;  1JV3 A;  3USR A;  1HM9 A;  3FOQ A;  2Y6P A;  2RIX A;  3F1C A;  1TW5 A;  1FR9 A;  2WEE A;  1VIC A;  2DPW A;  1FG5 N;  1ZCV A;  4Y7V A;  2Y7A A;  1WSZ A;  4Y6N A;  1ZCT A;  3SX7 A;  1S4P A;  4B3U A;  1EYR A;  1LL3 A;  4HO6 A;  4FRD A;  2X65 A;  2YQC A;  1NF5 B;  1VH1 A;  4EE3 A;  4FRB A;  3SX5 A;  1LZJ A;  3OC9 A;  5FTS A;  5C3A A;  3I0G A;  4KNX A;  2BO6 A;  2AM4 A;  4Y7G A;  4D11 A;  1E5K A;  2XWL A;  1R7V A;  2A8W A;  1ON8 A;  1IIM A;  4B4G A;  3T7O A;  3Q4S A;  3HL3 A;  2OI7 A;  3V90 A;  1ZDF A;  5C3D A;  3D8V A;  5CMI A;  3SX8 A;  4EVW A;  4FRQ A;  4G3Q A;  3I0D A;  1H5S C;  3CKQ A;  3CKN A;  3FWW A;  2VXL A;  1G93 A;  1R82 A;  2VSH A;  2P6W A;  2I5E A;  4EEM A;  4K6R A;  2FYD B;  2Y4L A;  1IIN A;  1FXJ A;  1ZDG A;  1VGZ A;  1HM8 A;  1JYL A;  2CU2 A;  3BRK X;  1G1L A;  4Y7U A;  2YC5 A;  5C1G A;  1G2V A;  5CMH A;  1R81 A;  5CMG X;  4KRV A;  3U2T A;  1S4O A;  4D0T A;  4Y7T A;  4ARW A;  2ICY A;  5FU0 A;  1SS9 A;  3IOI A;  1MC3 A;  3OH1 A;  1G9R A;  1LZI A;  4DEC A;  5C4C A;  4KQL A;  1NHE B;  1VGT A;  2VD4 A;  5C4F A;  3K8D A;  2AES A;  4FRE A;  4P00 A;  1KWS A;  1JVG A;  5EJ1 A;  2Z86 A;  3V0Q A;  3LW6 A;  5C1L A;  2OI6 A;  5EJZ A;  1VGU A;  5L6S A;  1NWG B;  4AC3 A;  2V0H A;  1FGG A;  3BCV A;  2RJ4 A;  4R7P A;  3CU0 A;  4NAI A;  4D48 A;  2X60 A;  3Q80 A;  4G3P A;  2WAW A;  2FFV A;  4B2X A;  1OMZ A;  1H7F A;  4M2A A;  3ZLK A;  2OEG A;  1V82 A;  5IDS A;  1FZW A;  4KC2 A;  5AJP A;  4IRQ A;  1GX0 A;  2WVL A;  3OAM A;  5C3B A;  4G3S A;  5FUH A;  1WT3 A;  2BO4 A;  2O1H A;  3OH3 A;  3U2W A;  4FQW A;  5C4D A;  2FY7 A;  2YCM A;  4B42 A;  4CJB A;  4BMA A;  3RMW A;  1GQ9 A;  1H7Q A;  4KPZ A;  5FYE A;  4EE4 A;  2GGO A;  3U0Y A;  4P02 A;  1ZCU A;  5C49 A;  3SXD A;  2Z87 A;  3POL A;  4KC1 A;  1LZ7 A;  2XWN A;  4KPX A;  2FYB A;  2FYC B;  2RIZ A;  4FRM A;  1FR8 A;  4AAW A;  3CKV A;  2BO8 A;  3DJ4 A;  2APC A;  4CVH A;  1YP3 A;  2FYA A;  3ZGF A;  1HM0 A;  5FU8 A;  1FWY A;  1ZJO A;  1INI