3RMVA

Crystal structure of human glycogenin-1 (gyg1) t83m mutant complexed with manganese and udp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
249
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVMLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSILPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 249
sequence length 263
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3rmvA00
1HJJA 1PZYB 3DJ4A 1H5SC 1EZIA 2ICYA 3TZTA 1TZFA 4FRPA 4FREA 1IIMA 1V83A 5C36A 5C1LA 1INIA 2YESA 3SXEA 3OH2A 3ZLLA 1VZTA 1ON8A 1VM8A 3EE5A 2I5EA 3TQDA 5IDSA 5C3DA 4R7PA 4CJBA 4D11C 1G9RA 3Q7UA 4Y9XA 2V0HA 3CKVA 3OGZA 3SX5A 1FXJA 1VZUA 4FCEA 1GWVA 1KWSA 5EJ1A 4NANA 2WVMA 3CGXA 4HG6A 4EEGA 1GX4A 2GGQA 4D0TA 1H5TB 1LL3A 2RITA 4ASJA 2VD4A 3K8DA 1ZCUA 4EE5A 1MP5A 1H5SB 1G3LA 1FGGA 1QGQA 4Y7FA 3DUVA 3POLA 3BRKX 1GX0A 1FZWA 1FGXA 2AM3A 1K4VA 4LW3A 4NAIA 2OEGA 2V0JA 1WVCA 2OI6A 3SXCA 1FO8A 3T7MA 2BO8A 3V0OA 4B42A 4JD0A 2AGDA 2O1HA 4FRDA 3I0IX 3IOJA 3T7NA 2FYAA 2D0JA 5C4BA 4G3QA 4M2BA 2XWMA 2DPWA 4Y7UA 3U2XA 3IOHA 1R80A 2VS3A 3CKNA 1W57A 1INJA 4FRLA 1WT1A 3JUJA 2PX7A 1JV3A 1O7QA 3QVBA 3R3IA 1G95A 4EVWA 1FG5N 1V82A 2XWLA 4HO9A 4MNDA 1NHEB 3F1CA 4M28A 1ON6A 1W55A 3V8ZA 1VGWA 1VPAA 2XMEA 1Z90A 2O1GA 4HO6A 3ZF8A 1VZXA 2AH9A 5J49A 1H5TA 1ZJ3A 5FTSA 2BO6A 2I7BA 1VGTA 4L41C 2X5ZA 1FR8A 4B4MA 3HL3A 1JYKA 1H5SA 1SS9A 3D5NA 2X5SA 3O3PA 2VXLA 1OQMB 2NXVA 1LZ7A 3OH0A 4E1KA 4FROA 1ZJOA 2Y7AA 5CMHA 1QWJA 2YC3A 4HO0A 5FV9A 1H7HA 2RJ0A 2XWNA 2FYCB 4D11A 1H4CA 3N9WA 1H4DA 1NKHB 2V0IA 2WGZA 1R7YA 5C4FA 2VS4A 1OMZA 1HM9A 2VS5A 3I0CA 2FYBA 3I0JA 4CJ8A 1V84A 5IFYA 4Y7TA 3V0PA 5L6VA 2FFVA 1S4NA 2BO4A 4FRBA 4BQHA 2AE7A 2OI5A 4GBPA 4HOCA 2OEFA 1GQCA 3USRA 1XHBA 4B2WA 3OH4A 1W77A 1R81A 3I0KA 2A8UA 1QG8A 1PZTA 1YP4A 4HO8A 3OKRA 5CQPA 3CKJA 1HJLA 3T7OA 5C1HA 2WE9A 2YQHA 4G3PA 3ZGFA 5C4DA 1ZDGA 1YP3A 4B2XA 1R7VA 5C1GA 4EE3A 4BMAA 4KC4A 4HO5A 4D48A 5CQLX 3V90A 1OMXA 3USQA 3OC9A 1G93A 5IDTA 4FRQA 1JV1A 3Q80A 4FRHA 3I0DA 1H7FA 4HO4A 2QKXA 4NALA 3KIAA 3CU0A 4KT7A 2Y4KA 4DDZA 2VSIA 1LZIA 3D98A 2PGYA 4FRAA 4KQLA 4C2SA 2RIZA 1R7TA 3NGWA 5BXCA 2E3DA 3IOIA 5AJPA 4Y6UA 1H4EA 2RJ7A 4IRQA 3Q4SA 1G0RA 1H7QA 4DECA 1S4OA 1WSZA 3BCVA 3RSBA 3V0QA 3FOQA 2Z86A 1H5RB 3V0NA 4EE4A 2RJ1A 2RJ5A 1GQ9A 3V8YA 3I0EA 4YS8A 4Y7GA 2YCMA 1JVDA 5C47A 1GA8A 