3U2UA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese, udp and maltotetraose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u2uA00
2YCMA 2RJ7A 4EE5A 1PZYB 3SXBA 2YQCA 5C3DA 3CKJA 1WT3A 2YESA 1FRWA 3TZTA 1VGWA 2VXMA 3R2WA 4FRPA 2E8BA 5CMHA 2VXLA 1VGUA 2AM4A 2PGYA 2QKXA 2W0VA 4C2SA 2ICYA 2OEFA 4FQWA 4NALA 4KQLA 5FU0A 2E3DA 4CVHA 2OEGA 4FRAA 4EE3A 3SXDA 2JCJA 3I0HA 1FXOA 4M2AA 2V0HA 1ZCTA 2OI5A 1H5RA 5CQOA 1W55A 3USQA 1FO9A 3D98A 3PKQA 1XZ6A 5FV9A 1G2VA 1HJJA 2X5ZA 1MP4A 1WT0A 2Y4LA 3D8VA 3JTJA 4Y6UA 4B5BA 5C47A 1H4EA 3DJ4A 4FRDA 3V0NA 4KNXA 4Y62A 4HO0A 3Q80A 2XWMA 2Y4JA 2PX7A 2FYCB 1G1LA 2JCLA 3PNNA 2AH9A 1EYRA 1YP4A 3U0YA 2I7BA 3USRA 3CKQA 1VGZA 1GQCA 5J49A 4AC3A 5CQLX 1FG5N 2Y7AA 2AE7A 4J18A 2O1HA 3IOIA 1I52A 5EIYA 2Y4MA 3POLA 2JCOA 5CMJA 1YP2A 2Q4JA 3QVBA 1LZ0A 5FTSA 4B2WA 1FOAA 2RJ9A 1FGGA 2WVLA 1GX4A 2XWNA 4CJCA 1G93A 3HL3A 4NANA 4G3PA 4UEGA 5C1HA 2P72A 2W0WA 1ZI3A 1K4VA 2WVKA 2XMEA 3RMWA 1G95A 4FRBA 4BQHA 2VFZA 1V84A 1TW5A 4DDZA 1VPAA 1NHEB 4E1KA 4FRHA 2YC5A 3Q4SA 1PZTA 1V83A 3OKRA 3CKNA 1EZIA 1Z90A 4JISA 1JV1A 5C1LA 3CKVA 2AM5A 1WT1A 1FXJA 1VM8A 4KC1A 3V0OA 3V0PA 4FROA 1R80A 1W77A 4AYLA 4D48A 3EE5A 3CU0A 2APCA 5C4FA 4HO5A 2RITA 3JUKA 1R7YA 1H7TA 4MYBA 2VS3A 1R7VA 4HOCA 2PGVA 1HM9A 4Y9XA 1VH1A 4KPZA 2RJ5A 4IRPA 5FTVA 1FGXA 3K8EA 3FOQA 2RIYA 4M28A 5C3AA 3KIAA 4DE7A 5C4CA 1H5TB 4B3UA 2A8WA 4EEGA 2FYBA 4BMAA 1WVCA 1LZIA 3V90A 4Y6NA 4GBPA 4G3QA 5L6SA 1VH3A 1VGTA 4MNDA 2VSIA 5CQPA 1H4CA 2I5KA 2X60A 1INJA 3F1CA 2OI7A 4KRVA 1LL0A 1R7TA 4FRMA 1H4DA 1V82A 3V0MA 3ZGGA 1HM8A 3T7NA 1H5SD 3T7OA 1FZWA 3ZLLA 1GA8A 1YP3A 1ZCUA 1TVYA 2RJ0A 4K6RA 4EE4A 1FR8A 1R81A 4HO9A 5DDVA 5C4DA 3SXAA 1S4PA 5C3BA 3O3PA 1O23B 1VZXA 2ZU9A 3E26A 2WGZA 1R82A 4KNRA 1S4OA 2BO6A 1KWSA 1H3MA 1O0RA 1ZCVA 3E25A 3OAMA 5FU8A 1E5KA 3N9WA 4CJBA 4B4BA 2YQJA 5C36A 2FFUA 4EEMA 1SS9A 1LZ7A 1QG8A 4EVWA 3DUVA 1VZTA 1YROB 2A8UA 3SX7A 3TQDA 2PA4A 1IIMA 2AECA 3BRKX 4P00A 4JD0A 2FY7A 1H5RB 1ZJOA 2AGDA 2UX8A 4DECA 3I0GA 1ZJ0A 4KT7A 1VICA 3U0XA 5FUHA 1ZHJA 2Z86A 4ECMA 4AAWA 2Y4KA 1ON6A 5L6VA 4NAIA 2NXVA 1OQMB 4L41C 2D0JA 3SX5A 1NMMB 5C49A 5C4BA 2RJ4A 1TZFA 1G97A 3I0LA 1GX0A 3RSBA 5AJPA 2O1GA 1ZI4A 2YQSA 4Y63A 1ON8A 2ZU7A 1H7EA 5CMGX 1GWWA 2Y6PA 4M4KA 1FR9A 2BO8A 2XWLA 1NKHB 4G87A 5AJOA 4B42A 4HCQA 2RJ6A 2WVMA 1H7LA 1NF5B 2X65A 3F1YA 1G0RA 4B4GA 1FWYA 1G23A 4EEOA 2I5EA 3CGXA 3ST8A 4KXOA 1QGQA 3SX8A 3I0DA 2RIZA 4D0TA 3D5NA 5IDTA 2D7RA 3U2UA 1H7FA 1ZDFA 3K8DA 4LW6A 3OC9A 3SPTA 2FFVA 3I0CA 3I0KA 2FYDB 4FCEA 3U2TA 3V0LA 1JYLA 4Y7FA 4ASJA 4R7PA 2O1FA 2V0JA 2WE9A 2QH5A 1XHBA 4D0ZA 2VD4A 1O7QA 3Q7UA 1WSZA 1R7UA 2OI6A 3SX3A 4ARWA 1HV9A 2YC3A 5FYEA 4XWIA 2V0LA 1ZJPA 3OH3A 1MP3A 4Y7UA 1GQ9A 1JYKA 4IRQA 1JV3A 5CMIA 1O7OA 3OH4A 1QWJA 3BCVA 2XMHA 3GUEA 4AYJA 4D11A 5IFYA 1S4NA 4Y7GA 2GGOA 3DK5A 3JUJA 5AJNA 1H5SA 1ZJ1A 1ZI1A 5HS2A 1ZCYA 4FRLA 5IDSA 2AM3A 1INIA 5DDTA 1OMZA 3T7MA 3V8YA 3ZGFA 4D11C 3U2VA 4NAKA 1JVDA 2BO7A 1H7QA 3V0QA 3R3IA 5C38A 1H5SC 5EJ1A 4EEAA 3OH0A 5CQMX 1HM0A 2RJ8A 2V0KA 1LL2A 3OH2A 4HO6A 3IOHA 4G3SA 1LVWA 2BO4A 2D7IA 5C4EA 5CMFX 1OMXA 3SXCA 4YS8A 2VS4A 1ZIZA 4ASYA 2P73A 1LL3A 1JVGA 1TW1A 2JCKA 3NGWA 3OGZA 4B2XA 1LZJA 2P6WA 1H7GA 2RIXA 1ZJ3A 3V8ZA 3SXEA 3SXGA 3ZLKA 1H5SB 2ZU8A 1ZDGA 3I0IX 1ZJ2A 3U2XA 1G3LA 1MC3A 4Y7TA 4B4MA 3ZF8A 3PKPA 2WEEA 1VZUA 4HO2A 4LW3A 4HO4A 2FYAA 4HO3A 2QGIA 2MZBA 2Z87A 4KC4A 2VSHA 5CQNX 4CJ8A 4HG6A 1ZI5A 1H5TA 1W57A 2YQHA 2VS5A 4FCUA 5JQQA 4P02A 4KPXA 3I0JA 2WAWA 5EJZA 1QGSA 1MP5A 1NQIB 4FRQA 1WT2A 4FREA 3I0FA 3RMVA 4Y7VA 5C8RA 3OH1A 1FO8A 1G9RA 4M2BA 3CKOA 3U2WA 1IINA 1GWVA 3FWWA 1HJLA 2GGQA 4HO8A 2X5SA 1R7XA 2CU2A 3IOJA 5I1FA 2AESA 4ZDQA 5C48A 1G8OA 1NWGB 2RJ1A 2V0IA 5BXCA 3V91A 1H7HA 3I0EA 3LW6A 2DPWA 2ICXA 4KC2A 4Y64A 5C1GA