A;  1V83 A;  4C2S A;  1O7O A;  3V91 A;  1WT0 A;  2P72 A;  4GBP A;  1H7T A;  1QWJ A;  1WVC A;  1W57 A;  3N9W A;  4B5B A;  1QGQ A;  3OKR A;  2QKX A;  1H5T B;  3D5N A;  2RJ5 A;  4JD0 A;  2JCK A;  2AH9 A;  1NMM B;  3PKP A;  5FTV A;  4ASJ A;  3Q7U A;  3OGZ A;  2W0V A;  1ZJ3 A;  3O3P A;  3CKJ A;  5I1F A;  4HO9 A;  1YRO B;  2RJ7 A;  3KIA A;  1XHB A;  4Y63 A;  1G3L A;  3EE5 A;  3OH0 A;  4Y6U A;  5C48 A;  1VPA A;  4M4K A;  3V0L A;  3CKO A;  5AJO A;  2WGZ A;  2A8U A;  4HO2 A;  5AJN A;  5FV9 A;  1VZT A;  4ECM A;  2E3D A;  3ZLL A;  1TVY A;  1R7T A;  4DDZ A;  4HO8 A;  4YS8 A;  2I7B A;  3JUJ A;  1S4N A;  1I52 A;  1FOA A;  1FXO A;  3OH2 A;  1R7X A;  3V8Z A;  4KT7 A;  3ST8 A;  1NKH B;  3U0X A;  5CQN X;  1H5R B;  1H3M A;  1ZHJ A;  4LW6 A;  2RJ0 A;  2QH5 A; 
#chains in the Genus database with same CATH topology
 4HO0 A;  1OQM B;  2V0K A;  1ZI3 A;  4B2W A;  4D0Z A;  1R7Y A;  1G8O A;  2YQH A;  2ZU8 A;  3V0N A;  5CQO A;  1GA8 A;  1ZJ2 A;  2X5S A;  4B4B A;  2VFZ A;  2XMH A;  3PKQ A;  1LVW A;  4Y9X A;  2VS4 A;  3RSB A;  3QVB A;  3F1Y A;  4EEG A;  2AE7 A;  1Z90 A;  4G87 A;  2YC3 A;  4Y62 A;  3SXE A;  2Q4J A;  2W0W A;  2XWM A;  5HS2 A;  5C1H A;  2YQJ A;  3JTJ A;  1H4C A;  4FIY A;  1YP2 A;  1NQI B;  4B4M A;  3I0I X;  3USQ A;  2Y4M A;  1LL2 A;  2O1G A;  1G0R A;  5CMF X;  1VGW A;  2P73 A;  4NAL A;  2VXM A;  2ZU9 A;  1VZX A;  2OEF A;  4O6M A;  5CQP A;  3U2V A;  1H7L A;  1VM8 A;  3IOH A;  4MYB A;  3T7N A;  3CGX A;  2NXV A;  3V0O A;  3SXC A;  1LZ0 A;  2V0L A;  4KXO A;  1ZI5 A;  2MZB A;  1R7U A;  2XME A;  4HCQ A;  3U2U A;  3T7M A;  2ZU7 A;  4E1K A;  4CJ8 A;  1EZI A;  2WE9 A;  1H5S B;  1WT1 A;  3I0E A;  4M28 A;  1FO9 A;  5DDT A;  5CQM X;  4LW3 A;  1FGX A;  1H5S D;  1VH3 A;  5IFY A;  1FO8 A;  1O23 B;  3RMV A;  1MP3 A;  1H7H A;  4UEG A;  1H5T A;  4DE7 A;  3V0P A;  4Q7C A;  3E26 A;  1H4E A;  2ICX A;  3SXA A;  3ZF8 A;  1VZU A;  4KC4 A;  2JCL A;  3U2X A;  4BQH A;  3E25 A;  4KNR A;  2D7R A;  5IDT A;  1H4D A;  1LL0 