1H4DA

Biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
188
structure length
188
Chain Sequence
MTTITGVVLAGGKARRMGLVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Molybdenum cofactor biosynthesis
molecule keywords MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS PROTEIN A
publication title Biochemical and Structural Analysis of the Molybdenum Cofactor Biosynthesis Protein Moba
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 188
sequence length 188
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h4dA00
2JCOA 3I0LA 1NKHB 5C4FA 2YQSA 1EYRA 2VFZA 2AESA 4EVWA 4P00A 4DE7A 3D5NA 3CKQA 5C3AA 4Y62A 1INIA 5DDVA 5FV9A 2WVKA 4LW3A 2YQHA 1H7QA 3SXDA 3OH0A 4LW6A 2XWLA 1R7XA 4CJCA 1ZI1A 1W55A 3ZGFA 5BXCA 2VXLA 3SPTA 3JUJA 1VZTA 4NANA 5J49A 1H7LA 1FZWA 3KIAA 1ZJ1A 2W0VA 4AC3A 1G93A 3RMVA 3I0JA 5IDSA 2RIZA 3E25A 1W57A 3V0PA 4D0ZA 1NHEB 3SX5A 1HM9A 3BRKX 2V0JA 5CQPA 3EE5A 4Y7FA 4E1KA 1H5SA 3SXCA 3U2XA 4B42A 1KWSA 2AGDA 2D7RA 1MC3A 5L6VA 1LZJA 2PA4A 1HJJA 4K6RA 4FRPA 2P73A 2X5SA 2Y4JA 2QKXA 5C1HA 5HS2A 3U0XA 1ZCUA 5CQNX 2BO7A 1I52A 2WVLA 4NAKA 3NGWA 1HV9A 1GQ9A 2Z87A 1YP2A 3OKRA 1JV3A 5I1FA 4Y7GA 1PZYB 5C8RA 2X5ZA 1G9RA 2AE7A 2O1FA 3ZGGA 2FFVA 2OEFA 4DECA 5JQQA 3R3IA 3QVBA 4CJ8A 2RJ0A 5EJ1A 4HO3A 1FR8A 3CKOA 3POLA 1WSZA 1TW5A 2WAWA 3SX8A 3USRA 1ZJ2A 1G2VA 1H7EA 1JVDA 3OH4A 3U2TA 2JCLA 3OH3A 4Y6NA 3V8YA 1FG5N 5C49A 3V90A 1INJA 2OI5A 3SXGA 1VICA 1EZIA 4B4GA 3SXAA 2ZU7A 1QG8A 1ZJ3A 5FYEA 2RJ1A 3I0KA 3OGZA 2I5EA 1FRWA 2RJ8A 2BO6A 3JTJA 4G3PA 3LW6A 3SX3A 2AECA 2BO4A 2FYBA 4HO8A 3HL3A 2VXMA 1ZI4A 3I0GA 1FR9A 1XHBA 1GX0A 5C3DA 1LL3A 2I7BA 4Y64A 5FTSA 5FUHA 1H7HA 2Y7AA 5C4DA 1H3MA 4B2XA 3ZLLA 3DK5A 1VGUA 1LVWA 1H4EA 3OAMA 1VH1A 1VM8A 2RJ5A 2GGOA 4BQHA 1GQCA 4GBPA 2V0HA 2WEEA 2XMEA 4FQWA 1LZ7A 3PNNA 4JD0A 4CJBA 1ZHJA 3OC9A 2JCKA 1K4VA 4M28A 4HO4A 1V84A 4Y7TA 2YQCA 5AJOA 2VD4A 3IOJA 4M2AA 1GWWA 3OH1A 1ON8A 4R7PA 4G3SA 1VH3A 2XWNA 4JISA 4EEMA 1WT1A 1G8OA 2YCMA 4EE3A 1LZIA 1ZDGA 1ZIZA 1V83A 4B4BA 1NWGB 5C38A 3R2WA 1WT0A 3U0YA 1FO9A 3SXBA 1QWJA 1ZDFA 2WE9A 5IFYA 2D7IA 3F1CA 1WT3A 2P6WA 3V0QA 4D11A 1OMXA 3CU0A 4EEGA 2A8WA 1YROB 1O7OA 3USQA 1JV1A 4EEAA 2FYDB 1VGZA 1O0RA 1JYLA 5C1GA 1ZI3A 1IIMA 1GA8A 4FROA 3TZTA 1PZTA 3OH2A 2XMHA 2E3DA 4XWIA 4G3QA 3V91A 1V82A 1ZJPA 3FWWA 4KPZA 2P72A 5CMGX 4HCQA 2VS4A 3RMWA 4B2WA 1ZJOA 4KC2A 5C36A 4HO9A 1NQIB 4HO6A 4AYLA 2Y6PA 1TW1A 3CGXA 2YESA 5C4EA 5IDTA 4HO2A 4MYBA 1NF5B 4J18A 1R7YA 2RJ4A 3TQDA 1H5SC 2V0KA 1R81A 4P02A 3BCVA 4Y63A 1HJLA 1H5RB 2V0LA 4IRQA 2GGQA 3D8VA 3K8DA 4EE5A 1G0RA 3E26A 1GX4A 1TVYA 4ZDQA 1O7QA 2ICXA 4Y7VA 4ARWA 3U2UA 3IOIA 1FXJA 3I0DA 1R80A 2RITA 1SS9A 5L6SA 1XZ6A 4Y7UA 4NALA 1S4PA 1R7TA 1S4OA 2Y4LA 2RIYA 2YC5A 4FRBA 3I0FA 3JUKA 4AYJA 5CMJA 4Y9XA 2AM3A 3CKNA 3I0CA 2NXVA 5DDTA 5CQLX 1LL2A 1G23A 1FOAA 2FY7A 1H4CA 2A8UA 4FRQA 4KPXA 1JYKA 2RJ7A 1JVGA 2JCJA 4FRHA 2VSIA 4KQLA 3SX7A 3V0LA 2FYCB 2PGVA 2Y4MA 1QGSA 4KC4A 2O1HA 2VS3A 2X60A 2FYAA 4DDZA 1OQMB 1NMMB 2ZU8A 2Z86A 2CU2A 3O3PA 5CMIA 4AAWA 2WGZA 3T7MA 1TZFA 5CQMX 1G1LA 2WVMA 1G97A 4C2SA 2Y4KA 1H7GA 1W77A 1IINA 2DPWA 3U2WA 4FRAA 3SXEA 4D0TA 2YQJA 3Q80A 5EIYA 2OI7A 2AM5A 1H5TB 2ICYA 3ST8A 4M4KA 3I0IX 3RSBA 4NAIA 2PX7A 4ECMA 3DUVA 1H5RA 3V0OA 3Q7UA 2O1GA 5CQOA 1H7FA 3F1YA 4HG6A 2VSHA 1ZI5A 4B4MA 4FRMA 5C1LA 3GUEA 3U2VA 4B5BA 5C4CA 2YC3A 5EJZA 1H5SD 2XWMA 4KNRA 4KT7A 3CKJA 1ZJ0A 3CKVA 1R7UA 1HM8A 1VZUA 1H7TA 1VGWA 2UX8A 2APCA 2PGYA 5FU0A 1MP5A 4B3UA 1S4NA 4EEOA 4KC1A 5C3BA 2RIXA 2BO8A 2W0WA 4Y6UA 1FGXA 2OEGA 5C48A 1FXOA 