5CMFX 4FCUA 4MYBA 1H7TA 1ZJ2A 1H7EA 1JVGA 5CMJA 2JCJA 2V0KA 4B4BA 3SX8A 2D7IA 4CJCA 4EEOA 3SX7A 2Y6PA 4JISA 1HM0A 2WVKA 2QH5A 2P6WA 1NQIB 1NF5B 4J18A 3JUKA 1WT2A 4Y6NA 5DDVA 5C48A 2YC5A 3I0FA 5JQQA 5C49A 2RIYA 2W0VA 2JCLA 4AC3A 1TW1A 4IRPA 1MP3A 1ZJPA 1R82A 5C3AA 2RJ4A 1ZI5A 4CVHA 2MZBA 1O7OA 2Y4LA 1O0RA 4LW6A 5C8RA 1VH1A 2Y4MA 2PGVA 4KC2A 4KC1A 3RMVA 3V91A 1GWWA 3U0YA 3FWWA 1H5RA 1HM8A 5C4EA 1VICA 3RMWA 1G23A 2X65A 3OH3A 2AM4A 2FYDB 2QGIA 3D8VA 1VGZA 1TVYA 1XZ6A 4KPZA 1FO9A 1FR9A 5C3BA 1ZI3A 1YP2A 3ST8A 2XMHA 4ARWA 2X60A 2ZU8A 1LVWA 2UX8A 1ZDFA 1WT3A 4AAWA 5CQMX 4KRVA 4EEAA 4P02A 4M4KA 1HV9A 3V0MA 5CQOA 4G87A 1ZJ1A 3I0LA 1LZ0A 1H7GA 1ZCTA 5C38A 3DK5A 3V0LA 4B5BA 5EJZA 1G97A 1R7XA 4KNXA 4Y63A 2WEEA 1YROB 5L6SA 4B3UA 4HCQA 4B4GA 3K8EA 2CU2A 4HO3A 5C4CA 1ZI4A 2AM5A 4KNRA 3SXBA 1EYRA 3PKQA 3U2TA 5AJOA 3GUEA 5FUHA 1MC3A 2RJ8A 5EIYA 1ZCVA 1O23B 2I5KA 2ZU9A 2P72A 2VXMA 3PKPA 2A8WA 4P00A 2BO7A 5AJNA 1VH3A 1ZIZA 4Y64A 3SPTA 5FTVA 1IINA 3E26A 1LZJA 4FQWA 4KPXA 1G1LA 3F1YA 1G8OA 2VSHA 1S4PA 1ZI1A 2AECA 1NMMB 4ECMA 1TW5A 5CQNX 5FYEA 2Y4JA 2Q4JA 1LL0A 5DDTA 2YQSA 3I0GA 3JTJA 4KXOA 1G2VA 1R7UA 1FWYA 1MP4A 1LL2A 5FU8A 3CKQA 3E25A 3SXGA 1H3MA 2AESA 2O1FA 1E5KA 4ASYA 1ZJ0A 2APCA 2FFUA 3SXAA 2RIXA 4G3SA 3U0XA 4Y62A 2E8BA 4D0ZA 3U2WA 1JYLA 1H5SD 2P73A 4AYLA 3OH1A 5FU0A 3I0HA 4UEGA 1FOAA 2OI7A 4HO2A 2ZU7A 2VFZA 3SXDA 2YQCA 2RJ9A 3R2WA 2WAWA 5I1FA 1ZCYA 5CMGX 4M2AA 2PA4A 3U2UA 3CKOA 3LW6A 2GGOA 3ZLKA 4ZDQA 4AYJA 1WT0A 2D7RA 2WVLA 3U2VA 2W0WA 2JCKA 2FY7A 5CMIA 4XWIA 1H7LA 2YQJA 2Z87A 4NAKA 3ZGGA 4Y7VA 2RJ6A 1FXOA 1QGSA 2ICXA 1I52A 1VGUA 1ZHJA 4EEMA 1FRWA 1NWGB 3OAMA 4DE7A 3SX3A 4K6RA 5HS2A 2JCOA 2V0LA 3PNNA 4FRMA
chains in the Genus database with same CATH superfamily
1HJJA 1PZYB 3DJ4A 1H5SC 1EZIA 2ICYA 3TZTA 1TZFA 4FRPA 4FREA 1IIMA 1V83A 5C36A 5C1LA 1INIA 2YESA 3SXEA 3OH2A 3ZLLA 1VZTA 2J0AA 1ON8A 1VM8A 3EE5A 2I5EA 3TQDA 5IDSA 5C3DA 4R7PA 4CJBA 4D11C 1G9RA 3Q7UA 4Y9XA 2V0HA 3CKVA 3OGZA 3SX5A 1FXJA 1VZUA 4FCEA 1GWVA 1KWSA 5EJ1A 4NANA 2WVMA 3CGXA 4HG6A 4EEGA 1GX4A 2GGQA 4O6NA 4D0TA 1H5TB 1LL3A 2RITA 4ASJA 2VD4A 3K8DA 1ZCUA 4EE5A 1MP5A 1H5SB 1G3LA 1FGGA 1QGQA 4Y7FA 3DUVA 3POLA 3BRKX 1GX0A 1FZWA 1FGXA 2AM3A 1K4VA 4LW3A 4NAIA 4MIXA 2OEGA 2V0JA 1WVCA 2OI6A 3SXCA 1FO8A 3T7MA 2BO8A 3V0OA 4B42A 4JD0A 2AGDA 2O1HA 4FRDA 