A;  3I0C A;  2RJ1 A;  1HV9 A;  3I0H A;  1G97 A;  4NAN A;  1GWW A;  1V84 A;  4XWI A;  1GWV A;  1ZIZ A;  3JUK A;  1ZI1 A;  4MND A;  1O7Q A;  3R2W A;  2AM5 A;  1OMX A;  3SXG A;  1K4V A;  2O1F A;  4J18 A;  2OI5 A;  4CJC A;  4EE5 A;  4NAK A;  2AM3 A;  2WVM A;  2QGI A;  3I0L A;  5C4B A;  1H5R A;  4HO5 A;  2RIT A;  4L41 C;  1INJ A;  2V0J A;  4Y64 A;  5C38 A;  2JCO A;  3TZT A;  1FRW A;  2Y4K A;  1H7E A;  4JIS A;  2BO7 A;  3DK5 A;  3ZGG A;  3SXB A;  1G95 A;  2PGV A;  5CMJ A;  5C8R A;  1QG8 A;  1HJL A;  1JVD A;  1XZ6 A;  1ZJ1 A;  5JQQ A;  2E8B A;  1MP4 A;  2X5Z A;  4HG6 A;  4HO4 A;  3K8E A;  2FFU A;  1R80 A;  2GGQ A;  3GUE A;  1JYK A;  2D0J A;  2JCJ A;  1YP4 A;  1HJJ A;  5C47 A;  4Y7F A;  3NGW A;  2VS3 A;  3IOJ A;  2PA4 A;  2AEC A;  3TQD A;  2PGY A;  1G23 A;  3SPT A;  2RIY A;  1WT2 A;  1ZI4 A;  4FCU A;  5L6V A;  2WVK A;  1TW1 A;  1GX4 A;  2RJ9 A;  2AGD A;  3R3I A;  4IRP A;  1H7G A;  4AYJ A;  4EEO A;  2D7I A;  3V8Y A;  4HO3 A;  5C4E A;  1W77 A;  5BXC A;  4D11 C;  4FRH A;  2I5K A;  3DUV A;  2UX8 A;  3PNN A;  3D98 A;  4FRA A;  1TZF A;  2RJ6 A;  2YES A;  3OH4 A;  4ASY A;  4FRP A;  5CQL X;  1H5S A;  4FCE A;  1ZJP A;  1PZT A;  2RJ8 A;  4ZDQ A;  4FRL A;  2VS5 A;  2Y4J A;  1JV1 A;  3I0K A;  3I0J A;  1O0R A;  2VSI A;  1MP5 A;  5C36 A;  4M2B A;  4EEA A;  3V0M A;  3SX3 A;  4FRO A;  1PZY B;  2V0I A;  1QGS A;  3I0F A;  1W55 A;  4AYL A;  1ON6 A;  1GQC A;  1ZJ0 A;  5DDV A;  4HOC A;  5EIY A;  5J49 A;  2PX7 A;  5D91 A;  2YQS A;  1ZCY A;  1JV3 A;  3USR A;  1HM9 A;  3FOQ A;  2Y6P A;  2RIX A;  3F1C A;  1TW5 A;  1FR9 A;  2WEE A;  1VIC A;  2DPW A;  1FG5 N;  1ZCV A;  4Y7V A;  2Y7A A;  1WSZ A;  4Y6N A;  1ZCT A;  3SX7 A;  1S4P A;  4B3U A;  1EYR A;  1LL3 A;  2C0N A;  4FRD A;  2X65 A;  4HO6 A;  2YQC A;  1NF5 B;  1VH1 A;  4EE3 A;  4FRB A;  3SX5 A;  1LZJ A;  3OC9 A;  5FTS A;  5C3A A;  3I0G A;  4KNX A;  2BO6 A;  5D92 A;  2AM4 A;  4Y7G A;  4D11 A;  1E5K A;  2XWL A;  1R7V A;  2A8W A;  1ON8 A;  1IIM A;  4B4G A;  