1WT2A 2AM4A 2QH5A 3D98A 4CVHA 2MZBA 3ZLKA 2RJ6A 5CMFX 1FGGA 4ASYA 4HO5A 1MP3A 3T7NA 3N9WA 3DJ4A 1OMZA 1R7VA 4D48A 1MP4A 4FRDA 4UEGA 1O23B 3ZF8A 1R82A 4FCUA 2D0JA 1ON6A 1H4DA 4BMAA 1ZCTA 3IOHA 4YS8A 5C47A 4M2BA 3V8ZA 2AH9A 3I0HA 4FREA 4ASJA 1Z90A 1LZ0A 3PKPA 1HM0A 3T7OA 3K8EA 4D11C 1FO8A 1LL0A 4IRPA 3PKQA 3V0NA 1GWVA 1G95A 2X65A 4EE4A 4HOCA 4KNXA 4KXOA 4KRVA 4HO0A 1E5KA 1H5TA 5AJNA 3Q4SA 2VS5A 1YP4A 2ZU9A 1H5SB 1VZXA 2I5KA 4MNDA 5AJPA 4FRLA 3I0EA 1G3LA 2V0IA 1ZCVA 3V0MA 2OI6A 1VPAA 1ZCYA 1VGTA 2Q4JA 2QGIA 5FU8A 1QGQA 2E8BA 5CMHA 5FTVA 5C4BA 2RJ9A 2FFUA 4G87A 1YP3A 1WVCA 1FWYA 3FOQA 4FCEA 4L41C
chains in the Genus database with same CATH superfamily
2JCOA 3I0LA 1NKHB 5C4FA 2YQSA 1EYRA 2VFZA 2AESA 4EVWA 4P00A 4DE7A 3D5NA 3CKQA 5C3AA 4Y62A 1INIA 5DDVA 5FV9A 2WVKA 4LW3A 2YQHA 1H7QA 3SXDA 3OH0A 4LW6A 2XWLA 1R7XA 4CJCA 2J0AA 1ZI1A 1W55A 3ZGFA 5BXCA 2VXLA 3SPTA 3JUJA 1VZTA 4NANA 5J49A 1H7LA 1FZWA 3KIAA 1ZJ1A 2W0VA 4AC3A 1G93A 4Q7CA 3RMVA 3I0JA 5IDSA 2RIZA 3E25A 1W57A 2J0BA 3V0PA 4D0ZA 1NHEB 3SX5A 1HM9A 3BRKX 2V0JA 5D91A 5CQPA 3EE5A 4Y7FA 4E1KA 1H5SA 3SXCA 4O6MA 3U2XA 4B42A 1KWSA 2AGDA 2D7RA 1MC3A 5L6VA 1LZJA 2PA4A 1HJJA 4K6RA 4FRPA 2P73A 2X5SA 2Y4JA 2QKXA 5C1HA 5HS2A 3U0XA 1ZCUA 5CQNX 2BO7A 1I52A 2WVLA 4NAKA 3NGWA 1HV9A 1GQ9A 2Z87A 1YP2A 3OKRA 1JV3A 5I1FA 4Y7GA 1PZYB 5C8RA 2X5ZA 1G9RA 2AE7A 2O1FA 3ZGGA 2FFVA 2OEFA 4DECA 5JQQA 3R3IA 3QVBA 4CJ8A 2RJ0A 5EJ1A 4HO3A 1FR8A 3CKOA 3POLA 1WSZA 1TW5A 2WAWA 3SX8A 3USRA 1ZJ2A 1G2VA 1H7EA 1JVDA 3OH4A 3U2TA 2JCLA 3OH3A 4Y6NA 3V8YA 1FG5N 5C49A 3V90A 1INJA 2OI5A 3SXGA 1VICA 1EZIA 4B4GA 3SXAA 2ZU7A 1QG8A 1ZJ3A 4FIYA 5FYEA 2RJ1A 3I0KA 3OGZA 2I5EA 1FRWA 2RJ8A 2BO6A 3JTJA 4G3PA 4MIXA 3LW6A 3SX3A 2AECA 2BO4A 2FYBA 4HO8A 3HL3A 2VXMA 1ZI4A 3I0GA 1FR9A 1XHBA 1GX0A 5C3DA 1LL3A 2I7BA 4Y64A 5FTSA 5FUHA 1H7HA 2Y7AA 5C4DA 1H3MA 4B2XA 3ZLLA 3DK5A 1VGUA 1LVWA 1H4EA 3OAMA 1VH1A 1VM8A 2RJ5A 2GGOA 4BQHA 1GQCA 4GBPA 2V0HA 2WEEA 2XMEA 4FQWA 1LZ7A 3PNNA 4JD0A 4CJBA 1ZHJA 3OC9A 2JCKA 1K4VA 4M28A 4HO4A 1V84A 4Y7TA 2YQCA 5AJOA 2VD4A 3IOJA 4M2AA 1GWWA 3OH1A 1ON8A 4R7PA 4G3SA 1VH3A 2XWNA 4JISA 4EEMA 1WT1A 1G8OA 2YCMA 4EE3A 1LZIA 1ZDGA 1ZIZA 1V83A 4B4BA 1NWGB 5C38A 3R2WA 1WT0A 3U0YA 1FO9A 3SXBA 1QWJA 4FIXA 1ZDFA 2C0NA 2WE9A 2D7IA 5IFYA 3F1CA 1WT3A 2P6WA 3V0QA 4D11A 1OMXA 3CU0A 4EEGA 2A8WA 1YROB 1O7OA 3USQA 2VK9A 1JV1A 4EEAA 2FYDB 1VGZA 1O0RA 1JYLA 5C1GA 1ZI3A 1IIMA 1GA8A 4FROA 3TZTA 1PZTA 3OH2A 2XMHA 2E3DA 4XWIA 4G3QA 3V91A 1V82A 1ZJPA 4O6NA 3FWWA 4KPZA 2P72A 5CMGX 4HCQA 2VS4A 3RMWA 4B2WA 1ZJOA 4KC2A 5C36A 4HO9A 1NQIB 4HO6A 4AYLA 2Y6PA 1TW1A 3CGXA 2YESA 5C4EA 5IDTA 4HO2A 4MYBA 1NF5B 4J18A 1R7YA 2RJ4A 3TQDA 1H5SC 2V0KA 1R81A 4P02A 3BCVA 4Y63A 1HJLA 1H5RB 2V0LA 4IRQA 2GGQA 3D8VA 3K8DA 4EE5A 1G0RA 3E26A 1GX4A 1TVYA 4ZDQA 1O7QA 2ICXA 4Y7VA 4ARWA 3U2UA 3IOIA 1FXJA 3I0DA 1R80A 2RITA 1SS9A 5L6SA 1XZ6A 4Y7UA 4NALA 1S4PA 1R7TA 1S4OA 2Y4LA 2RIYA 2YC5A 4FRBA 3I0FA 3JUKA 4AYJA 5CMJA 4Y9XA 2AM3A 3CKNA 3I0CA 5D92A 2NXVA 5DDTA 5CQLX 1LL2A 1G23A 1FOAA 2FY7A 1H4CA 2A8UA 4FRQA 4KPXA 1JYKA 2RJ7A 1JVGA 2JCJA 4FRHA 2VSIA 4KQLA 3SX7A 3V0LA 2FYCB 2PGVA 2Y4MA 1QGSA 4KC4A 2O1HA 2VS3A 2X60A 2FYAA 4DDZA 1OQMB 1NMMB 2ZU8A 2Z86A 2CU2A 3O3PA 5CMIA 4AAWA 2WGZA 3T7MA 1TZFA 5CQMX 1G1LA 2WVMA 1G97A 4C2SA 2Y4KA 1H7GA 1W77A 1IINA 2DPWA 3U2WA 4FRAA 3SXEA 4D0TA 2YQJA 3Q80A 5EIYA 2OI7A 2AM5A 1H5TB 2ICYA 3ST8A 4M4KA 3I0IX 3RSBA 4NAIA 2PX7A 4ECMA 3DUVA 1H5RA 3V0OA 3Q7UA 2O1GA 5CQOA 1H7FA 3F1YA 4HG6A 2VSHA 1ZI5A 4B4MA 4FRMA 5C1LA 3GUEA 3U2VA 4B5BA 5C4CA 