3I0IX 3IOJA 3T7NA 2FYAA 2D0JA 5C4BA 4G3QA 4M2BA 2XWMA 2DPWA 4Y7UA 3U2XA 3IOHA 1R80A 2VS3A 3CKNA 1W57A 1INJA 4FRLA 1WT1A 3JUJA 2PX7A 1JV3A 1O7QA 3QVBA 3R3IA 1G95A 4EVWA 1FG5N 1V82A 2XWLA 4HO9A 4MNDA 1NHEB 3F1CA 4M28A 1ON6A 1W55A 3V8ZA 1VGWA 1VPAA 2XMEA 1Z90A 2O1GA 4HO6A 3ZF8A 1VZXA 2AH9A 5J49A 1H5TA 1ZJ3A 5FTSA 2BO6A 2I7BA 1VGTA 4L41C 2X5ZA 1FR8A 4B4MA 3HL3A 1JYKA 4O6MA 1H5SA 1SS9A 3D5NA 2X5SA 3O3PA 2VXLA 1OQMB 2NXVA 1LZ7A 3OH0A 4E1KA 4FROA 1ZJOA 2Y7AA 5CMHA 1QWJA 2YC3A 4HO0A 5FV9A 1H7HA 2RJ0A 2XWNA 2FYCB 4D11A 2C0NA 1H4CA 3N9WA 1H4DA 1NKHB 2V0IA 2WGZA 1R7YA 5C4FA 2VS4A 1OMZA 1HM9A 2VS5A 3I0CA 2FYBA 3I0JA 4CJ8A 1V84A 5IFYA 4Y7TA 3V0PA 5L6VA 2FFVA 1S4NA 2BO4A 4FRBA 4BQHA 2AE7A 2OI5A 4GBPA 4HOCA 2OEFA 1GQCA 3USRA 1XHBA 4B2WA 3OH4A 1W77A 1R81A 3I0KA 2A8UA 1QG8A 1PZTA 1YP4A 4HO8A 3OKRA 5CQPA 3CKJA 1HJLA 3T7OA 5C1HA 2WE9A 2YQHA 4G3PA 3ZGFA 5C4DA 1ZDGA 1YP3A 4B2XA 1R7VA 5C1GA 4EE3A 4BMAA 4KC4A 4HO5A 4D48A 5CQLX 3V90A 1OMXA 3USQA 3OC9A 1G93A 5IDTA 4FRQA 1JV1A 3Q80A 4FRHA 3I0DA 1H7FA 4HO4A 2QKXA 4NALA 3KIAA 3CU0A 4KT7A 2Y4KA 4DDZA 2VSIA 1LZIA 3D98A 2PGYA 4FRAA 4KQLA 4C2SA 2RIZA 1R7TA 3NGWA 5BXCA 2E3DA 3IOIA 5AJPA 4Q7CA 4Y6UA 1H4EA 2RJ7A 4IRQA 3Q4SA 1G0RA 1H7QA 4DECA 1S4OA 1WSZA 3BCVA 3RSBA 3V0QA 3FOQA 2Z86A 1H5RB 3V0NA 4EE4A 2RJ1A 2RJ5A 1GQ9A 3V8YA 3I0EA 4YS8A 4Y7GA 4FIXA 2YCMA 1JVDA 5C47A 1GA8A 5CMFX 4FCUA 4MYBA 1H7TA 1ZJ2A 1H7EA 1JVGA 5CMJA 2J0BA 2JCJA 2V0KA 4B4BA 3SX8A 2D7IA 4CJCA 4EEOA 3SX7A 2Y6PA 4JISA 1HM0A 2WVKA 2QH5A 2P6WA 1NQIB 1NF5B 4J18A 3JUKA 1WT2A 4Y6NA 5DDVA 5C48A 2YC5A 3I0FA 5JQQA 5C49A 2RIYA 2W0VA 2JCLA 4AC3A 1TW1A 4IRPA 1MP3A 1ZJPA 1R82A 5C3AA 2RJ4A 1ZI5A 4CVHA 2MZBA 1O7OA 2Y4LA 1O0RA 4LW6A 5C8RA 5D92A 1VH1A 2Y4MA 2PGVA 4KC2A 4KC1A 3RMVA 3V91A 1GWWA 3U0YA 3FWWA 1H5RA 1HM8A 5C4EA 1VICA 3RMWA 1G23A 2X65A 3OH3A 2AM4A 2FYDB 2QGIA 3D8VA 1VGZA 1TVYA 1XZ6A 4KPZA 1FO9A 1FR9A 5C3BA 1ZI3A 1YP2A 3ST8A 2XMHA 4ARWA 2X60A 2ZU8A 1LVWA 2UX8A 1ZDFA 1WT3A 4AAWA 5CQMX 4KRVA 4EEAA 4P02A 4M4KA 1HV9A 3V0MA 5CQOA 4G87A 1ZJ1A 3I0LA 1LZ0A 1H7GA 1ZCTA 5C38A 2VK9A 3DK5A 3V0LA 4B5BA 5EJZA 1G97A 1R7XA 4KNXA 4Y63A 2WEEA 1YROB 5L6SA 4B3UA 4HCQA 4B4GA 3K8EA 2CU2A 4HO3A 5C4CA 1ZI4A 2AM5A 4KNRA 3SXBA 1EYRA 3PKQA 3U2TA 5AJOA 3GUEA 5FUHA 1MC3A 2RJ8A 5EIYA 1ZCVA 1O23B 2I5KA 2ZU9A 2P72A 2VXMA 3PKPA 2A8WA 4P00A 2BO7A 5AJNA 