chains in the Genus database with same CATH superfamily
4MIXA 2YCMA 2RJ7A 4EE5A 1PZYB 3SXBA 2YQCA 5C3DA 3CKJA 1WT3A 2YESA 1FRWA 3TZTA 1VGWA 2VXMA 3R2WA 2C0NA 4FRPA 2E8BA 5CMHA 2VXLA 1VGUA 2AM4A 2PGYA 2QKXA 2W0VA 4C2SA 2ICYA 2OEFA 4FQWA 4NALA 4KQLA 5FU0A 2E3DA 4CVHA 2OEGA 4FRAA 4EE3A 3SXDA 2JCJA 3I0HA 1FXOA 4M2AA 2V0HA 1ZCTA 2OI5A 1H5RA 5CQOA 1W55A 3USQA 1FO9A 3D98A 3PKQA 1XZ6A 5FV9A 1G2VA 1HJJA 2X5ZA 1MP4A 1WT0A 2Y4LA 3D8VA 3JTJA 4Y6UA 4B5BA 5C47A 1H4EA 3DJ4A 4FRDA 3V0NA 4KNXA 4Y62A 4HO0A 3Q80A 2XWMA 2Y4JA 2PX7A 2FYCB 1G1LA 2JCLA 3PNNA 2AH9A 1EYRA 1YP4A 3U0YA 2VK9A 2I7BA 3USRA 3CKQA 1VGZA 1GQCA 5J49A 4AC3A 4O6MA 5CQLX 1FG5N 2Y7AA 2AE7A 4J18A 2O1HA 3IOIA 1I52A 5EIYA 2Y4MA 3POLA 2JCOA 5CMJA 1YP2A 2Q4JA 4O6NA 3QVBA 1LZ0A 5FTSA 4B2WA 1FOAA 2RJ9A 5D92A 1FGGA 2WVLA 1GX4A 2XWNA 4CJCA 1G93A 3HL3A 4NANA 4G3PA 4UEGA 5C1HA 2P72A 2W0WA 1ZI3A 1K4VA 2WVKA 2XMEA 3RMWA 1G95A 4FRBA 4BQHA 2VFZA 1V84A 1TW5A 4DDZA 1VPAA 1NHEB 4E1KA 4FRHA 2YC5A 3Q4SA 1PZTA 4FIXA 1V83A 3OKRA 3CKNA 1EZIA 1Z90A 4JISA 1JV1A 5C1LA 3CKVA 2AM5A 1WT1A 1FXJA 1VM8A 4KC1A 3V0OA 3V0PA 4FROA 1R80A 1W77A 4AYLA 4D48A 3EE5A 3CU0A 2APCA 5C4FA 4HO5A 2RITA 3JUKA 1R7YA 1H7TA 4MYBA 2VS3A 1R7VA 4HOCA 2PGVA 1HM9A 4Y9XA 1VH1A 4KPZA 2RJ5A 4IRPA 5FTVA 1FGXA 3K8EA 3FOQA 2RIYA 4M28A 5C3AA 3KIAA 4DE7A 5C4CA 1H5TB 4B3UA 2A8WA 4EEGA 2FYBA 4BMAA 1WVCA 1LZIA 3V90A 4Y6NA 4GBPA 4G3QA 5L6SA 1VH3A 1VGTA 4MNDA 2VSIA 5CQPA 1H4CA 2I5KA 2X60A 1INJA 3F1CA 2OI7A 4KRVA 1LL0A 1R7TA 4FRMA 1H4DA 1V82A 3V0MA 2J0AA 3ZGGA 1HM8A 3T7NA 1H5SD 3T7OA 1FZWA 3ZLLA 1GA8A 1YP3A 1ZCUA 1TVYA 2RJ0A 4K6RA 4EE4A 1FR8A 1R81A 4HO9A 5DDVA 5C4DA 3SXAA 1S4PA 5C3BA 3O3PA 1O23B 1VZXA 2ZU9A 3E26A 2WGZA 1R82A 4KNRA 1S4OA 2BO6A 1KWSA 1H3MA 1O0RA 1ZCVA 3E25A 3OAMA 5FU8A 1E5KA 3N9WA 5D91A 4CJBA 4B4BA 2YQJA 5C36A 2FFUA 4EEMA 1SS9A 1LZ7A 1QG8A 4EVWA 3DUVA 1VZTA 1YROB 2A8UA 3SX7A 3TQDA 2PA4A 1IIMA 2AECA 3BRKX 4P00A 4JD0A 2FY7A 1H5RB 1ZJOA 2AGDA 2UX8A 4DECA 3I0GA 1ZJ0A 4KT7A 1VICA 3U0XA 5FUHA 1ZHJA 2Z86A 4ECMA 4AAWA 2Y4KA 1ON6A 5L6VA 4NAIA 2NXVA 1OQMB 4L41C 2D0JA 3SX5A 1NMMB 5C49A 5C4BA 2RJ4A 1TZFA 1G97A 3I0LA 1GX0A 3RSBA 5AJPA 2O1GA 1ZI4A 2YQSA 4Y63A 1ON8A 2ZU7A 1H7EA 5CMGX 1GWWA 2Y6PA 4M4KA 1FR9A 2BO8A 2XWLA 1NKHB 4G87A 5AJOA 4B42A 4HCQA 2RJ6A 2WVMA 1H7LA 1NF5B 2X65A 3F1YA 1G0RA 4B4GA 1FWYA 1G23A 4EEOA 2I5EA 3CGXA 3ST8A 4KXOA 1QGQA 3SX8A 3I0DA 2RIZA 4D0TA 3D5NA 5IDTA 2D7RA 3U2UA 1H7FA 1ZDFA 3K8DA 4LW6A 3OC9A 3SPTA 2FFVA 3I0CA 3I0KA 2FYDB 4FCEA 3U2TA 3V0LA 1JYLA 4Y7FA 4ASJA 4R7PA 2O1FA 2V0JA 2WE9A 2QH5A 1XHBA 4D0ZA 2VD4A 1O7QA 3Q7UA 1WSZA 1R7UA 2OI6A 3SX3A 4ARWA 1HV9A 2YC3A 5FYEA 4XWIA 2V0LA 1ZJPA 3OH3A 1MP3A 4Y7UA 1GQ9A 1JYKA 4IRQA 1JV3A 5CMIA 1O7OA 3OH4A 1QWJA 3BCVA 2XMHA 3GUEA 4AYJA 4D11A 5IFYA 1S4NA 4Y7GA 2GGOA 3DK5A 3JUJA 5AJNA 1H5SA 1ZJ1A 1ZI1A 5HS2A 1ZCYA 4FRLA 5IDSA 2AM3A 1INIA 5DDTA 1OMZA 3T7MA 3V8YA 3ZGFA 4D11C 3U2VA 4NAKA 1JVDA 2BO7A 1H7QA 3V0QA 3R3IA 5C38A 1H5SC 4FIYA 5EJ1A 4EEAA 3OH0A 5CQMX 1HM0A 2RJ8A 2V0KA 1LL2A 3OH2A 4HO6A 3IOHA 4G3SA 1LVWA 2BO4A 2D7IA 5C4EA 5CMFX 1OMXA 3SXCA 4YS8A 2VS4A 1ZIZA 4ASYA 2P73A 1LL3A 1JVGA 1TW1A 2JCKA 3NGWA 3OGZA 4B2XA 1LZJA 2P6WA 1H7GA 2RIXA 1ZJ3A 3V8ZA 3SXEA 3SXGA 3ZLKA 1H5SB 2ZU8A 1ZDGA 3I0IX 1ZJ2A 3U2XA 1G3LA 1MC3A 4Y7TA 4B4MA 3ZF8A 3PKPA 2WEEA 1VZUA 4HO2A 4LW3A 4HO4A 2FYAA 4HO3A 2QGIA 2MZBA 2Z87A 4KC4A 2VSHA 5CQNX 4CJ8A 4HG6A 2J0BA 4Q7CA 1ZI5A 1H5TA 1W57A 2YQHA 2VS5A 4FCUA 5JQQA 4P02A 4KPXA 3I0JA 2WAWA 5EJZA 1QGSA 1MP5A 1NQIB 4FRQA 1WT2A 4FREA 3I0FA 3RMVA 4Y7VA 5C8RA 3OH1A 1FO8A 1G9RA 4M2BA 3CKOA 3U2WA 1IINA 1GWVA 3FWWA 1HJLA 2GGQA 4HO8A 2X5SA 1R7XA 2CU2A 3IOJA 5I1FA 2AESA 4ZDQA 5C48A 1G8OA 1NWGB 2RJ1A 2V0IA 5BXCA 3V91A 1H7HA 3I0EA 3LW6A 2DPWA 2ICXA 4KC2A 4Y64A 5C1GA