2YC3A 5EJZA 1H5SD 2XWMA 4KNRA 4KT7A 3CKJA 1ZJ0A 3CKVA 1R7UA 1HM8A 1VZUA 1H7TA 1VGWA 2UX8A 2APCA 2PGYA 5FU0A 1MP5A 4B3UA 1S4NA 4EEOA 4KC1A 5C3BA 2RIXA 2BO8A 2W0WA 4Y6UA 1FGXA 2OEGA 5C48A 1FXOA 1WT2A 2AM4A 2QH5A 3D98A 4CVHA 2MZBA 3ZLKA 2RJ6A 5CMFX 1FGGA 4ASYA 4HO5A 1MP3A 3T7NA 3N9WA 3DJ4A 1OMZA 1R7VA 4D48A 1MP4A 4FRDA 4UEGA 1O23B 3ZF8A 1R82A 4FCUA 2D0JA 1ON6A 1H4DA 4BMAA 1ZCTA 3IOHA 4YS8A 5C47A 4M2BA 3V8ZA 2AH9A 3I0HA 4FREA 4ASJA 1Z90A 1LZ0A 3PKPA 1HM0A 3T7OA 3K8EA 4D11C 1FO8A 1LL0A 4IRPA 3PKQA 3V0NA 1GWVA 1G95A 2X65A 4EE4A 4HOCA 4KNXA 4KXOA 4KRVA 4HO0A 1E5KA 1H5TA 5AJNA 3Q4SA 2VS5A 1YP4A 2ZU9A 1H5SB 1VZXA 2I5KA 4MNDA 5AJPA 4FRLA 3I0EA 1G3LA 2V0IA 1ZCVA 3V0MA 2OI6A 1VPAA 1ZCYA 1VGTA 2Q4JA 2QGIA 5FU8A 1QGQA 2E8BA 5CMHA 5FTVA 5C4BA 2RJ9A 2FFUA 4G87A 1YP3A 1WVCA 1FWYA 3FOQA 4FCEA 4L41C
chains in the Genus database with same CATH topology
2JCOA 3I0LA 1NKHB 5C4FA 2YQSA 1EYRA 2VFZA 2AESA 4EVWA 4P00A 4DE7A 3D5NA 3CKQA 5C3AA 4Y62A 1INIA 5DDVA 5FV9A 2WVKA 4LW3A 2YQHA 1H7QA 3SXDA 3OH0A 4LW6A 2XWLA 1R7XA 4CJCA 2J0AA 1ZI1A 1W55A 3ZGFA 5BXCA 2VXLA 3SPTA 3JUJA 1VZTA 4NANA 5J49A 1H7LA 1FZWA 3KIAA 1ZJ1A 2W0VA 4AC3A 1G93A 4Q7CA 3RMVA 3I0JA 5IDSA 2RIZA 3E25A 1W57A 2J0BA 3V0PA 4D0ZA 1NHEB 3SX5A 1HM9A 3BRKX 2V0JA 5D91A 5CQPA 3EE5A 4Y7FA 4E1KA 1H5SA 3SXCA 4O6MA 3U2XA 4B42A 1KWSA 2AGDA 2D7RA 1MC3A 5L6VA 1LZJA 2PA4A 1HJJA 4K6RA 4FRPA 2P73A 2X5SA 2Y4JA 2QKXA 5C1HA 5HS2A 3U0XA 1ZCUA 5CQNX 2BO7A 1I52A 2WVLA 4NAKA 3NGWA 1HV9A 1GQ9A 2Z87A 1YP2A 3OKRA 1JV3A 5I1FA 4Y7GA 1PZYB 5C8RA 2X5ZA 1G9RA 2AE7A 2O1FA 3ZGGA 2FFVA 2OEFA 4DECA 5JQQA 3R3IA 3QVBA 4CJ8A 2RJ0A 5EJ1A 4HO3A 1FR8A 3CKOA 3POLA 1WSZA 1TW5A 2WAWA 3SX8A 3USRA 1ZJ2A 1G2VA 1H7EA 1JVDA 3OH4A 3U2TA 2JCLA 3OH3A 4Y6NA 3V8YA 1FG5N 5C49A 3V90A 1INJA 2OI5A 3SXGA 1VICA 1EZIA 4B4GA 3SXAA 2ZU7A 1QG8A 1ZJ3A 4FIYA 5FYEA 2RJ1A 3I0KA 3OGZA 2I5EA 1FRWA 2RJ8A 2BO6A 3JTJA 4G3PA 4MIXA 3LW6A 3SX3A 2AECA 2BO4A 2FYBA 4HO8A 3HL3A 2VXMA 1ZI4A 3I0GA 1FR9A 1XHBA 1GX0A 5C3DA 1LL3A 2I7BA 4Y64A 5FTSA 5FUHA 1H7HA 2Y7AA 5C4DA 1H3MA 4B2XA 3ZLLA 3DK5A 1VGUA 1LVWA 1H4EA 3OAMA 1VH1A 1VM8A 2RJ5A 2GGOA 4BQHA 1GQCA 4GBPA 2V0HA 2WEEA 2XMEA 4FQWA 1LZ7A 3PNNA 4JD0A 4CJBA 1ZHJA 3OC9A 2JCKA 1K4VA 4M28A 4HO4A 1V84A 4Y7TA 2YQCA 5AJOA 2VD4A 3IOJA 4M2AA 1GWWA 3OH1A 1ON8A 4R7PA 4G3SA 1VH3A 2XWNA 4JISA 4EEMA 1WT1A 1G8OA 2YCMA 4EE3A 1LZIA 1ZDGA 1ZIZA 1V83A 4B4BA 1NWGB 5C38A 3R2WA 1WT0A 3U0YA 1FO9A 3SXBA 1QWJA 4FIXA 1ZDFA 2C0NA 2WE9A 2D7IA 5IFYA 3F1CA 1WT3A 2P6WA 3V0QA 4D11A 1OMXA 3CU0A 4EEGA 2A8WA 1YROB 1O7OA 3USQA 2VK9A 1JV1A 4EEAA 2FYDB 1VGZA 1O0RA 1JYLA 5C1GA 1ZI3A 1IIMA 1GA8A 4FROA 3TZTA 1PZTA 3OH2A 2XMHA 2E3DA 4XWIA 4G3QA 3V91A 1V82A 1ZJPA 4O6NA 3FWWA 4KPZA 2P72A 5CMGX 4HCQA 2VS4A 3RMWA 4B2WA 1ZJOA 4KC2A 5C36A 4HO9A 1NQIB 4HO6A 4AYLA 2Y6PA 1TW1A 3CGXA 2YESA 5C4EA 5IDTA 4HO2A 4MYBA 1NF5B 4J18A 1R7YA 2RJ4A 3TQDA 1H5SC 2V0KA 1R81A 4P02A 3BCVA 4Y63A 1HJLA 1H5RB 2V0LA 4IRQA 2GGQA 3D8VA 3K8DA 4EE5A 1G0RA 3E26A 1GX4A 1TVYA 4ZDQA 1O7QA 2ICXA 4Y7VA 4ARWA 3U2UA 3IOIA 1FXJA 3I0DA 1R80A 2RITA 1SS9A 5L6SA 1XZ6A 4Y7UA 4NALA 1S4PA 1R7TA 1S4OA 2Y4LA 2RIYA 2YC5A 4FRBA 3I0FA 3JUKA 4AYJA 5CMJA 4Y9XA 2AM3A 3CKNA 3I0CA 5D92A 2NXVA 5DDTA 5CQLX 1LL2A 1G23A 1FOAA 2FY7A 1H4CA 2A8UA 4FRQA 4KPXA 1JYKA 2RJ7A 1JVGA 2JCJA 4FRHA 2VSIA 4KQLA 3SX7A 3V0LA 2FYCB 2PGVA 2Y4MA 1QGSA 4KC4A 2O1HA 2VS3A 2X60A 2FYAA 4DDZA 1OQMB 1NMMB 2ZU8A 2Z86A 2CU2A 3O3PA 5CMIA 4AAWA 2WGZA 3T7MA 1TZFA 5CQMX 1G1LA 2WVMA 1G97A 4C2SA 2Y4KA 1H7GA 1W77A 1IINA 2DPWA 3U2WA 4FRAA 3SXEA 4D0TA 2YQJA 