1VH3A 1ZIZA 4Y64A 3SPTA 5FTVA 1IINA 3E26A 1LZJA 4FQWA 4KPXA 1G1LA 3F1YA 1G8OA 2VSHA 1S4PA 1ZI1A 2AECA 1NMMB 4ECMA 1TW5A 5CQNX 5FYEA 2Y4JA 2Q4JA 1LL0A 5DDTA 2YQSA 3I0GA 3JTJA 4KXOA 1G2VA 1R7UA 1FWYA 1MP4A 1LL2A 5FU8A 3CKQA 3E25A 3SXGA 1H3MA 2AESA 2O1FA 1E5KA 4ASYA 1ZJ0A 2APCA 2FFUA 3SXAA 5D91A 2RIXA 4G3SA 3U0XA 4Y62A 2E8BA 4D0ZA 3U2WA 1JYLA 1H5SD 2P73A 4AYLA 3OH1A 5FU0A 3I0HA 4UEGA 1FOAA 2OI7A 4HO2A 2ZU7A 2VFZA 3SXDA 2YQCA 2RJ9A 3R2WA 2WAWA 5I1FA 1ZCYA 4FIYA 5CMGX 4M2AA 2PA4A 3U2UA 3CKOA 3LW6A 2GGOA 3ZLKA 4ZDQA 4AYJA 1WT0A 2D7RA 2WVLA 3U2VA 2W0WA 2JCKA 2FY7A 5CMIA 4XWIA 1H7LA 2YQJA 2Z87A 4NAKA 3ZGGA 4Y7VA 2RJ6A 1FXOA 1QGSA 2ICXA 1I52A 1VGUA 1ZHJA 4EEMA 1FRWA 1NWGB 3OAMA 4DE7A 3SX3A 4K6RA 5HS2A 2JCOA 2V0LA 3PNNA 4FRMA
chains in the Genus database with same CATH topology
1HJJA 1PZYB 3DJ4A 1H5SC 1EZIA 2ICYA 3TZTA 1TZFA 4FRPA 4FREA 1IIMA 1V83A 5C36A 5C1LA 1INIA 2YESA 3SXEA 3OH2A 3ZLLA 1VZTA 2J0AA 1ON8A 1VM8A 3EE5A 2I5EA 3TQDA 5IDSA 5C3DA 4R7PA 4CJBA 4D11C 1G9RA 3Q7UA 4Y9XA 2V0HA 3CKVA 3OGZA 3SX5A 1FXJA 1VZUA 4FCEA 1GWVA 1KWSA 5EJ1A 4NANA 2WVMA 3CGXA 4HG6A 4EEGA 1GX4A 2GGQA 4O6NA 4D0TA 1H5TB 1LL3A 2RITA 4ASJA 2VD4A 3K8DA 1ZCUA 4EE5A 1MP5A 1H5SB 1G3LA 1FGGA 1QGQA 4Y7FA 3DUVA 3POLA 3BRKX 1GX0A 1FZWA 1FGXA 2AM3A 1K4VA 4LW3A 4NAIA 4MIXA 2OEGA 2V0JA 1WVCA 2OI6A 3SXCA 1FO8A 3T7MA 2BO8A 3V0OA 4B42A 4JD0A 2AGDA 2O1HA 4FRDA 3I0IX 3IOJA 3T7NA 2FYAA 2D0JA 5C4BA 4G3QA 4M2BA 2XWMA 2DPWA 4Y7UA 3U2XA 3IOHA 1R80A 2VS3A 3CKNA 1W57A 1INJA 4FRLA 1WT1A 3JUJA 2PX7A 1JV3A 1O7QA 3QVBA 3R3IA 1G95A 4EVWA 1FG5N 1V82A 2XWLA 4HO9A 4MNDA 1NHEB 3F1CA 4M28A 1ON6A 1W55A 3V8ZA 1VGWA 1VPAA 2XMEA 1Z90A 2O1GA 4HO6A 3ZF8A 1VZXA 2AH9A 5J49A 1H5TA 1ZJ3A 5FTSA 2BO6A 2I7BA 1VGTA 4L41C 2X5ZA 1FR8A 4B4MA 3HL3A 1JYKA 4O6MA 1H5SA 1SS9A 3D5NA 2X5SA 3O3PA 2VXLA 1OQMB 2NXVA 1LZ7A 3OH0A 4E1KA 4FROA 1ZJOA 2Y7AA 5CMHA 1QWJA 2YC3A 4HO0A 5FV9A 1H7HA 2RJ0A 2XWNA 2FYCB 4D11A 2C0NA 1H4CA 3N9WA 1H4DA 1NKHB 2V0IA 2WGZA 1R7YA 5C4FA 2VS4A 1OMZA 1HM9A 2VS5A 3I0CA 2FYBA 3I0JA 4CJ8A 1V84A 5IFYA 4Y7TA 3V0PA 5L6VA 2FFVA 1S4NA 2BO4A 4FRBA 4BQHA 2AE7A 2OI5A 4GBPA 4HOCA 2OEFA 1GQCA 3USRA 1XHBA 4B2WA 3OH4A 1W77A 1R81A 3I0KA 2A8UA 1QG8A 1PZTA 1YP4A 4HO8A 3OKRA 5CQPA 3CKJA 1HJLA 3T7OA 5C1HA 2WE9A 2YQHA 4G3PA 3ZGFA 5C4DA 1ZDGA 1YP3A 4B2XA 1R7VA 5C1GA 4EE3A 4BMAA 