chains in the Genus database with same CATH topology
4MIXA 2YCMA 2RJ7A 4EE5A 1PZYB 3SXBA 2YQCA 5C3DA 3CKJA 1WT3A 2YESA 1FRWA 3TZTA 1VGWA 2VXMA 3R2WA 2C0NA 4FRPA 2E8BA 5CMHA 2VXLA 1VGUA 2AM4A 2PGYA 2QKXA 2W0VA 4C2SA 2ICYA 2OEFA 4FQWA 4NALA 4KQLA 5FU0A 2E3DA 4CVHA 2OEGA 4FRAA 4EE3A 3SXDA 2JCJA 3I0HA 1FXOA 4M2AA 2V0HA 1ZCTA 2OI5A 1H5RA 5CQOA 1W55A 3USQA 1FO9A 3D98A 3PKQA 1XZ6A 5FV9A 1G2VA 1HJJA 2X5ZA 1MP4A 1WT0A 2Y4LA 3D8VA 3JTJA 4Y6UA 4B5BA 5C47A 1H4EA 3DJ4A 4FRDA 3V0NA 4KNXA 4Y62A 4HO0A 3Q80A 2XWMA 2Y4JA 2PX7A 2FYCB 1G1LA 2JCLA 3PNNA 2AH9A 1EYRA 1YP4A 3U0YA 2VK9A 2I7BA 3USRA 3CKQA 1VGZA 1GQCA 5J49A 4AC3A 4O6MA 5CQLX 1FG5N 2Y7AA 2AE7A 4J18A 2O1HA 3IOIA 1I52A 5EIYA 2Y4MA 3POLA 2JCOA 5CMJA 1YP2A 2Q4JA 4O6NA 3QVBA 1LZ0A 5FTSA 4B2WA 1FOAA 2RJ9A 5D92A 1FGGA 2WVLA 1GX4A 2XWNA 4CJCA 1G93A 3HL3A 4NANA 4G3PA 4UEGA 5C1HA 2P72A 2W0WA 1ZI3A 1K4VA 2WVKA 2XMEA 3RMWA 1G95A 4FRBA 4BQHA 2VFZA 1V84A 1TW5A 4DDZA 1VPAA 1NHEB 4E1KA 4FRHA 2YC5A 3Q4SA 1PZTA 4FIXA 1V83A 3OKRA 3CKNA 1EZIA 1Z90A 4JISA 1JV1A 5C1LA 3CKVA 2AM5A 1WT1A 1FXJA 1VM8A 4KC1A 3V0OA 3V0PA 4FROA 1R80A 1W77A 4AYLA 4D48A 3EE5A 3CU0A 2APCA 5C4FA 4HO5A 2RITA 3JUKA 1R7YA 1H7TA 4MYBA 2VS3A 1R7VA 4HOCA 2PGVA 1HM9A 4Y9XA 1VH1A 4KPZA 2RJ5A 4IRPA 5FTVA 1FGXA 3K8EA 3FOQA 2RIYA 4M28A 5C3AA 3KIAA 4DE7A 5C4CA 1H5TB 4B3UA 2A8WA 4EEGA 2FYBA 4BMAA 1WVCA 1LZIA 3V90A 4Y6NA 4GBPA 4G3QA 5L6SA 1VH3A 1VGTA 4MNDA 2VSIA 5CQPA 1H4CA 2I5KA 2X60A 1INJA 3F1CA 2OI7A 4KRVA 1LL0A 1R7TA 4FRMA 1H4DA 1V82A 3V0MA 2J0AA 3ZGGA 1HM8A 3T7NA 1H5SD 3T7OA 1FZWA 3ZLLA 1GA8A 1YP3A 1ZCUA 1TVYA 2RJ0A 4K6RA 4EE4A 1FR8A 1R81A 4HO9A 5DDVA 5C4DA 3SXAA 1S4PA 5C3BA 3O3PA 1O23B 1VZXA 2ZU9A 3E26A 2WGZA 1R82A 4KNRA 1S4OA 2BO6A 1KWSA 1H3MA 1O0RA 1ZCVA 3E25A 3OAMA 5FU8A 1E5KA 3N9WA 5D91A 4CJBA 4B4BA 2YQJA 5C36A 2FFUA 4EEMA 1SS9A 1LZ7A 1QG8A 4EVWA 3DUVA 1VZTA 1YROB 2A8UA 3SX7A 3TQDA 2PA4A 1IIMA 2AECA 3BRKX 4P00A 4JD0A 2FY7A 1H5RB 1ZJOA 2AGDA 2UX8A 4DECA 3I0GA 1ZJ0A 4KT7A 1VICA 3U0XA 5FUHA 1ZHJA 2Z86A 4ECMA 4AAWA 2Y4KA 1ON6A 5L6VA 4NAIA 2NXVA 1OQMB 4L41C 2D0JA 3SX5A 1NMMB 5C49A 5C4BA 2RJ4A 1TZFA 1G97A 3I0LA 1GX0A 3RSBA 5AJPA 2O1GA 1ZI4A 2YQSA 4Y63A 1ON8A 2ZU7A 1H7EA 5CMGX 1GWWA 2Y6PA 4M4KA 1FR9A 2BO8A 2XWLA 1NKHB 4G87A 5AJOA 4B42A 4HCQA 2RJ6A 2WVMA 1H7LA 1NF5B 2X65A 3F1YA 1G0RA 4B4GA 1FWYA 1G23A 4EEOA 2I5EA 3CGXA 3ST8A 4KXOA 1QGQA 3SX8A 3I0DA 2RIZA 4D0TA 3D5NA 5IDTA 2D7RA 3U2UA 1H7FA 1ZDFA 3K8DA 4LW6A 3OC9A 3SPTA 2FFVA 3I0CA 3I0KA 2FYDB 4FCEA 3U2TA 3V0LA 1JYLA 4Y7FA 4ASJA 4R7PA 2O1FA 2V0JA 2WE9A 2QH5A 1XHBA 4D0ZA 2VD4A 1O7QA 3Q7UA 1WSZA 1R7UA 2OI6A 3SX3A 4ARWA 1HV9A 2YC3A 5FYEA 4XWIA 2V0LA 1ZJPA 3OH3A 1MP3A 4Y7UA 1GQ9A 1JYKA 4IRQA 1JV3A 5CMIA 1O7OA 3OH4A 1QWJA 3BCVA 2XMHA 3GUEA 4AYJA 4D11A 5IFYA 1S4NA 4Y7GA 2GGOA 3DK5A 3JUJA 5AJNA 1H5SA 1ZJ1A 1ZI1A 5HS2A 1ZCYA 4FRLA 5IDSA 2AM3A 1INIA 5DDTA 1OMZA 3T7MA 3V8YA 3ZGFA 4D11C 3U2VA 4NAKA 1JVDA 2BO7A 1H7QA 3V0QA 3R3IA 5C38A 1H5SC 4FIYA 5EJ1A 4EEAA 3OH0A 