3Q80A 5EIYA 2OI7A 2AM5A 1H5TB 2ICYA 3ST8A 4M4KA 3I0IX 3RSBA 4NAIA 2PX7A 4ECMA 3DUVA 1H5RA 3V0OA 3Q7UA 2O1GA 5CQOA 1H7FA 3F1YA 4HG6A 2VSHA 1ZI5A 4B4MA 4FRMA 5C1LA 3GUEA 3U2VA 4B5BA 5C4CA 2YC3A 5EJZA 1H5SD 2XWMA 4KNRA 4KT7A 3CKJA 1ZJ0A 3CKVA 1R7UA 1HM8A 1VZUA 1H7TA 1VGWA 2UX8A 2APCA 2PGYA 5FU0A 1MP5A 4B3UA 1S4NA 4EEOA 4KC1A 5C3BA 2RIXA 2BO8A 2W0WA 4Y6UA 1FGXA 2OEGA 5C48A 1FXOA 1WT2A 2AM4A 2QH5A 3D98A 4CVHA 2MZBA 3ZLKA 2RJ6A 5CMFX 1FGGA 4ASYA 4HO5A 1MP3A 3T7NA 3N9WA 3DJ4A 1OMZA 1R7VA 4D48A 1MP4A 4FRDA 4UEGA 1O23B 3ZF8A 1R82A 4FCUA 2D0JA 1ON6A 1H4DA 4BMAA 1ZCTA 3IOHA 4YS8A 5C47A 4M2BA 3V8ZA 2AH9A 3I0HA 4FREA 4ASJA 1Z90A 1LZ0A 3PKPA 1HM0A 3T7OA 3K8EA 4D11C 1FO8A 1LL0A 4IRPA 3PKQA 3V0NA 1GWVA 1G95A 2X65A 4EE4A 4HOCA 4KNXA 4KXOA 4KRVA 4HO0A 1E5KA 1H5TA 5AJNA 3Q4SA 2VS5A 1YP4A 2ZU9A 1H5SB 1VZXA 2I5KA 4MNDA 5AJPA 4FRLA 3I0EA 1G3LA 2V0IA 1ZCVA 3V0MA 2OI6A 1VPAA 1ZCYA 1VGTA 2Q4JA 2QGIA 5FU8A 1QGQA 2E8BA 5CMHA 5FTVA 5C4BA 2RJ9A 2FFUA 4G87A 1YP3A 1WVCA 1FWYA 3FOQA 4FCEA 4L41C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JCO A;  3I0L A;  1NKH B;  5C4F A;  2YQS A;  1EYR A;  2VFZ A;  2AES A;  4EVW A;  4P00 A;  4DE7 A;  3D5N A;  3CKQ A;  5C3A A;  4Y62 A;  1INI A;  5DDV A;  5FV9 A;  2WVK A;  4LW3 A;  2YQH A;  1H7Q A;  3SXD A;  3OH0 A;  4LW6 A;  2XWL A;  1R7X A;  4CJC A;  1ZI1 A;  1W55 A;  3ZGF A;  5BXC A;  2VXL A;  3SPT A;  3JUJ A;  1VZT A;  4NAN A;  5J49 A;  1H7L A;  1FZW A;  3KIA A;  1ZJ1 A;  2W0V A;  4AC3 A;  1G93 A;  3RMV A;  3I0J A;  5IDS A;  2RIZ A;  3E25 A;  1W57 A;  3V0P A;  4D0Z A;  1NHE B;  3SX5 A;  1HM9 A;  3BRK X;  2V0J A;  5CQP A;  3EE5 A;  4Y7F A;  4E1K A;  1H5S A;  3SXC A;  3U2X A;  4B42 A;  1KWS A;  2AGD A;  2D7R A;  1MC3 A;  5L6V A;  1LZJ A;  2PA4 A;  1HJJ A;  4K6R A;  4FRP A;  2P73 A;  2X5S A;  2Y4J A;  2QKX A;  5C1H A;  5HS2 A;  3U0X A;  1ZCU A;  5CQN X;  2BO7 A;  1I52 A;  2WVL A;  4NAK A;  3NGW A;  1HV9 A;  1GQ9 A;  2Z87 A;  1YP2 A;  3OKR A;  1JV3 A;  5I1F A;  4Y7G A;  1PZY B;  5C8R A;  2X5Z A;  1G9R A;  2AE7 A;  2O1F A;  3ZGG A;  2FFV A;  2OEF A;  4DEC A;  5JQQ A;  3R3I A;  3QVB A;  4CJ8 A;  2RJ0 A;  5EJ1 A;  4HO3 A;  1FR8 A;  3CKO A;  3POL A;  1WSZ A;  1TW5 A;  2WAW A;  3SX8 A;  3USR A;  1ZJ2 A;  1G2V A;  1H7E A;  1JVD A;  3OH4 A;  3U2T A;  2JCL A;  3OH3 A;  4Y6N A;  3V8Y A;  1FG5 N;  5C49 A;  3V90 A;  1INJ A;  2OI5 A;  3SXG A;  1VIC A;  1EZI A;  4B4G A;  3SXA A;  2ZU7 A;  1QG8 A;  1ZJ3 A;  5FYE A;  2RJ1 A;  3I0K A;  3OGZ A;  2I5E A;  1FRW A;  2RJ8 A;  2BO6 A;  3JTJ A;  4G3P A;  3LW6 A;  3SX3 A;  2AEC A;  2BO4 A;  2FYB A;  4HO8 A;  3HL3 A;  2VXM A;  1ZI4 A;  3I0G A;  1FR9 A;  1XHB A;  1GX0 A;  5C3D A;  1LL3 A;  2I7B A;  4Y64 A;  5FTS A;  5FUH A;  1H7H A;  2Y7A A;  5C4D A;  1H3M A;  4B2X A;  3ZLL A;  3DK5 A;  1VGU A;  1LVW A;  1H4E A;  3OAM A;  1VH1 A;  1VM8 A;  2RJ5 A;  2GGO A;  4BQH A;  1GQC A;  4GBP A;  2V0H A;  2WEE A;  2XME A;  4FQW A;  1LZ7 A;  3PNN A;  4JD0 A;  4CJB A;  1ZHJ A;  3OC9 A;  2JCK A;  1K4V A;  4M28 A;  4HO4 A;  1V84 A;  4Y7T A;  2YQC A;  5AJO A;  2VD4 A;  3IOJ A;  4M2A A;  1GWW A;  3OH1 A;  1ON8 A;  4R7P A;  4G3S A;  1VH3 A;  2XWN A;  4JIS A;  4EEM A;  1WT1 A;  1G8O A;  2YCM A;  4EE3 A;  1LZI A;  1ZDG A;  1ZIZ A;  1V83 A;  4B4B A;  1NWG B;  5C38 A;  3R2W A;  1WT0 A;  3U0Y A;  1FO9 A;  3SXB A;  1QWJ A;  1ZDF A;  2WE9 A;  5IFY A;  2D7I A;  3F1C A;  1WT3 A;  2P6W A;  3V0Q A;  4D11 A;  1OMX A;  3CU0 A;  4EEG A;  2A8W A;  1YRO B;  1O7O A;  3USQ A;  1JV1 A;  4EEA A;  2FYD B;  1VGZ A;  1O0R