3T7O A;  3Q4S A;  3HL3 A;  2OI7 A;  3V90 A;  1ZDF A;  5C3D A;  3D8V A;  5CMI A;  3SX8 A;  4EVW A;  4FRQ A;  4G3Q A;  3I0D A;  1H5S C;  3CKQ A;  3CKN A;  3FWW A;  2VXL A;  1G93 A;  1R82 A;  2VSH A;  2P6W A;  2I5E A;  4EEM A;  4K6R A;  2VK9 A;  2FYD B;  2Y4L A;  1IIN A;  1FXJ A;  1ZDG A;  1VGZ A;  1HM8 A;  2J0A A;  1JYL A;  2CU2 A;  3BRK X;  1G1L A;  4Y7U A;  2YC5 A;  5C1G A;  1G2V A;  5CMH A;  1R81 A;  5CMG X;  4KRV A;  3U2T A;  1S4O A;  4D0T A;  4Y7T A;  4ARW A;  2ICY A;  5FU0 A;  1SS9 A;  3IOI A;  1MC3 A;  3OH1 A;  1G9R A;  1LZI A;  4DEC A;  5C4C A;  4O6N A;  4KQL A;  1NHE B;  1VGT A;  2VD4 A;  5C4F A;  3K8D A;  2AES A;  4FRE A;  4P00 A;  1KWS A;  1JVG A;  5EJ1 A;  2Z86 A;  3V0Q A;  3LW6 A;  5C1L A;  2OI6 A;  5EJZ A;  1VGU A;  5L6S A;  1NWG B;  4AC3 A;  2V0H A;  1FGG A;  3BCV A;  2RJ4 A;  4R7P A;  3CU0 A;  4NAI A;  4D48 A;  2X60 A;  3Q80 A;  4G3P A;  2WAW A;  2FFV A;  4B2X A;  1OMZ A;  1H7F A;  4M2A A;  3ZLK A;  2OEG A;  1V82 A;  5IDS A;  1FZW A;  4KC2 A;  5AJP A;  4IRQ A;  1GX0 A;  2WVL A;  3OAM A;  5C3B A;  4G3S A;  5FUH A;  1WT3 A;  2BO4 A;  2O1H A;  4MIX A;  3OH3 A;  3U2W A;  4FQW A;  5C4D A;  2FY7 A;  2YCM A;  4B42 A;  4CJB A;  4BMA A;  3RMW A;  1GQ9 A;  1H7Q A;  4KPZ A;  5FYE A;  4EE4 A;  2GGO A;  3U0Y A;  4P02 A;  1ZCU A;  5C49 A;  3SXD A;  2Z87 A;  3POL A;  4KC1 A;  1LZ7 A;  2XWN A;  4KPX A;  2FYB A;  2FYC B;  2RIZ A;  4FRM A;  1FR8 A;  4AAW A;  3CKV A;  2BO8 A;  3DJ4 A;  2APC A;  4CVH A;  1YP3 A;  2FYA A;  3ZGF A;  1HM0 A;  5FU8 A;  1FWY A;  1ZJO A;  1INI A;  1V83 A;  4C2S A;  1O7O A;  3V91 A;  1WT0 A;  2P72 A;  4GBP A;  1H7T A;  1QWJ A;  1WVC A;  1W57 A;  3N9W A;  4B5B A;  1QGQ A;  3OKR A;  2QKX A;  1H5T B;  3D5N A;  2RJ5 A;  2J0B A;  4JD0 A;  2JCK A;  2AH9 A;  1NMM B;  3PKP A;  5FTV A;  4ASJ A;  3Q7U A;  3OGZ A;  2W0V A;  1ZJ3 A;  3O3P A;  3CKJ A;  5I1F A;  4HO9 A;  1YRO B;  2RJ7 A;  3KIA A;  1XHB A;  4Y63 A;  1G3L A;  3EE5 A;  3OH0 A;  4Y6U A;  5C48 A;  1VPA A;  