5CQMX 1HM0A 2RJ8A 2V0KA 1LL2A 3OH2A 4HO6A 3IOHA 4G3SA 1LVWA 2BO4A 2D7IA 5C4EA 5CMFX 1OMXA 3SXCA 4YS8A 2VS4A 1ZIZA 4ASYA 2P73A 1LL3A 1JVGA 1TW1A 2JCKA 3NGWA 3OGZA 4B2XA 1LZJA 2P6WA 1H7GA 2RIXA 1ZJ3A 3V8ZA 3SXEA 3SXGA 3ZLKA 1H5SB 2ZU8A 1ZDGA 3I0IX 1ZJ2A 3U2XA 1G3LA 1MC3A 4Y7TA 4B4MA 3ZF8A 3PKPA 2WEEA 1VZUA 4HO2A 4LW3A 4HO4A 2FYAA 4HO3A 2QGIA 2MZBA 2Z87A 4KC4A 2VSHA 5CQNX 4CJ8A 4HG6A 2J0BA 4Q7CA 1ZI5A 1H5TA 1W57A 2YQHA 2VS5A 4FCUA 5JQQA 4P02A 4KPXA 3I0JA 2WAWA 5EJZA 1QGSA 1MP5A 1NQIB 4FRQA 1WT2A 4FREA 3I0FA 3RMVA 4Y7VA 5C8RA 3OH1A 1FO8A 1G9RA 4M2BA 3CKOA 3U2WA 1IINA 1GWVA 3FWWA 1HJLA 2GGQA 4HO8A 2X5SA 1R7XA 2CU2A 3IOJA 5I1FA 2AESA 4ZDQA 5C48A 1G8OA 1NWGB 2RJ1A 2V0IA 5BXCA 3V91A 1H7HA 3I0EA 3LW6A 2DPWA 2ICXA 4KC2A 4Y64A 5C1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YCM A;  2RJ7 A;  4EE5 A;  1PZY B;  3SXB A;  2YQC A;  5C3D A;  3CKJ A;  1WT3 A;  2YES A;  1FRW A;  3TZT A;  1VGW A;  2VXM A;  3R2W A;  4FRP A;  2E8B A;  5CMH A;  2VXL A;  1VGU A;  2AM4 A;  2PGY A;  2QKX A;  2W0V A;  4C2S A;  2ICY A;  2OEF A;  4FQW A;  4NAL A;  4KQL A;  5FU0 A;  2E3D A;  4CVH A;  2OEG A;  4FRA A;  4EE3 A;  3SXD A;  2JCJ A;  3I0H A;  1FXO A;  4M2A A;  2V0H A;  1ZCT A;  2OI5 A;  1H5R A;  5CQO A;  1W55 A;  3USQ A;  1FO9 A;  3D98 A;  3PKQ A;  1XZ6 A;  5FV9 A;  1G2V A;  1HJJ A;  2X5Z A;  1MP4 A;  1WT0 A;  2Y4L A;  3D8V A;  3JTJ A;  4Y6U A;  4B5B A;  5C47 A;  1H4E A;  3DJ4 A;  4FRD A;  3V0N A;  4KNX A;  4Y62 A;  4HO0 A;  3Q80 A;  2XWM A;  2Y4J A;  2PX7 A;  2FYC B;  1G1L A;  2JCL A;  3PNN A;  2AH9 A;  1EYR A;  1YP4 A;  3U0Y A;  2I7B A;  3USR A;  3CKQ A;  1VGZ A;  1GQC A;  5J49 A;  4AC3 A;  5CQL X;  1FG5 N;  2Y7A A;  2AE7 A;  4J18 A;  2O1H A;  3IOI A;  1I52 A;  5EIY A;  2Y4M A;  3POL A;  2JCO A;  5CMJ A;  1YP2 A;  2Q4J A;  3QVB A;  1LZ0 A;  5FTS A;  4B2W A;  1FOA A;  2RJ9 A;  1FGG A;  2WVL A;  1GX4 A;  2XWN A;  4CJC A;  1G93 A;  3HL3 A;  4NAN A;  4G3P A;  4UEG A;  5C1H A;  2P72 A;  2W0W A;  1ZI3 A;  1K4V A;  2WVK A;  2XME A;  3RMW A;  1G95 A;  4FRB A;  4BQH A;  2VFZ A;  1V84 A;  1TW5 A;  4DDZ A;  1VPA A;  1NHE B;  4E1K A;  4FRH A;  2YC5 A;  3Q4S A;  1PZT A;  1V83 A;  3OKR A;  3CKN A;  1EZI A;  1Z90 A;  4JIS A;  1JV1 A;  5C1L A;  3CKV A;  2AM5 A;  1WT1 A;  1FXJ A;  1VM8 A;  4KC1 A;  3V0O A;  3V0P A;  4FRO A;  1R80 A;  1W77 A;  4AYL A;  4D48 A;  3EE5 A;  3CU0 A;  2APC A;  5C4F A;  4HO5 A;  2RIT A;  3JUK A;  1R7Y A;  1H7T A;  4MYB A;  2VS3 A;  1R7V A;  4HOC A;  2PGV A;  1HM9 A;  4Y9X A;  1VH1 A;  4KPZ A;  2RJ5 A;  4IRP A;  5FTV A;  1FGX A;  3K8E A;  3FOQ A;  2RIY A;  4M28 A;  5C3A A;  3KIA A;  4DE7 A;  5C4C A;  1H5T B;  4B3U A;  2A8W A;  4EEG A;  2FYB A;  4BMA A;  1WVC A;  1LZI A;  3V90 A;  4Y6N A;  4GBP A;  4G3Q A;  5L6S A;  1VH3 A;  1VGT A;  4MND A;  2VSI A;  5CQP A;  1H4C A;  2I5K A;  2X60 A;  1INJ A;  3F1C A;  2OI7 A;  4KRV A;  1LL0 A;  1R7T A;  4FRM A;  1H4D A;  1V82 A;  3V0M A;  3ZGG A;  1HM8 A;  3T7N A;  1H5S D;  3T7O A;  1FZW A;  3ZLL A;  1GA8 A;  1YP3 A;  1ZCU A;  1TVY A;  2RJ0 A;  4K6R A;  4EE4 A;  1FR8 A;  1R81 A;  4HO9 A;  5DDV A;  5C4D A;  3SXA A;  1S4P A;  5C3B A;  3O3P A;  1O23 B;  1VZX A;  2ZU9 A;  3E26 A;  2WGZ A;  1R82 A;  4KNR A;  1S4O A;  2BO6 A;  1KWS A;  1H3M A;  1O0R A;  1ZCV A;  3E25 A;  3OAM A;  5FU8 A;  1E5K A;  3N9W A;  4CJB A;  4B4B A;  2YQJ A;  5C36 A;  2FFU A;  4EEM A;  1SS9 A;  1LZ7 A;  1QG8 A;  4EVW A;  3DUV A;  1VZT A;  1YRO B;  2A8U A;  3SX7 A;  3TQD A;  2PA4 