A;  1JYL A;  5C1G A;  1ZI3 A;  1IIM A;  1GA8 A;  4FRO A;  3TZT A;  1PZT A;  3OH2 A;  2XMH A;  2E3D A;  4XWI A;  4G3Q A;  3V91 A;  1V82 A;  1ZJP A;  3FWW A;  4KPZ A;  2P72 A;  5CMG X;  4HCQ A;  2VS4 A;  3RMW A;  4B2W A;  1ZJO A;  4KC2 A;  5C36 A;  4HO9 A;  1NQI B;  4HO6 A;  4AYL A;  2Y6P A;  1TW1 A;  3CGX A;  2YES A;  5C4E A;  5IDT A;  4HO2 A;  4MYB A;  1NF5 B;  4J18 A;  1R7Y A;  2RJ4 A;  3TQD A;  1H5S C;  2V0K A;  1R81 A;  4P02 A;  3BCV A;  4Y63 A;  1HJL A;  1H5R B;  2V0L A;  4IRQ A;  2GGQ A;  3D8V A;  3K8D A;  4EE5 A;  1G0R A;  3E26 A;  1GX4 A;  1TVY A;  4ZDQ A;  1O7Q A;  2ICX A;  4Y7V A;  4ARW A;  3U2U A;  3IOI A;  1FXJ A;  3I0D A;  1R80 A;  2RIT A;  1SS9 A;  5L6S A;  1XZ6 A;  4Y7U A;  4NAL A;  1S4P A;  1R7T A;  1S4O A;  2Y4L A;  2RIY A;  2YC5 A;  4FRB A;  3I0F A;  3JUK A;  4AYJ A;  5CMJ A;  4Y9X A;  2AM3 A;  3CKN A;  3I0C A;  2NXV A;  5DDT A;  5CQL X;  1LL2 A;  1G23 A;  1FOA A;  2FY7 A;  1H4C A;  2A8U A;  4FRQ A;  4KPX A;  1JYK A;  2RJ7 A;  1JVG A;  2JCJ A;  4FRH A;  2VSI A;  4KQL A;  3SX7 A;  3V0L A;  2FYC B;  2PGV A;  2Y4M A;  1QGS A;  4KC4 A;  2O1H A;  2VS3 A;  2X60 A;  2FYA A;  4DDZ A;  1OQM B;  1NMM B;  2ZU8 A;  2Z86 A;  2CU2 A;  3O3P A;  5CMI A;  4AAW A;  2WGZ A;  3T7M A;  1TZF A;  5CQM X;  1G1L A;  2WVM A;  1G97 A;  4C2S A;  2Y4K A;  1H7G A;  1W77 A;  1IIN A;  2DPW A;  3U2W A;  4FRA A;  3SXE A;  4D0T A;  2YQJ A;  3Q80 A;  5EIY A;  2OI7 A;  2AM5 A;  1H5T B;  2ICY A;  3ST8 A;  4M4K A;  3I0I X;  3RSB A;  4NAI A;  2PX7 A;  4ECM A;  3DUV A;  1H5R A;  3V0O A;  3Q7U A;  2O1G A;  5CQO A;  1H7F A;  3F1Y A;  4HG6 A;  2VSH A;  1ZI5 A;  4B4M A;  4FRM A;  5C1L A;  3GUE A;  3U2V A;  4B5B A;  5C4C A;  2YC3 A;  5EJZ A;  1H5S D;  2XWM A;  4KNR A;  4KT7 A;  3CKJ A;  1ZJ0 A;  3CKV A;  1R7U A;  1HM8 A;  1VZU A;  1H7T A;  1VGW A;  2UX8 A;  2APC A;  2PGY A;  5FU0 A;  1MP5 A;  4B3U A;  1S4N A;  4EEO A;  4KC1 A;  5C3B A;  2RIX A;  2BO8 A;  2W0W A;  4Y6U A;  1FGX A;  2OEG A;  5C48 A;  1FXO A;  1WT2 A;  2AM4 A;  2QH5 A;  3D98 A;  4CVH A;  2MZB A;  3ZLK A;  2RJ6 A;  5CMF X;  1FGG A;  4ASY A;  4HO5 A;  1MP3 A;  3T7N A;  3N9W A;  3DJ4 A;  1OMZ A;  1R7V A;  4D48 A;  1MP4 A;  4FRD A;  4UEG A;  1O23 B;  3ZF8 A;  1R82 A;  4FCU A;  2D0J A;  1ON6 A;  1H4D A;  4BMA A;  1ZCT A;  3IOH A;  4YS8 A;  5C47 A;  4M2B A;  3V8Z A;  2AH9 A;  3I0H A;  4FRE A;  4ASJ A;  1Z90 A;  1LZ0 A;  3PKP A;  1HM0 A;  3T7O A;  3K8E A;  4D11 C;  1FO8 A;  1LL0 A;  4IRP A;  3PKQ A;  3V0N A;  1GWV A;  1G95 A;  2X65 A;  4EE4 A;  4HOC A;  4KNX A;  4KXO A;  4KRV A;  4HO0 A;  1E5K A;  1H5T A;  5AJN A;  3Q4S A;  2VS5 A;  1YP4 A;  2ZU9 A;  1H5S B;  1VZX A;  2I5K A;  4MND A;  5AJP A;  4FRL A;  3I0E A;  1G3L A;  2V0I A;  1ZCV A;  3V0M A;  2OI6 A;  1VPA A;  1ZCY A;  1VGT A;  2Q4J A;  2QGI A;  5FU8 A;  1QGQ A;  2E8B A;  5CMH A;  5FTV A;  5C4B A;  2RJ9 A;  2FFU A;  4G87 A;  1YP3 A;  1WVC A;  1FWY A;  3FOQ A;  4FCE A;  4L41 C; 
#chains in the Genus database with same CATH topology
 2JCO A;  3I0L A;  1NKH B;  5C4F A;  2YQS A;  1EYR A;  2VFZ A;  2AES A;  4EVW A;  4P00 A;  4DE7 A;  3D5N A;  3CKQ A;  5C3A A;  4Y62 A;  1INI A;  5DDV A;  5FV9 A;  2WVK A;  4LW3 A;  2YQH A;  1H7Q A;  3SXD A;  3OH0 A;  4LW6 A;  2XWL A;  1R7X A;  4CJC A;  2J0A A;  1ZI1 A;  1W55 A;  3ZGF A;  5BXC A;  2VXL A;  3SPT A;  3JUJ A;  1VZT A;  4NAN A;  5J49 A;  1H7L A;  1FZW A;  3KIA A;  1ZJ1 A;  2W0V A;  4AC3 A;  1G93 A;  4Q7C A;  3RMV A;  3I0J A;  5IDS A;  2RIZ A;  3E25 A;  1W57 A;  2J0B A;  3V0P A;  4D0Z A;  1NHE