4M4K A;  3V0L A;  3CKO A;  5AJO A;  2WGZ A;  2A8U A;  4HO2 A;  5AJN A;  5FV9 A;  1VZT A;  4ECM A;  2E3D A;  3ZLL A;  1TVY A;  1R7T A;  4DDZ A;  4HO8 A;  4YS8 A;  2I7B A;  3JUJ A;  1S4N A;  1I52 A;  1FOA A;  1FXO A;  3OH2 A;  1R7X A;  3V8Z A;  4KT7 A;  4FIX A;  3ST8 A;  1NKH B;  3U0X A;  5CQN X;  1H5R B;  1H3M A;  1ZHJ A;  4LW6 A;  2RJ0 A;  2QH5 A; 
#chains in the Genus database with same CATH homology
 4HO0 A;  1OQM B;  2V0K A;  1ZI3 A;  4B2W A;  4D0Z A;  1R7Y A;  1G8O A;  2YQH A;  2ZU8 A;  3V0N A;  5CQO A;  1GA8 A;  1ZJ2 A;  2X5S A;  4B4B A;  2VFZ A;  2XMH A;  3PKQ A;  1LVW A;  4Y9X A;  2VS4 A;  3RSB A;  3QVB A;  3F1Y A;  4EEG A;  2AE7 A;  1Z90 A;  4G87 A;  2YC3 A;  4Y62 A;  3SXE A;  2Q4J A;  2W0W A;  2XWM A;  5HS2 A;  5C1H A;  2YQJ A;  3JTJ A;  1H4C A;  4FIY A;  1YP2 A;  1NQI B;  4B4M A;  3I0I X;  3USQ A;  2Y4M A;  1LL2 A;  2O1G A;  1G0R A;  5CMF X;  1VGW A;  2P73 A;  4NAL A;  2VXM A;  2ZU9 A;  1VZX A;  2OEF A;  4O6M A;  5CQP A;  3U2V A;  1H7L A;  1VM8 A;  3IOH A;  4MYB A;  3T7N A;  3CGX A;  2NXV A;  3V0O A;  3SXC A;  1LZ0 A;  2V0L A;  4KXO A;  1ZI5 A;  2MZB A;  1R7U A;  2XME A;  4HCQ A;  3U2U A;  3T7M A;  2ZU7 A;  4E1K A;  4CJ8 A;  1EZI A;  2WE9 A;  1H5S B;  1WT1 A;  3I0E A;  4M28 A;  1FO9 A;  5DDT A;  5CQM X;  4LW3 A;  1FGX A;  1H5S D;  1VH3 A;  5IFY A;  1FO8 A;  1O23 B;  3RMV A;  1MP3 A;  1H7H A;  4UEG A;  1H5T A;  4DE7 A;  3V0P A;  4Q7C A;  3E26 A;  1H4E A;  2ICX A;  3SXA A;  3ZF8 A;  1VZU A;  4KC4 A;  2JCL A;  3U2X A;  4BQH A;  3E25 A;  4KNR A;  2D7R A;  5IDT A;  1H4D A;  1LL0 A;  3I0C A;  2RJ1 A;  1HV9 A;  3I0H A;  1G97 A;  4NAN A;  1GWW A;  1V84 A;  4XWI A;  1GWV A;  1ZIZ A;  3JUK A;  1ZI1 A;  4MND A;  1O7Q A;  3R2W A;  2AM5 A;  1OMX A;  3SXG A;  1K4V A;  2O1F A;  4J18 A;  2OI5 A;  4CJC A;  4EE5 A;  4NAK A;  2AM3 A;  2WVM A;  2QGI A;  3I0L A;  5C4B A;  1H5R A;  4HO5 A;  2RIT A;  4L41 C;  1INJ A;  2V0J A;  4Y64 A;  5C38 A;  2JCO A;  3TZT A;  1FRW A;  2Y4K A;  1H7E A;  