A;  1IIM A;  2AEC A;  3BRK X;  4P00 A;  4JD0 A;  2FY7 A;  1H5R B;  1ZJO A;  2AGD A;  2UX8 A;  4DEC A;  3I0G A;  1ZJ0 A;  4KT7 A;  1VIC A;  3U0X A;  5FUH A;  1ZHJ A;  2Z86 A;  4ECM A;  4AAW A;  2Y4K A;  1ON6 A;  5L6V A;  4NAI A;  2NXV A;  1OQM B;  4L41 C;  2D0J A;  3SX5 A;  1NMM B;  5C49 A;  5C4B A;  2RJ4 A;  1TZF A;  1G97 A;  3I0L A;  1GX0 A;  3RSB A;  5AJP A;  2O1G A;  1ZI4 A;  2YQS A;  4Y63 A;  1ON8 A;  2ZU7 A;  1H7E A;  5CMG X;  1GWW A;  2Y6P A;  4M4K A;  1FR9 A;  2BO8 A;  2XWL A;  1NKH B;  4G87 A;  5AJO A;  4B42 A;  4HCQ A;  2RJ6 A;  2WVM A;  1H7L A;  1NF5 B;  2X65 A;  3F1Y A;  1G0R A;  4B4G A;  1FWY A;  1G23 A;  4EEO A;  2I5E A;  3CGX A;  3ST8 A;  4KXO A;  1QGQ A;  3SX8 A;  3I0D A;  2RIZ A;  4D0T A;  3D5N A;  5IDT A;  2D7R A;  3U2U A;  1H7F A;  1ZDF A;  3K8D A;  4LW6 A;  3OC9 A;  3SPT A;  2FFV A;  3I0C A;  3I0K A;  2FYD B;  4FCE A;  3U2T A;  3V0L A;  1JYL A;  4Y7F A;  4ASJ A;  4R7P A;  2O1F A;  2V0J A;  2WE9 A;  2QH5 A;  1XHB A;  4D0Z A;  2VD4 A;  1O7Q A;  3Q7U A;  1WSZ A;  1R7U A;  2OI6 A;  3SX3 A;  4ARW A;  1HV9 A;  2YC3 A;  5FYE A;  4XWI A;  2V0L A;  1ZJP A;  3OH3 A;  1MP3 A;  4Y7U A;  1GQ9 A;  1JYK A;  4IRQ A;  1JV3 A;  5CMI A;  1O7O A;  3OH4 A;  1QWJ A;  3BCV A;  2XMH A;  3GUE A;  4AYJ A;  4D11 A;  5IFY A;  1S4N A;  4Y7G A;  2GGO A;  3DK5 A;  3JUJ A;  5AJN A;  1H5S A;  1ZJ1 A;  1ZI1 A;  5HS2 A;  1ZCY A;  4FRL A;  5IDS A;  2AM3 A;  1INI A;  5DDT A;  1OMZ A;  3T7M A;  3V8Y A;  3ZGF A;  4D11 C;  3U2V A;  4NAK A;  1JVD A;  2BO7 A;  1H7Q A;  3V0Q A;  3R3I A;  5C38 A;  1H5S C;  5EJ1 A;  4EEA A;  3OH0 A;  5CQM X;  1HM0 A;  2RJ8 A;  2V0K A;  1LL2 A;  3OH2 A;  4HO6 A;  3IOH A;  4G3S A;  1LVW A;  2BO4 A;  2D7I A;  5C4E A;  5CMF X;  1OMX A;  3SXC A;  4YS8 A;  2VS4 A;  1ZIZ A;  4ASY A;  2P73 A;  1LL3 A;  1JVG A;  1TW1 A;  2JCK A;  3NGW A;  3OGZ A;  4B2X A;  1LZJ A;  2P6W A;  1H7G A;  2RIX A;  1ZJ3 A;  3V8Z A;  3SXE A;  3SXG A;  3ZLK A;  1H5S B;  2ZU8 A;  1ZDG A;  3I0I X;  1ZJ2 A;  3U2X A;  1G3L A;  1MC3 A;  4Y7T A;  4B4M A;  3ZF8 A;  3PKP A;  2WEE A;  1VZU A;  4HO2 A;  4LW3 A;  4HO4 A;  2FYA A;  4HO3 A;  2QGI A;  2MZB A;  2Z87 A;  4KC4 A;  2VSH A;  5CQN X;  4CJ8 A;  4HG6 A;  1ZI5 A;  1H5T A;  1W57 A;  2YQH A;  2VS5 A;  4FCU A;  5JQQ A;  4P02 A;  4KPX A;  3I0J A;  2WAW A;  5EJZ A;  1QGS A;  1MP5 A;  1NQI B;  4FRQ A;  1WT2 A;  4FRE A;  3I0F A;  3RMV A;  4Y7V A;  5C8R A;  3OH1 A;  1FO8 A;  1G9R A;  4M2B A;  3CKO A;  3U2W A;  1IIN A;  1GWV A;  3FWW A;  1HJL A;  2GGQ A;  4HO8 A;  2X5S A;  1R7X A;  2CU2 A;  3IOJ A;  5I1F A;  2AES A;  4ZDQ A;  5C48 A;  1G8O A;  1NWG B;  2RJ1 A;  2V0I A;  5BXC A;  3V91 A;  1H7H A;  3I0E A;  3LW6 A;  2DPW A;  2ICX A;  4KC2 A;  4Y64 A;  5C1G A; 
#chains in the Genus database with same CATH topology
 4MIX A;  2YCM A;  2RJ7 A;  4EE5 A;  1PZY B;  3SXB A;  2YQC A;  5C3D A;  3CKJ A;  1WT3 A;  2YES A;  1FRW A;  3TZT A;  1VGW A;  2VXM A;  3R2W A;  2C0N A;  4FRP A;  2E8B A;  5CMH A;  2VXL A;  1VGU A;  2AM4 A;  2PGY A;  2QKX A;  2W0V A;  4C2S A;  2ICY A;  2OEF A;  4FQW A;  4NAL A;  4KQL A;  5FU0 A;  2E3D A;  4CVH A;  2OEG A;  4FRA A;  4EE3 A;  3SXD A;  2JCJ A;  3I0H A;  1FXO A;  4M2A A;  2V0H A;  1ZCT A;  2OI5 A;  1H5R A;  5CQO A;  1W55 A;  3USQ A;  1FO9 A;  3D98 A;  3PKQ A;  1XZ6 A;  5FV9 A;  1G2V A;  1HJJ A;  2X5Z A;  1MP4 A;  1WT0 A;  2Y4L A;  3D8V A;  3JTJ A;  4Y6U A;  4B5B A;  5C47 A;  1H4E A;  3DJ4 A;  4FRD A;  3V0N A;  4KNX A;  4Y62 A;  4HO0 A;  