B;  3SX5 A;  1HM9 A;  3BRK X;  2V0J A;  5D91 A;  5CQP A;  3EE5 A;  4Y7F A;  4E1K A;  1H5S A;  3SXC A;  4O6M A;  3U2X A;  4B42 A;  1KWS A;  2AGD A;  2D7R A;  1MC3 A;  5L6V A;  1LZJ A;  2PA4 A;  1HJJ A;  4K6R A;  4FRP A;  2P73 A;  2X5S A;  2Y4J A;  2QKX A;  5C1H A;  5HS2 A;  3U0X A;  1ZCU A;  5CQN X;  2BO7 A;  1I52 A;  2WVL A;  4NAK A;  3NGW A;  1HV9 A;  1GQ9 A;  2Z87 A;  1YP2 A;  3OKR A;  1JV3 A;  5I1F A;  4Y7G A;  1PZY B;  5C8R A;  2X5Z A;  1G9R A;  2AE7 A;  2O1F A;  3ZGG A;  2FFV A;  2OEF A;  4DEC A;  5JQQ A;  3R3I A;  3QVB A;  4CJ8 A;  2RJ0 A;  5EJ1 A;  4HO3 A;  1FR8 A;  3CKO A;  3POL A;  1WSZ A;  1TW5 A;  2WAW A;  3SX8 A;  3USR A;  1ZJ2 A;  1G2V A;  1H7E A;  1JVD A;  3OH4 A;  3U2T A;  2JCL A;  3OH3 A;  4Y6N A;  3V8Y A;  1FG5 N;  5C49 A;  3V90 A;  1INJ A;  2OI5 A;  3SXG A;  1VIC A;  1EZI A;  4B4G A;  3SXA A;  2ZU7 A;  1QG8 A;  1ZJ3 A;  4FIY A;  5FYE A;  2RJ1 A;  3I0K A;  3OGZ A;  2I5E A;  1FRW A;  2RJ8 A;  2BO6 A;  3JTJ A;  4G3P A;  4MIX A;  3LW6 A;  3SX3 A;  2AEC A;  2BO4 A;  2FYB A;  4HO8 A;  3HL3 A;  2VXM A;  1ZI4 A;  3I0G A;  1FR9 A;  1XHB A;  1GX0 A;  5C3D A;  1LL3 A;  2I7B A;  4Y64 A;  5FTS A;  5FUH A;  1H7H A;  2Y7A A;  5C4D A;  1H3M A;  4B2X A;  3ZLL A;  3DK5 A;  1VGU A;  1LVW A;  1H4E A;  3OAM A;  1VH1 A;  1VM8 A;  2RJ5 A;  2GGO A;  4BQH A;  1GQC A;  4GBP A;  2V0H A;  2WEE A;  2XME A;  4FQW A;  1LZ7 A;  3PNN A;  4JD0 A;  4CJB A;  1ZHJ A;  3OC9 A;  2JCK A;  1K4V A;  4M28 A;  4HO4 A;  1V84 A;  4Y7T A;  2YQC A;  5AJO A;  2VD4 A;  3IOJ A;  4M2A A;  1GWW A;  3OH1 A;  1ON8 A;  4R7P A;  4G3S A;  1VH3 A;  2XWN A;  4JIS A;  4EEM A;  1WT1 A;  1G8O A;  2YCM A;  4EE3 A;  1LZI A;  1ZDG A;  1ZIZ A;  1V83 A;  4B4B A;  1NWG B;  5C38 A;  3R2W A;  1WT0 A;  3U0Y A;  1FO9 A;  3SXB A;  1QWJ A;  4FIX A;  1ZDF A;  2C0N A;  2WE9 A;  2D7I A;  5IFY A;  3F1C A;  1WT3 A;  2P6W A;  3V0Q A;  4D11 A;  1OMX A;  3CU0 A;  4EEG A;  2A8W A;  1YRO B;  1O7O A;  3USQ A;  2VK9 A;  1JV1 A;  4EEA A;  2FYD B;  1VGZ A;  1O0R A;  1JYL A;  5C1G A;  1ZI3 A;  1IIM A;  1GA8 A;  4FRO A;  3TZT A;  1PZT A;  3OH2 A;  2XMH A;  2E3D A;  4XWI A;  4G3Q A;  3V91 A;  1V82 A;  1ZJP A;  4O6N A;  3FWW A;  4KPZ A;  2P72 A;  5CMG X;  4HCQ A;  2VS4 A;  3RMW A;  4B2W A;  1ZJO A;  4KC2 A;  5C36 A;  4HO9 A;  1NQI B;  4HO6 A;  4AYL A;  2Y6P A;  1TW1 A;  3CGX A;  2YES A;  5C4E A;  5IDT A;  4HO2 A;  4MYB A;  1NF5 B;  4J18 A;  1R7Y A;  2RJ4 A;  3TQD A;  1H5S C;  2V0K A;  1R81 A;  4P02 A;  3BCV A;  4Y63 A;  1HJL A;  1H5R B;  2V0L A;  4IRQ A;  2GGQ A;  3D8V A;  3K8D A;  4EE5 A;  1G0R A;  3E26 A;  1GX4 A;  1TVY A;  4ZDQ A;  1O7Q A;  2ICX A;  4Y7V A;  4ARW A;  3U2U A;  3IOI A;  1FXJ A;  3I0D A;  1R80 A;  2RIT A;  1SS9 A;  5L6S A;  1XZ6 A;  4Y7U A;  4NAL A;  1S4P A;  1R7T A;  1S4O A;  2Y4L A;  2RIY A;  2YC5 A;  4FRB A;  3I0F A;  3JUK A;  4AYJ A;  5CMJ A;  4Y9X A;  2AM3 A;  3CKN A;  3I0C A;  5D92 A;  2NXV A;  5DDT A;  5CQL X;  1LL2 A;  1G23 A;  1FOA A;  2FY7 A;  1H4C A;  2A8U A;  4FRQ A;  4KPX A;  1JYK A;  2RJ7 A;  1JVG A;  2JCJ A;  4FRH A;  2VSI A;  4KQL A;  3SX7 A;  3V0L A;  2FYC B;  2PGV A;  2Y4M A;  1QGS A;  4KC4 A;  2O1H A;  2VS3 A;  2X60 A;  2FYA A;  4DDZ A;  1OQM B;  1NMM B;  2ZU8 A;  2Z86 A;  2CU2 A;  3O3P A;  5CMI A;  4AAW A;  2WGZ A;  3T7M A;  1TZF A;  5CQM X;  1G1L A;  2WVM A;  1G97 A;  4C2S A;  2Y4K A;  1H7G A;  1W77 A;  1IIN A;  2DPW A;  3U2W A;  4FRA A;  3SXE A;  4D0T A;  2YQJ A;  3Q80 A;  5EIY A;  2OI7 A;  2AM5 A;  1H5T B;  2ICY A;  3ST8 A;  4M4K A;  3I0I X;  3RSB