4JIS A;  2BO7 A;  3DK5 A;  3ZGG A;  3SXB A;  1G95 A;  2PGV A;  5CMJ A;  5C8R A;  1QG8 A;  1HJL A;  1JVD A;  1XZ6 A;  1ZJ1 A;  5JQQ A;  2E8B A;  1MP4 A;  2X5Z A;  4HG6 A;  4HO4 A;  3K8E A;  2FFU A;  1R80 A;  2GGQ A;  3GUE A;  1JYK A;  2D0J A;  2JCJ A;  1YP4 A;  1HJJ A;  5C47 A;  4Y7F A;  3NGW A;  2VS3 A;  3IOJ A;  2PA4 A;  2AEC A;  3TQD A;  2PGY A;  1G23 A;  3SPT A;  2RIY A;  1WT2 A;  1ZI4 A;  4FCU A;  5L6V A;  2WVK A;  1TW1 A;  1GX4 A;  2RJ9 A;  2AGD A;  3R3I A;  4IRP A;  1H7G A;  4AYJ A;  4EEO A;  2D7I A;  3V8Y A;  4HO3 A;  5C4E A;  1W77 A;  5BXC A;  4D11 C;  4FRH A;  2I5K A;  3DUV A;  2UX8 A;  3PNN A;  3D98 A;  4FRA A;  1TZF A;  2RJ6 A;  2YES A;  3OH4 A;  4ASY A;  4FRP A;  5CQL X;  1H5S A;  4FCE A;  1ZJP A;  1PZT A;  2RJ8 A;  4ZDQ A;  4FRL A;  2VS5 A;  2Y4J A;  1JV1 A;  3I0K A;  3I0J A;  1O0R A;  2VSI A;  1MP5 A;  5C36 A;  4M2B A;  4EEA A;  3V0M A;  3SX3 A;  4FRO A;  1PZY B;  2V0I A;  1QGS A;  3I0F A;  1W55 A;  4AYL A;  1ON6 A;  1GQC A;  1ZJ0 A;  5DDV A;  4HOC A;  5EIY A;  5J49 A;  2PX7 A;  5D91 A;  2YQS A;  1ZCY A;  1JV3 A;  3USR A;  1HM9 A;  3FOQ A;  2Y6P A;  2RIX A;  3F1C A;  1TW5 A;  1FR9 A;  2WEE A;  1VIC A;  2DPW A;  1FG5 N;  1ZCV A;  4Y7V A;  2Y7A A;  1WSZ A;  4Y6N A;  1ZCT A;  3SX7 A;  1S4P A;  4B3U A;  1EYR A;  1LL3 A;  2C0N A;  4FRD A;  2X65 A;  4HO6 A;  2YQC A;  1NF5 B;  1VH1 A;  4EE3 A;  4FRB A;  3SX5 A;  1LZJ A;  3OC9 A;  5FTS A;  5C3A A;  3I0G A;  4KNX A;  2BO6 A;  5D92 A;  2AM4 A;  4Y7G A;  4D11 A;  1E5K A;  2XWL A;  1R7V A;  2A8W A;  1ON8 A;  1IIM A;  4B4G A;  3T7O A;  3Q4S A;  3HL3 A;  2OI7 A;  3V90 A;  1ZDF A;  5C3D A;  3D8V A;  5CMI A;  3SX8 A;  4EVW A;  4FRQ A;  4G3Q A;  3I0D A;  1H5S C;  3CKQ A;  3CKN A;  3FWW A;  2VXL A;  1G93 A;  1R82 A;  2VSH A;  2P6W A;  2I5E A;  4EEM A;  4K6R A;  2VK9 A;  2FYD B;  2Y4L A;  1IIN A;  1FXJ A;  1ZDG A;  1VGZ A;  1HM8 A;  2J0A A;  1JYL A;  2CU2 A;  3BRK X;  1G1L A;  4Y7U A;  2YC5 A;  5C1G A;  1G2V A;  5CMH A;  1R81 