3Q80 A;  2XWM A;  2Y4J A;  2PX7 A;  2FYC B;  1G1L A;  2JCL A;  3PNN A;  2AH9 A;  1EYR A;  1YP4 A;  3U0Y A;  2VK9 A;  2I7B A;  3USR A;  3CKQ A;  1VGZ A;  1GQC A;  5J49 A;  4AC3 A;  4O6M A;  5CQL X;  1FG5 N;  2Y7A A;  2AE7 A;  4J18 A;  2O1H A;  3IOI A;  1I52 A;  5EIY A;  2Y4M A;  3POL A;  2JCO A;  5CMJ A;  1YP2 A;  2Q4J A;  4O6N A;  3QVB A;  1LZ0 A;  5FTS A;  4B2W A;  1FOA A;  2RJ9 A;  5D92 A;  1FGG A;  2WVL A;  1GX4 A;  2XWN A;  4CJC A;  1G93 A;  3HL3 A;  4NAN A;  4G3P A;  4UEG A;  5C1H A;  2P72 A;  2W0W A;  1ZI3 A;  1K4V A;  2WVK A;  2XME A;  3RMW A;  1G95 A;  4FRB A;  4BQH A;  2VFZ A;  1V84 A;  1TW5 A;  4DDZ A;  1VPA A;  1NHE B;  4E1K A;  4FRH A;  2YC5 A;  3Q4S A;  1PZT A;  4FIX A;  1V83 A;  3OKR A;  3CKN A;  1EZI A;  1Z90 A;  4JIS A;  1JV1 A;  5C1L A;  3CKV A;  2AM5 A;  1WT1 A;  1FXJ A;  1VM8 A;  4KC1 A;  3V0O A;  3V0P A;  4FRO A;  1R80 A;  1W77 A;  4AYL A;  4D48 A;  3EE5 A;  3CU0 A;  2APC A;  5C4F A;  4HO5 A;  2RIT A;  3JUK A;  1R7Y A;  1H7T A;  4MYB A;  2VS3 A;  1R7V A;  4HOC A;  2PGV A;  1HM9 A;  4Y9X A;  1VH1 A;  4KPZ A;  2RJ5 A;  4IRP A;  5FTV A;  1FGX A;  3K8E A;  3FOQ A;  2RIY A;  4M28 A;  5C3A A;  3KIA A;  4DE7 A;  5C4C A;  1H5T B;  4B3U A;  2A8W A;  4EEG A;  2FYB A;  4BMA A;  1WVC A;  1LZI A;  3V90 A;  4Y6N A;  4GBP A;  4G3Q A;  5L6S A;  1VH3 A;  1VGT A;  4MND A;  2VSI A;  5CQP A;  1H4C A;  2I5K A;  2X60 A;  1INJ A;  3F1C A;  2OI7 A;  4KRV A;  1LL0 A;  1R7T A;  4FRM A;  1H4D A;  1V82 A;  3V0M A;  2J0A A;  3ZGG A;  1HM8 A;  3T7N A;  1H5S D;  3T7O A;  1FZW A;  3ZLL A;  1GA8 A;  1YP3 A;  1ZCU A;  1TVY A;  2RJ0 A;  4K6R A;  4EE4 A;  1FR8 A;  1R81 A;  4HO9 A;  5DDV A;  5C4D A;  3SXA A;  1S4P A;  5C3B A;  3O3P A;  1O23 B;  1VZX A;  2ZU9 A;  3E26 A;  2WGZ A;  1R82 A;  4KNR A;  1S4O A;  2BO6 A;  1KWS A;  1H3M A;  1O0R A;  1ZCV A;  3E25 A;  3OAM A;  5FU8 A;  1E5K A;  3N9W A;  5D91 A;  4CJB A;  4B4B A;  2YQJ A;  5C36 A;  2FFU A;  4EEM A;  1SS9 A;  1LZ7 A;  1QG8 A;  4EVW A;  3DUV A;  1VZT A;  1YRO B;  2A8U A;  3SX7 A;  3TQD A;  2PA4 A;  1IIM A;  2AEC A;  3BRK X;  4P00 A;  4JD0 A;  2FY7 A;  1H5R B;  1ZJO A;  2AGD A;  2UX8 A;  4DEC A;  3I0G A;  1ZJ0 A;  4KT7 A;  1VIC A;  3U0X A;  5FUH A;  1ZHJ A;  2Z86 A;  4ECM A;  4AAW A;  2Y4K A;  1ON6 A;  5L6V A;  4NAI A;  2NXV A;  1OQM B;  4L41 C;  2D0J A;  3SX5 A;  1NMM B;  5C49 A;  5C4B A;  2RJ4 A;  1TZF A;  1G97 A;  3I0L A;  1GX0 A;  3RSB A;  5AJP A;  2O1G A;  1ZI4 A;  2YQS A;  4Y63 A;  1ON8 A;  2ZU7 A;  1H7E A;  5CMG X;  1GWW A;  2Y6P A;  4M4K A;  1FR9 A;  2BO8 A;  2XWL A;  1NKH B;  4G87 A;  5AJO A;  4B42 A;  4HCQ A;  2RJ6 A;  2WVM A;  1H7L A;  1NF5 B;  2X65 A;  3F1Y A;  1G0R A;  4B4G A;  1FWY A;  1G23 A;  4EEO A;  2I5E A;  3CGX A;  3ST8 A;  4KXO A;  1QGQ A;  3SX8 A;  3I0D A;  2RIZ A;  4D0T A;  3D5N A;  5IDT A;  2D7R A;  3U2U A;  1H7F A;  1ZDF A;  3K8D A;  4LW6 A;  3OC9 A;  3SPT A;  2FFV A;  3I0C A;  3I0K A;  2FYD B;  4FCE A;  3U2T A;  3V0L A;  1JYL A;  4Y7F A;  4ASJ A;  4R7P A;  2O1F A;  2V0J A;  2WE9 A;  2QH5 A;  1XHB A;  4D0Z A;  2VD4 A;  1O7Q A;  3Q7U A;  1WSZ A;  1R7U A;  2OI6 A;  3SX3 A;  4ARW A;  1HV9 A;  2YC3 A;  5FYE A;  4XWI A;  2V0L A;  1ZJP A;  3OH3 A;  1MP3 A;  4Y7U A;  1GQ9 A;  1JYK A;  4IRQ A;  1JV3 A;  5CMI A;  1O7O A;  3OH4 A;  1QWJ A;  3BCV A;  2XMH A;  3GUE A;  4AYJ A;  4D11 A;  5IFY A;  1S4N A;  4Y7G A;  2GGO A;  3DK5 A;  3JUJ A;  5AJN A;  1H5S A;  1ZJ1 A;  1ZI1 A;  5HS2 A;  1ZCY A;  4FRL A;  5IDS A;  2AM3 