A;  4NAI A;  2PX7 A;  4ECM A;  3DUV A;  1H5R A;  3V0O A;  3Q7U A;  2O1G A;  5CQO A;  1H7F A;  3F1Y A;  4HG6 A;  2VSH A;  1ZI5 A;  4B4M A;  4FRM A;  5C1L A;  3GUE A;  3U2V A;  4B5B A;  5C4C A;  2YC3 A;  5EJZ A;  1H5S D;  2XWM A;  4KNR A;  4KT7 A;  3CKJ A;  1ZJ0 A;  3CKV A;  1R7U A;  1HM8 A;  1VZU A;  1H7T A;  1VGW A;  2UX8 A;  2APC A;  2PGY A;  5FU0 A;  1MP5 A;  4B3U A;  1S4N A;  4EEO A;  4KC1 A;  5C3B A;  2RIX A;  2BO8 A;  2W0W A;  4Y6U A;  1FGX A;  2OEG A;  5C48 A;  1FXO A;  1WT2 A;  2AM4 A;  2QH5 A;  3D98 A;  4CVH A;  2MZB A;  3ZLK A;  2RJ6 A;  5CMF X;  1FGG A;  4ASY A;  4HO5 A;  1MP3 A;  3T7N A;  3N9W A;  3DJ4 A;  1OMZ A;  1R7V A;  4D48 A;  1MP4 A;  4FRD A;  4UEG A;  1O23 B;  3ZF8 A;  1R82 A;  4FCU A;  2D0J A;  1ON6 A;  1H4D A;  4BMA A;  1ZCT A;  3IOH A;  4YS8 A;  5C47 A;  4M2B A;  3V8Z A;  2AH9 A;  3I0H A;  4FRE A;  4ASJ A;  1Z90 A;  1LZ0 A;  3PKP A;  1HM0 A;  3T7O A;  3K8E A;  4D11 C;  1FO8 A;  1LL0 A;  4IRP A;  3PKQ A;  3V0N A;  1GWV A;  1G95 A;  2X65 A;  4EE4 A;  4HOC A;  4KNX A;  4KXO A;  4KRV A;  4HO0 A;  1E5K A;  1H5T A;  5AJN A;  3Q4S A;  2VS5 A;  1YP4 A;  2ZU9 A;  1H5S B;  1VZX A;  2I5K A;  4MND A;  5AJP A;  4FRL A;  3I0E A;  1G3L A;  2V0I A;  1ZCV A;  3V0M A;  2OI6 A;  1VPA A;  1ZCY A;  1VGT A;  2Q4J A;  2QGI A;  5FU8 A;  1QGQ A;  2E8B A;  5CMH A;  5FTV A;  5C4B A;  2RJ9 A;  2FFU A;  4G87 A;  1YP3 A;  1WVC A;  1FWY A;  3FOQ A;  4FCE A;  4L41 C; 
#chains in the Genus database with same CATH homology
 2JCO A;  3I0L A;  1NKH B;  5C4F A;  2YQS A;  1EYR A;  2VFZ A;  2AES A;  4EVW A;  4P00 A;  4DE7 A;  3D5N A;  3CKQ A;  5C3A A;  4Y62 A;  1INI A;  5DDV A;  5FV9 A;  2WVK A;  4LW3 A;  2YQH A;  1H7Q A;  3SXD A;  3OH0 A;  4LW6 A;  2XWL A;  1R7X A;  4CJC A;  2J0A A;  1ZI1 A;  1W55 A;  3ZGF A;  5BXC A;  2VXL A;  3SPT A;  3JUJ A;  1VZT A;  4NAN A;  5J49 A;  1H7L A;  1FZW A;  3KIA A;  1ZJ1 A;  2W0V A;  4AC3 A;  1G93 A;  4Q7C A;  3RMV A;  3I0J A;  5IDS A;  2RIZ A;  3E25 A;  1W57 A;  2J0B A;  3V0P A;  4D0Z A;  1NHE B;  3SX5 A;  1HM9 A;  3BRK X;  2V0J A;  5D91 A;  5CQP A;  3EE5 A;  4Y7F A;  4E1K A;  1H5S A;  3SXC A;  4O6M A;  3U2X A;  4B42 A;  1KWS A;  2AGD A;  2D7R A;  1MC3 A;  5L6V A;  1LZJ A;  2PA4 A;  1HJJ A;  4K6R A;  4FRP A;  2P73 A;  2X5S A;  2Y4J A;  2QKX A;  5C1H A;  5HS2 A;  3U0X A;  1ZCU A;  5CQN X;  2BO7 A;  1I52 A;  2WVL A;  4NAK A;  3NGW A;  1HV9 A;  1GQ9 A;  2Z87 A;  1YP2 A;  3OKR A;  1JV3 A;  5I1F A;  4Y7G A;  1PZY B;  5C8R A;  2X5Z A;  1G9R A;  2AE7 A;  2O1F A;  3ZGG A;  2FFV A;  2OEF A;  4DEC A;  5JQQ A;  3R3I A;  3QVB A;  4CJ8 A;  2RJ0 A;  5EJ1 A;  4HO3 A;  1FR8 A;  3CKO A;  3POL A;  1WSZ A;  1TW5 A;  2WAW A;  3SX8 A;  3USR A;  1ZJ2 A;  1G2V A;  1H7E A;  1JVD A;  3OH4 A;  3U2T A;  2JCL A;  3OH3 A;  4Y6N A;  3V8Y A;  1FG5 N;  5C49 A;  3V90 A;  1INJ A;  2OI5 A;  3SXG A;  1VIC A;  1EZI A;  4B4G A;  3SXA A;  2ZU7 A;  1QG8 A;  1ZJ3 A;  4FIY A;  5FYE A;  2RJ1 A;  3I0K A;  3OGZ A;  2I5E A;  1FRW A;  2RJ8 A;  2BO6 A;  3JTJ A;  4G3P A;  4MIX A;  3LW6 A;  3SX3 A;  2AEC A;  2BO4 A;  2FYB A;  4HO8 A;  3HL3 A;  2VXM A;  1ZI4 A;  3I0G A;  1FR9 A;  1XHB A;  1GX0 A;  5C3D A;  1LL3 A;  2I7B A;  4Y64 A;  5FTS A;  5FUH A;  1H7H A;  2Y7A A;  5C4D A;  1H3M A;  4B2X A;  3ZLL A;  3DK5 A;  1VGU A;  1LVW A;  1H4E A;  3OAM A;  1VH1 A;  1VM8 A;  2RJ5 A;  2GGO A;  4BQH A;  1GQC A;  4GBP A;  2V0H A;  2WEE A;  2XME A;  4FQW A;  1LZ7 A;  3PNN A;  4JD0 A;  4CJB A;  1ZHJ A;  3OC9 A;  2JCK A;  1K4V A;  4M28 A;  4HO4 A;  1V84 A;  4Y7T