4KC4A 4HO5A 4D48A 5CQLX 3V90A 1OMXA 3USQA 3OC9A 1G93A 5IDTA 4FRQA 1JV1A 3Q80A 4FRHA 3I0DA 1H7FA 4HO4A 2QKXA 4NALA 3KIAA 3CU0A 4KT7A 2Y4KA 4DDZA 2VSIA 1LZIA 3D98A 2PGYA 4FRAA 4KQLA 4C2SA 2RIZA 1R7TA 3NGWA 5BXCA 2E3DA 3IOIA 5AJPA 4Q7CA 4Y6UA 1H4EA 2RJ7A 4IRQA 3Q4SA 1G0RA 1H7QA 4DECA 1S4OA 1WSZA 3BCVA 3RSBA 3V0QA 3FOQA 2Z86A 1H5RB 3V0NA 4EE4A 2RJ1A 2RJ5A 1GQ9A 3V8YA 3I0EA 4YS8A 4Y7GA 4FIXA 2YCMA 1JVDA 5C47A 1GA8A 5CMFX 4FCUA 4MYBA 1H7TA 1ZJ2A 1H7EA 1JVGA 5CMJA 2J0BA 2JCJA 2V0KA 4B4BA 3SX8A 2D7IA 4CJCA 4EEOA 3SX7A 2Y6PA 4JISA 1HM0A 2WVKA 2QH5A 2P6WA 1NQIB 1NF5B 4J18A 3JUKA 1WT2A 4Y6NA 5DDVA 5C48A 2YC5A 3I0FA 5JQQA 5C49A 2RIYA 2W0VA 2JCLA 4AC3A 1TW1A 4IRPA 1MP3A 1ZJPA 1R82A 5C3AA 2RJ4A 1ZI5A 4CVHA 2MZBA 1O7OA 2Y4LA 1O0RA 4LW6A 5C8RA 5D92A 1VH1A 2Y4MA 2PGVA 4KC2A 4KC1A 3RMVA 3V91A 1GWWA 3U0YA 3FWWA 1H5RA 1HM8A 5C4EA 1VICA 3RMWA 1G23A 2X65A 3OH3A 2AM4A 2FYDB 2QGIA 3D8VA 1VGZA 1TVYA 1XZ6A 4KPZA 1FO9A 1FR9A 5C3BA 1ZI3A 1YP2A 3ST8A 2XMHA 4ARWA 2X60A 2ZU8A 1LVWA 2UX8A 1ZDFA 1WT3A 4AAWA 5CQMX 4KRVA 4EEAA 4P02A 4M4KA 1HV9A 3V0MA 5CQOA 4G87A 1ZJ1A 3I0LA 1LZ0A 1H7GA 1ZCTA 5C38A 2VK9A 3DK5A 3V0LA 4B5BA 5EJZA 1G97A 1R7XA 4KNXA 4Y63A 2WEEA 1YROB 5L6SA 4B3UA 4HCQA 4B4GA 3K8EA 2CU2A 4HO3A 5C4CA 1ZI4A 2AM5A 4KNRA 3SXBA 1EYRA 3PKQA 3U2TA 5AJOA 3GUEA 5FUHA 1MC3A 2RJ8A 5EIYA 1ZCVA 1O23B 2I5KA 2ZU9A 2P72A 2VXMA 3PKPA 2A8WA 4P00A 2BO7A 5AJNA 1VH3A 1ZIZA 4Y64A 3SPTA 5FTVA 1IINA 3E26A 1LZJA 4FQWA 4KPXA 1G1LA 3F1YA 1G8OA 2VSHA 1S4PA 1ZI1A 2AECA 1NMMB 4ECMA 1TW5A 5CQNX 5FYEA 2Y4JA 2Q4JA 1LL0A 5DDTA 2YQSA 3I0GA 3JTJA 4KXOA 1G2VA 1R7UA 1FWYA 1MP4A 1LL2A 5FU8A 3CKQA 3E25A 3SXGA 1H3MA 2AESA 2O1FA 1E5KA 4ASYA 1ZJ0A 2APCA 2FFUA 3SXAA 5D91A 2RIXA 4G3SA 3U0XA 4Y62A 2E8BA 4D0ZA 3U2WA 1JYLA 1H5SD 2P73A 4AYLA 3OH1A 5FU0A 3I0HA 4UEGA 1FOAA 2OI7A 4HO2A 2ZU7A 2VFZA 3SXDA 2YQCA 2RJ9A 3R2WA 2WAWA 5I1FA 1ZCYA 4FIYA 5CMGX 4M2AA 2PA4A 3U2UA 3CKOA 3LW6A 2GGOA 3ZLKA 4ZDQA 4AYJA 1WT0A 2D7RA 2WVLA 3U2VA 2W0WA 2JCKA 2FY7A 5CMIA 4XWIA 1H7LA 2YQJA 2Z87A 4NAKA 3ZGGA 4Y7VA 2RJ6A 1FXOA 1QGSA 2ICXA 1I52A 1VGUA 1ZHJA 4EEMA 1FRWA 1NWGB 3OAMA 4DE7A 3SX3A 4K6RA 5HS2A 2JCOA 2V0LA 3PNNA 4FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJJ A;  1PZY B;  3DJ4 A;  1H5S C;  1EZI A;  2ICY A;  3TZT A;  1TZF A;  4FRP A;  4FRE A;  1IIM A;  1V83 A;  5C36 A;  