A;  5CMG X;  4KRV A;  3U2T A;  1S4O A;  4D0T A;  4Y7T A;  4ARW A;  2ICY A;  5FU0 A;  1SS9 A;  3IOI A;  1MC3 A;  3OH1 A;  1G9R A;  1LZI A;  4DEC A;  5C4C A;  4O6N A;  4KQL A;  1NHE B;  1VGT A;  2VD4 A;  5C4F A;  3K8D A;  2AES A;  4FRE A;  4P00 A;  1KWS A;  1JVG A;  5EJ1 A;  2Z86 A;  3V0Q A;  3LW6 A;  5C1L A;  2OI6 A;  5EJZ A;  1VGU A;  5L6S A;  1NWG B;  4AC3 A;  2V0H A;  1FGG A;  3BCV A;  2RJ4 A;  4R7P A;  3CU0 A;  4NAI A;  4D48 A;  2X60 A;  3Q80 A;  4G3P A;  2WAW A;  2FFV A;  4B2X A;  1OMZ A;  1H7F A;  4M2A A;  3ZLK A;  2OEG A;  1V82 A;  5IDS A;  1FZW A;  4KC2 A;  5AJP A;  4IRQ A;  1GX0 A;  2WVL A;  3OAM A;  5C3B A;  4G3S A;  5FUH A;  1WT3 A;  2BO4 A;  2O1H A;  4MIX A;  3OH3 A;  3U2W A;  4FQW A;  5C4D A;  2FY7 A;  2YCM A;  4B42 A;  4CJB A;  4BMA A;  3RMW A;  1GQ9 A;  1H7Q A;  4KPZ A;  5FYE A;  4EE4 A;  2GGO A;  3U0Y A;  4P02 A;  1ZCU A;  5C49 A;  3SXD A;  2Z87 A;  3POL A;  4KC1 A;  1LZ7 A;  2XWN A;  4KPX A;  2FYB A;  2FYC B;  2RIZ A;  4FRM A;  1FR8 A;  4AAW A;  3CKV A;  2BO8 A;  3DJ4 A;  2APC A;  4CVH A;  1YP3 A;  2FYA A;  3ZGF A;  1HM0 A;  5FU8 A;  1FWY A;  1ZJO A;  1INI A;  1V83 A;  4C2S A;  1O7O A;  3V91 A;  1WT0 A;  2P72 A;  4GBP A;  1H7T A;  1QWJ A;  1WVC A;  1W57 A;  3N9W A;  4B5B A;  1QGQ A;  3OKR A;  2QKX A;  1H5T B;  3D5N A;  2RJ5 A;  2J0B A;  4JD0 A;  2JCK A;  2AH9 A;  1NMM B;  3PKP A;  5FTV A;  4ASJ A;  3Q7U A;  3OGZ A;  2W0V A;  1ZJ3 A;  3O3P A;  3CKJ A;  5I1F A;  4HO9 A;  1YRO B;  2RJ7 A;  3KIA A;  1XHB A;  4Y63 A;  1G3L A;  3EE5 A;  3OH0 A;  4Y6U A;  5C48 A;  1VPA A;  4M4K A;  3V0L A;  3CKO A;  5AJO A;  2WGZ A;  2A8U A;  4HO2 A;  5AJN A;  5FV9 A;  1VZT A;  4ECM A;  2E3D A;  3ZLL A;  1TVY A;  1R7T A;  4DDZ A;  4HO8 A;  4YS8 A;  2I7B A;  3JUJ A;  1S4N A;  1I52 A;  1FOA A;  1FXO A;  3OH2 A;  1R7X A;  3V8Z A;  4KT7 A;  4FIX A;  3ST8 A;  1NKH B;  3U0X A;  5CQN X;  1H5R B;  1H3M A;  1ZHJ A;  4LW6 A;  2RJ0 A;  2QH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...