A;  2YQC A;  5AJO A;  2VD4 A;  3IOJ A;  4M2A A;  1GWW A;  3OH1 A;  1ON8 A;  4R7P A;  4G3S A;  1VH3 A;  2XWN A;  4JIS A;  4EEM A;  1WT1 A;  1G8O A;  2YCM A;  4EE3 A;  1LZI A;  1ZDG A;  1ZIZ A;  1V83 A;  4B4B A;  1NWG B;  5C38 A;  3R2W A;  1WT0 A;  3U0Y A;  1FO9 A;  3SXB A;  1QWJ A;  4FIX A;  1ZDF A;  2C0N A;  2WE9 A;  2D7I A;  5IFY A;  3F1C A;  1WT3 A;  2P6W A;  3V0Q A;  4D11 A;  1OMX A;  3CU0 A;  4EEG A;  2A8W A;  1YRO B;  1O7O A;  3USQ A;  2VK9 A;  1JV1 A;  4EEA A;  2FYD B;  1VGZ A;  1O0R A;  1JYL A;  5C1G A;  1ZI3 A;  1IIM A;  1GA8 A;  4FRO A;  3TZT A;  1PZT A;  3OH2 A;  2XMH A;  2E3D A;  4XWI A;  4G3Q A;  3V91 A;  1V82 A;  1ZJP A;  4O6N A;  3FWW A;  4KPZ A;  2P72 A;  5CMG X;  4HCQ A;  2VS4 A;  3RMW A;  4B2W A;  1ZJO A;  4KC2 A;  5C36 A;  4HO9 A;  1NQI B;  4HO6 A;  4AYL A;  2Y6P A;  1TW1 A;  3CGX A;  2YES A;  5C4E A;  5IDT A;  4HO2 A;  4MYB A;  1NF5 B;  4J18 A;  1R7Y A;  2RJ4 A;  3TQD A;  1H5S C;  2V0K A;  1R81 A;  4P02 A;  3BCV A;  4Y63 A;  1HJL A;  1H5R B;  2V0L A;  4IRQ A;  2GGQ A;  3D8V A;  3K8D A;  4EE5 A;  1G0R A;  3E26 A;  1GX4 A;  1TVY A;  4ZDQ A;  1O7Q A;  2ICX A;  4Y7V A;  4ARW A;  3U2U A;  3IOI A;  1FXJ A;  3I0D A;  1R80 A;  2RIT A;  1SS9 A;  5L6S A;  1XZ6 A;  4Y7U A;  4NAL A;  1S4P A;  1R7T A;  1S4O A;  2Y4L A;  2RIY A;  2YC5 A;  4FRB A;  3I0F A;  3JUK A;  4AYJ A;  5CMJ A;  4Y9X A;  2AM3 A;  3CKN A;  3I0C A;  5D92 A;  2NXV A;  5DDT A;  5CQL X;  1LL2 A;  1G23 A;  1FOA A;  2FY7 A;  1H4C A;  2A8U A;  4FRQ A;  4KPX A;  1JYK A;  2RJ7 A;  1JVG A;  2JCJ A;  4FRH A;  2VSI A;  4KQL A;  3SX7 A;  3V0L A;  2FYC B;  2PGV A;  2Y4M A;  1QGS A;  4KC4 A;  2O1H A;  2VS3 A;  2X60 A;  2FYA A;  4DDZ A;  1OQM B;  1NMM B;  2ZU8 A;  2Z86 A;  2CU2 A;  3O3P A;  5CMI A;  4AAW A;  2WGZ A;  3T7M A;  1TZF A;  5CQM X;  1G1L A;  2WVM A;  1G97 A;  4C2S A;  2Y4K A;  1H7G A;  1W77 A;  1IIN A;  2DPW A;  3U2W A;  4FRA A;  3SXE A;  4D0T A;  2YQJ A;  3Q80 A;  5EIY A;  2OI7 A;  2AM5 A;  1H5T B;  2ICY A;  3ST8 A;  4M4K A;  3I0I X;  3RSB A;  4NAI A;  2PX7 A;  4ECM A;  3DUV A;  1H5R A;  3V0O A;  3Q7U A;  2O1G A;  5CQO A;  1H7F A;  3F1Y A;  4HG6 A;  2VSH A;  1ZI5 A;  4B4M A;  4FRM A;  5C1L A;  3GUE A;  3U2V A;  4B5B A;  5C4C A;  2YC3 A;  5EJZ A;  1H5S D;  2XWM A;  4KNR A;  4KT7 A;  3CKJ A;  1ZJ0 A;  3CKV A;  1R7U A;  1HM8 A;  1VZU A;  1H7T A;  1VGW A;  2UX8 A;  2APC A;  2PGY A;  5FU0 A;  1MP5 A;  4B3U A;  1S4N A;  4EEO A;  4KC1 A;  5C3B A;  2RIX A;  2BO8 A;  2W0W A;  4Y6U A;  1FGX A;  2OEG A;  5C48 A;  1FXO A;  1WT2 A;  2AM4 A;  2QH5 A;  3D98 A;  4CVH A;  2MZB A;  3ZLK A;  2RJ6 A;  5CMF X;  1FGG A;  4ASY A;  4HO5 A;  1MP3 A;  3T7N A;  3N9W A;  3DJ4 A;  1OMZ A;  1R7V A;  4D48 A;  1MP4 A;  4FRD A;  4UEG A;  1O23 B;  3ZF8 A;  1R82 A;  4FCU A;  2D0J A;  1ON6 A;  1H4D A;  4BMA A;  1ZCT A;  3IOH A;  4YS8 A;  5C47 A;  4M2B A;  3V8Z A;  2AH9 A;  3I0H A;  4FRE A;  4ASJ A;  1Z90 A;  1LZ0 A;  3PKP A;  1HM0 A;  3T7O A;  3K8E A;  4D11 C;  1FO8 A;  1LL0 A;  4IRP A;  3PKQ A;  3V0N A;  1GWV A;  1G95 A;  2X65 A;  4EE4 A;  4HOC A;  4KNX A;  4KXO A;  4KRV A;  4HO0 A;  1E5K A;  1H5T A;  5AJN A;  3Q4S A;  2VS5 A;  1YP4 A;  2ZU9 A;  1H5S B;  1VZX A;  2I5K A;  4MND A;  5AJP A;  4FRL A;  3I0E A;  1G3L A;  2V0I A;  1ZCV A;  3V0M A;  2OI6 A;  1VPA A;  1ZCY A;  1VGT A;  2Q4J A;  2QGI A;  5FU8 A;  1QGQ A;  2E8B A;  5CMH A;  5FTV A;  5C4B A;  2RJ9 A;  2FFU A;  4G87 A;  1YP3 A;  1WVC A;  1FWY A;  3FOQ A;  4FCE A;  4L41 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...