A;  1INI A;  5DDT A;  1OMZ A;  3T7M A;  3V8Y A;  3ZGF A;  4D11 C;  3U2V A;  4NAK A;  1JVD A;  2BO7 A;  1H7Q A;  3V0Q A;  3R3I A;  5C38 A;  1H5S C;  4FIY A;  5EJ1 A;  4EEA A;  3OH0 A;  5CQM X;  1HM0 A;  2RJ8 A;  2V0K A;  1LL2 A;  3OH2 A;  4HO6 A;  3IOH A;  4G3S A;  1LVW A;  2BO4 A;  2D7I A;  5C4E A;  5CMF X;  1OMX A;  3SXC A;  4YS8 A;  2VS4 A;  1ZIZ A;  4ASY A;  2P73 A;  1LL3 A;  1JVG A;  1TW1 A;  2JCK A;  3NGW A;  3OGZ A;  4B2X A;  1LZJ A;  2P6W A;  1H7G A;  2RIX A;  1ZJ3 A;  3V8Z A;  3SXE A;  3SXG A;  3ZLK A;  1H5S B;  2ZU8 A;  1ZDG A;  3I0I X;  1ZJ2 A;  3U2X A;  1G3L A;  1MC3 A;  4Y7T A;  4B4M A;  3ZF8 A;  3PKP A;  2WEE A;  1VZU A;  4HO2 A;  4LW3 A;  4HO4 A;  2FYA A;  4HO3 A;  2QGI A;  2MZB A;  2Z87 A;  4KC4 A;  2VSH A;  5CQN X;  4CJ8 A;  4HG6 A;  2J0B A;  4Q7C A;  1ZI5 A;  1H5T A;  1W57 A;  2YQH A;  2VS5 A;  4FCU A;  5JQQ A;  4P02 A;  4KPX A;  3I0J A;  2WAW A;  5EJZ A;  1QGS A;  1MP5 A;  1NQI B;  4FRQ A;  1WT2 A;  4FRE A;  3I0F A;  3RMV A;  4Y7V A;  5C8R A;  3OH1 A;  1FO8 A;  1G9R A;  4M2B A;  3CKO A;  3U2W A;  1IIN A;  1GWV A;  3FWW A;  1HJL A;  2GGQ A;  4HO8 A;  2X5S A;  1R7X A;  2CU2 A;  3IOJ A;  5I1F A;  2AES A;  4ZDQ A;  5C48 A;  1G8O A;  1NWG B;  2RJ1 A;  2V0I A;  5BXC A;  3V91 A;  1H7H A;  3I0E A;  3LW6 A;  2DPW A;  2ICX A;  4KC2 A;  4Y64 A;  5C1G A; 
#chains in the Genus database with same CATH homology
 4MIX A;  2YCM A;  2RJ7 A;  4EE5 A;  1PZY B;  3SXB A;  2YQC A;  5C3D A;  3CKJ A;  1WT3 A;  2YES A;  1FRW A;  3TZT A;  1VGW A;  2VXM A;  3R2W A;  2C0N A;  4FRP A;  2E8B A;  5CMH A;  2VXL A;  1VGU A;  2AM4 A;  2PGY A;  2QKX A;  2W0V A;  4C2S A;  2ICY A;  2OEF A;  4FQW A;  4NAL A;  4KQL A;  5FU0 A;  2E3D A;  4CVH A;  2OEG A;  4FRA A;  4EE3 A;  3SXD A;  2JCJ A;  3I0H A;  1FXO A;  4M2A A;  2V0H A;  1ZCT A;  2OI5 A;  1H5R A;  5CQO A;  1W55 A;  3USQ A;  1FO9 A;  3D98 A;  3PKQ A;  1XZ6 A;  5FV9 A;  1G2V A;  1HJJ A;  2X5Z A;  1MP4 A;  1WT0 A;  2Y4L A;  3D8V A;  3JTJ A;  4Y6U A;  4B5B A;  5C47 A;  1H4E A;  3DJ4 A;  4FRD A;  3V0N A;  4KNX A;  4Y62 A;  4HO0 A;  3Q80 A;  2XWM A;  2Y4J A;  2PX7 A;  2FYC B;  1G1L A;  2JCL A;  3PNN A;  2AH9 A;  1EYR A;  1YP4 A;  3U0Y A;  2VK9 A;  2I7B A;  3USR A;  3CKQ A;  1VGZ A;  1GQC A;  5J49 A;  4AC3 A;  4O6M A;  5CQL X;  1FG5 N;  2Y7A A;  2AE7 A;  4J18 A;  2O1H A;  3IOI A;  1I52 A;  5EIY A;  2Y4M A;  3POL A;  2JCO A;  5CMJ A;  1YP2 A;  2Q4J A;  4O6N A;  3QVB A;  1LZ0 A;  5FTS A;  4B2W A;  1FOA A;  2RJ9 A;  5D92 A;  1FGG A;  2WVL A;  1GX4 A;  2XWN A;  4CJC A;  1G93 A;  3HL3 A;  4NAN A;  4G3P A;  4UEG A;  5C1H A;  2P72 A;  2W0W A;  1ZI3 A;  1K4V A;  2WVK A;  2XME A;  3RMW A;  1G95 A;  4FRB A;  4BQH A;  2VFZ A;  1V84 A;  1TW5 A;  4DDZ A;  1VPA A;  1NHE B;  4E1K A;  4FRH A;  2YC5 A;  3Q4S A;  1PZT A;  4FIX A;  1V83 A;  3OKR A;  3CKN A;  1EZI A;  1Z90 A;  4JIS A;  1JV1 A;  5C1L A;  3CKV A;  2AM5 A;  1WT1 A;  1FXJ A;  1VM8 A;  4KC1 A;  3V0O A;  3V0P A;  4FRO A;  1R80 A;  1W77 A;  4AYL A;  4D48 A;  3EE5 A;  3CU0 A;  2APC A;  5C4F A;  4HO5 A;  2RIT A;  3JUK A;  1R7Y A;  1H7T A;  4MYB A;  2VS3 A;  1R7V A;  4HOC A;  2PGV A;  1HM9 A;  4Y9X A;  1VH1 A;  4KPZ A;  2RJ5 A;  4IRP A;  5FTV A;  1FGX A;  3K8E A;  3FOQ A;  2RIY A;  4M28 A;  5C3A A;  3KIA A;  4DE7 A;  5C4C A;  1H5T B;  4B3U A;  2A8W A;  4EEG A;  2FYB A;  4BMA A;  1WVC A;  1LZI A;  3V90 A;  4Y6N A;  4GBP A;  4G3Q A;  5L6S A;  1VH3 A;  1VGT A;  4MND A;  2VSI A;  5CQP A;  1H4C A;  2I5K A;  