5C1L A;  1INI A;  2YES A;  3SXE A;  3OH2 A;  3ZLL A;  1VZT A;  1ON8 A;  1VM8 A;  3EE5 A;  2I5E A;  3TQD A;  5IDS A;  5C3D A;  4R7P A;  4CJB A;  4D11 C;  1G9R A;  3Q7U A;  4Y9X A;  2V0H A;  3CKV A;  3OGZ A;  3SX5 A;  1FXJ A;  1VZU A;  4FCE A;  1GWV A;  1KWS A;  5EJ1 A;  4NAN A;  2WVM A;  3CGX A;  4HG6 A;  4EEG A;  1GX4 A;  2GGQ A;  4D0T A;  1H5T B;  1LL3 A;  2RIT A;  4ASJ A;  2VD4 A;  3K8D A;  1ZCU A;  4EE5 A;  1MP5 A;  1H5S B;  1G3L A;  1FGG A;  1QGQ A;  4Y7F A;  3DUV A;  3POL A;  3BRK X;  1GX0 A;  1FZW A;  1FGX A;  2AM3 A;  1K4V A;  4LW3 A;  4NAI A;  2OEG A;  2V0J A;  1WVC A;  2OI6 A;  3SXC A;  1FO8 A;  3T7M A;  2BO8 A;  3V0O A;  4B42 A;  4JD0 A;  2AGD A;  2O1H A;  4FRD A;  3I0I X;  3IOJ A;  3T7N A;  2FYA A;  2D0J A;  5C4B A;  4G3Q A;  4M2B A;  2XWM A;  2DPW A;  4Y7U A;  3U2X A;  3IOH A;  1R80 A;  2VS3 A;  3CKN A;  1W57 A;  1INJ A;  4FRL A;  1WT1 A;  3JUJ A;  2PX7 A;  1JV3 A;  1O7Q A;  3QVB A;  3R3I A;  1G95 A;  4EVW A;  1FG5 N;  1V82 A;  2XWL A;  4HO9 A;  4MND A;  1NHE B;  3F1C A;  4M28 A;  1ON6 A;  1W55 A;  3V8Z A;  1VGW A;  1VPA A;  2XME A;  1Z90 A;  2O1G A;  4HO6 A;  3ZF8 A;  1VZX A;  2AH9 A;  5J49 A;  1H5T A;  1ZJ3 A;  5FTS A;  2BO6 A;  2I7B A;  1VGT A;  4L41 C;  2X5Z A;  1FR8 A;  4B4M A;  3HL3 A;  1JYK A;  1H5S A;  1SS9 A;  3D5N A;  2X5S A;  3O3P A;  2VXL A;  1OQM B;  2NXV A;  1LZ7 A;  3OH0 A;  4E1K A;  4FRO A;  1ZJO A;  2Y7A A;  5CMH A;  1QWJ A;  2YC3 A;  4HO0 A;  5FV9 A;  1H7H A;  2RJ0 A;  2XWN A;  2FYC B;  4D11 A;  1H4C A;  3N9W A;  1H4D A;  1NKH B;  2V0I A;  2WGZ A;  1R7Y A;  5C4F A;  2VS4 A;  1OMZ A;  1HM9 A;  2VS5 A;  3I0C A;  2FYB A;  3I0J A;  4CJ8 A;  1V84 A;  5IFY A;  4Y7T A;  3V0P A;  5L6V A;  2FFV A;  1S4N A;  2BO4 A;  4FRB A;  4BQH A;  2AE7 A;  2OI5 A;  4GBP A;  4HOC A;  2OEF A;  1GQC A;  3USR A;  1XHB A;  4B2W A;  3OH4 A;  1W77 A;  1R81 A;  3I0K A;  2A8U A;  1QG8 A;  1PZT A;  1YP4 A;  4HO8 A;  3OKR A;  5CQP A;  3CKJ A;  1HJL A;  3T7O A;  5C1H A;  2WE9 A;  2YQH A;  4G3P A;  3ZGF A;  5C4D A;  1ZDG A;  1YP3 A;  4B2X A;  1R7V A;  5C1G A;  4EE3 A;  4BMA A;  4KC4 A;  4HO5 A;  4D48 A;  5CQL X;  3V90 A;  1OMX A;  3USQ A;  3OC9 A;  1G93 A;  5IDT A;  4FRQ A;  1JV1 A;  3Q80 A;  4FRH A;  3I0D A;  1H7F A;  4HO4 A;  2QKX A;  4NAL A;  3KIA A;  3CU0 A;  4KT7 A;  2Y4K A;  4DDZ A;  2VSI A;  1LZI A;  3D98 A;  2PGY A;  4FRA A;  4KQL A;  4C2S A;  2RIZ A;  1R7T A;  3NGW A;  5BXC A;  2E3D A;  3IOI A;  5AJP A;  4Y6U A;  1H4E A;  2RJ7 A;  4IRQ A;  3Q4S A;  1G0R A;  1H7Q A;  4DEC A;  1S4O A;  1WSZ A;  3BCV A;  3RSB A;  3V0Q A;  3FOQ A;  2Z86 A;  1H5R B;  3V0N A;  4EE4 A;  2RJ1 A;  2RJ5 A;  1GQ9 A;  3V8Y A;  3I0E A;  4YS8 A;  4Y7G A;  2YCM A;  1JVD A;  5C47 A;  1GA8 A;  5CMF X;  4FCU A;  4MYB A;  1H7T A;  1ZJ2 A;  1H7E A;  1JVG A;  5CMJ A;  2JCJ A;  2V0K A;  4B4B A;  3SX8 A;  2D7I A;  4CJC A;  4EEO A;  3SX7 A;  2Y6P A;  4JIS A;  1HM0 A;  2WVK A;  2QH5 A;  2P6W A;  1NQI B;  1NF5 B;  4J18 A;  3JUK A;  1WT2 A;  4Y6N A;  5DDV A;  5C48 A;  2YC5 A;  3I0F A;  5JQQ A;  5C49 A;  2RIY A;  2W0V A;  2JCL A;  4AC3 A;  1TW1 A;  4IRP A;  1MP3 A;  1ZJP A;  1R82 A;  5C3A A;  2RJ4 A;  1ZI5 A;  4CVH A;  2MZB A;  1O7O A;  2Y4L A;  1O0R A;  4LW6 A;  5C8R A;  1VH1 A;  2Y4M A;  2PGV A;  4KC2 A;  4KC1 A;  3RMV A;  3V91 A;  1GWW A;  3U0Y A;  3FWW A;  1H5R A;  1HM8 A;  5C4E A;  1VIC A;  3RMW A;  1G23 A;  2X65 A;  3OH3 A;  2AM4 A;  2FYD B;  2QGI A;  3D8V A;  1VGZ A;  1TVY A;  1XZ6 A;  4KPZ A;  1FO9 A;  1FR9 A;  5C3B A;  1ZI3 A;  1YP2 A;  3ST8 A;  2XMH A;  4ARW A;  2X60 A;  2ZU8 A;  1LVW A;  2UX8 A;  1ZDF A;  1WT3 A;  4AAW A;  5CQM X;  4KRV A;  4EEA A;  4P02 A;  4M4K A;  1HV9 A;  3V0M A;  5CQO A;  4G87 A;  1ZJ1 A;  3I0L A;  1LZ0 A;  1H7G A;  1ZCT A;  5C38 A;  3DK5 A;  3V0L A;  4B5B A;  5EJZ A;  1G97 A;  1R7X A;  4KNX A;  4Y63 A;  2WEE A;  1YRO B;  5L6S A;  4B3U A;  4HCQ A;  4B4G A;  3K8E A;  2CU2 A;  4HO3 A;  5C4C A;  1ZI4 A;  2AM5 A;  4KNR A;  3SXB A;  1EYR A;  3PKQ A;  3U2T A;  5AJO A;  3GUE A;  5FUH A;  1MC3 A;  2RJ8 A;  5EIY A;  1ZCV A;  1O23 B;  2I5K A;  2ZU9 A;  2P72 A;  2VXM A;  3PKP A;  2A8W A;  4P00 A;  2BO7 A;  5AJN A;  1VH3 A;  1ZIZ A;  4Y64 A;  3SPT A;  5FTV A;  1IIN A;  3E26 A;  1LZJ A;  4FQW A;  4KPX A;  1G1L A;  3F1Y A;  1G8O A;  2VSH A;  1S4P A;  1ZI1 A;  2AEC A;  1NMM B;  4ECM A;  1TW5 A;  5CQN X;  5FYE A;  2Y4J A;  2Q4J A;  1LL0 A;  5DDT A;  2YQS A;  3I0G A;  3JTJ A;  4KXO A;  1G2V A;  1R7U A;  1FWY A;  1MP4 A;  1LL2 A;  5FU8 A;  3CKQ A;  3E25 A;  3SXG A;  1H3M A;  2AES A;  2O1F A;  1E5K A;  4ASY A;  1ZJ0 A;  2APC A;  2FFU A;  3SXA A;  2RIX A;  4G3S A;  3U0X A;  4Y62 A;  2E8B A;  4D0Z A;  3U2W