2X60 A;  1INJ A;  3F1C A;  2OI7 A;  4KRV A;  1LL0 A;  1R7T A;  4FRM A;  1H4D A;  1V82 A;  3V0M A;  2J0A A;  3ZGG A;  1HM8 A;  3T7N A;  1H5S D;  3T7O A;  1FZW A;  3ZLL A;  1GA8 A;  1YP3 A;  1ZCU A;  1TVY A;  2RJ0 A;  4K6R A;  4EE4 A;  1FR8 A;  1R81 A;  4HO9 A;  5DDV A;  5C4D A;  3SXA A;  1S4P A;  5C3B A;  3O3P A;  1O23 B;  1VZX A;  2ZU9 A;  3E26 A;  2WGZ A;  1R82 A;  4KNR A;  1S4O A;  2BO6 A;  1KWS A;  1H3M A;  1O0R A;  1ZCV A;  3E25 A;  3OAM A;  5FU8 A;  1E5K A;  3N9W A;  5D91 A;  4CJB A;  4B4B A;  2YQJ A;  5C36 A;  2FFU A;  4EEM A;  1SS9 A;  1LZ7 A;  1QG8 A;  4EVW A;  3DUV A;  1VZT A;  1YRO B;  2A8U A;  3SX7 A;  3TQD A;  2PA4 A;  1IIM A;  2AEC A;  3BRK X;  4P00 A;  4JD0 A;  2FY7 A;  1H5R B;  1ZJO A;  2AGD A;  2UX8 A;  4DEC A;  3I0G A;  1ZJ0 A;  4KT7 A;  1VIC A;  3U0X A;  5FUH A;  1ZHJ A;  2Z86 A;  4ECM A;  4AAW A;  2Y4K A;  1ON6 A;  5L6V A;  4NAI A;  2NXV A;  1OQM B;  4L41 C;  2D0J A;  3SX5 A;  1NMM B;  5C49 A;  5C4B A;  2RJ4 A;  1TZF A;  1G97 A;  3I0L A;  1GX0 A;  3RSB A;  5AJP A;  2O1G A;  1ZI4 A;  2YQS A;  4Y63 A;  1ON8 A;  2ZU7 A;  1H7E A;  5CMG X;  1GWW A;  2Y6P A;  4M4K A;  1FR9 A;  2BO8 A;  2XWL A;  1NKH B;  4G87 A;  5AJO A;  4B42 A;  4HCQ A;  2RJ6 A;  2WVM A;  1H7L A;  1NF5 B;  2X65 A;  3F1Y A;  1G0R A;  4B4G A;  1FWY A;  1G23 A;  4EEO A;  2I5E A;  3CGX A;  3ST8 A;  4KXO A;  1QGQ A;  3SX8 A;  3I0D A;  2RIZ A;  4D0T A;  3D5N A;  5IDT A;  2D7R A;  3U2U A;  1H7F A;  1ZDF A;  3K8D A;  4LW6 A;  3OC9 A;  3SPT A;  2FFV A;  3I0C A;  3I0K A;  2FYD B;  4FCE A;  3U2T A;  3V0L A;  1JYL A;  4Y7F A;  4ASJ A;  4R7P A;  2O1F A;  2V0J A;  2WE9 A;  2QH5 A;  1XHB A;  4D0Z A;  2VD4 A;  1O7Q A;  3Q7U A;  1WSZ A;  1R7U A;  2OI6 A;  3SX3 A;  4ARW A;  1HV9 A;  2YC3 A;  5FYE A;  4XWI A;  2V0L A;  1ZJP A;  3OH3 A;  1MP3 A;  4Y7U A;  1GQ9 A;  1JYK A;  4IRQ A;  1JV3 A;  5CMI A;  1O7O A;  3OH4 A;  1QWJ A;  3BCV A;  2XMH A;  3GUE A;  4AYJ A;  4D11 A;  5IFY A;  1S4N A;  4Y7G A;  2GGO A;  3DK5 A;  3JUJ A;  5AJN A;  1H5S A;  1ZJ1 A;  1ZI1 A;  5HS2 A;  1ZCY A;  4FRL A;  5IDS A;  2AM3 A;  1INI A;  5DDT A;  1OMZ A;  3T7M A;  3V8Y A;  3ZGF A;  4D11 C;  3U2V A;  4NAK A;  1JVD A;  2BO7 A;  1H7Q A;  3V0Q A;  3R3I A;  5C38 A;  1H5S C;  4FIY A;  5EJ1 A;  4EEA A;  3OH0 A;  5CQM X;  1HM0 A;  2RJ8 A;  2V0K A;  1LL2 A;  3OH2 A;  4HO6 A;  3IOH A;  4G3S A;  1LVW A;  2BO4 A;  2D7I A;  5C4E A;  5CMF X;  1OMX A;  3SXC A;  4YS8 A;  2VS4 A;  1ZIZ A;  4ASY A;  2P73 A;  1LL3 A;  1JVG A;  1TW1 A;  2JCK A;  3NGW A;  3OGZ A;  4B2X A;  1LZJ A;  2P6W A;  1H7G A;  2RIX A;  1ZJ3 A;  3V8Z A;  3SXE A;  3SXG A;  3ZLK A;  1H5S B;  2ZU8 A;  1ZDG A;  3I0I X;  1ZJ2 A;  3U2X A;  1G3L A;  1MC3 A;  4Y7T A;  4B4M A;  3ZF8 A;  3PKP A;  2WEE A;  1VZU A;  4HO2 A;  4LW3 A;  4HO4 A;  2FYA A;  4HO3 A;  2QGI A;  2MZB A;  2Z87 A;  4KC4 A;  2VSH A;  5CQN X;  4CJ8 A;  4HG6 A;  2J0B A;  4Q7C A;  1ZI5 A;  1H5T A;  1W57 A;  2YQH A;  2VS5 A;  4FCU A;  5JQQ A;  4P02 A;  4KPX A;  3I0J A;  2WAW A;  5EJZ A;  1QGS A;  1MP5 A;  1NQI B;  4FRQ A;  1WT2 A;  4FRE A;  3I0F A;  3RMV A;  4Y7V A;  5C8R A;  3OH1 A;  1FO8 A;  1G9R A;  4M2B A;  3CKO A;  3U2W A;  1IIN A;  1GWV A;  3FWW A;  1HJL A;  2GGQ A;  4HO8 A;  2X5S A;  1R7X A;  2CU2 A;  3IOJ A;  5I1F A;  2AES A;  4ZDQ A;  5C48 A;  1G8O A;  1NWG B;  2RJ1 A;  2V0I A;  5BXC A;  3V91 A;  1H7H A;  3I0E A;  3LW6 A;  2DPW A;  2ICX A;  4KC2 A;  4Y64 A;  5C1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...