A;  1JYL A;  1H5S D;  2P73 A;  4AYL A;  3OH1 A;  5FU0 A;  3I0H A;  4UEG A;  1FOA A;  2OI7 A;  4HO2 A;  2ZU7 A;  2VFZ A;  3SXD A;  2YQC A;  2RJ9 A;  3R2W A;  2WAW A;  5I1F A;  1ZCY A;  5CMG X;  4M2A A;  2PA4 A;  3U2U A;  3CKO A;  3LW6 A;  2GGO A;  3ZLK A;  4ZDQ A;  4AYJ A;  1WT0 A;  2D7R A;  2WVL A;  3U2V A;  2W0W A;  2JCK A;  2FY7 A;  5CMI A;  4XWI A;  1H7L A;  2YQJ A;  2Z87 A;  4NAK A;  3ZGG A;  4Y7V A;  2RJ6 A;  1FXO A;  1QGS A;  2ICX A;  1I52 A;  1VGU A;  1ZHJ A;  4EEM A;  1FRW A;  1NWG B;  3OAM A;  4DE7 A;  3SX3 A;  4K6R A;  5HS2 A;  2JCO A;  2V0L A;  3PNN A;  4FRM A; 
#chains in the Genus database with same CATH topology
 1HJJ A;  1PZY B;  3DJ4 A;  1H5S C;  1EZI A;  2ICY A;  3TZT A;  1TZF A;  4FRP A;  4FRE A;  1IIM A;  1V83 A;  5C36 A;  5C1L A;  1INI A;  2YES A;  3SXE A;  3OH2 A;  3ZLL A;  1VZT A;  2J0A A;  1ON8 A;  1VM8 A;  3EE5 A;  2I5E A;  3TQD A;  5IDS A;  5C3D A;  4R7P A;  4CJB A;  4D11 C;  1G9R A;  3Q7U A;  4Y9X A;  2V0H A;  3CKV A;  3OGZ A;  3SX5 A;  1FXJ A;  1VZU A;  4FCE A;  1GWV A;  1KWS A;  5EJ1 A;  4NAN A;  2WVM A;  3CGX A;  4HG6 A;  4EEG A;  1GX4 A;  2GGQ A;  4O6N A;  4D0T A;  1H5T B;  1LL3 A;  2RIT A;  4ASJ A;  2VD4 A;  3K8D A;  1ZCU A;  4EE5 A;  1MP5 A;  1H5S B;  1G3L A;  1FGG A;  1QGQ A;  4Y7F A;  3DUV A;  3POL A;  3BRK X;  1GX0 A;  1FZW A;  1FGX A;  2AM3 A;  1K4V A;  4LW3 A;  4NAI A;  4MIX A;  2OEG A;  2V0J A;  1WVC A;  2OI6 A;  3SXC A;  1FO8 A;  3T7M A;  2BO8 A;  3V0O A;  4B42 A;  4JD0 A;  2AGD A;  2O1H A;  4FRD A;  3I0I X;  3IOJ A;  3T7N A;  2FYA A;  2D0J A;  5C4B A;  4G3Q A;  4M2B A;  2XWM A;  2DPW A;  4Y7U A;  3U2X A;  3IOH A;  1R80 A;  2VS3 A;  3CKN A;  1W57 A;  1INJ A;  4FRL A;  1WT1 A;  3JUJ A;  2PX7 A;  1JV3 A;  1O7Q A;  3QVB A;  3R3I A;  1G95 A;  4EVW A;  1FG5 N;  1V82 A;  2XWL A;  4HO9 A;  4MND A;  1NHE B;  3F1C A;  4M28 A;  1ON6 A;  1W55 A;  3V8Z A;  1VGW A;  1VPA A;  2XME A;  1Z90 A;  2O1G A;  4HO6 A;  3ZF8 A;  1VZX A;  2AH9 A;  5J49 A;  1H5T A;  1ZJ3 A;  5FTS A;  2BO6 A;  2I7B A;  1VGT A;  4L41 C;  2X5Z A;  1FR8 A;  4B4M A;  3HL3 A;  1JYK A;  4O6M A;  1H5S A;  1SS9 A;  3D5N A;  2X5S A;  3O3P A;  2VXL A;  1OQM B;  2NXV A;  1LZ7 A;  3OH0 A;  4E1K A;  4FRO A;  1ZJO A;  2Y7A A;  5CMH A;  1QWJ A;  2YC3 A;  4HO0 A;  5FV9 A;  1H7H A;  2RJ0 A;  2XWN A;  2FYC B;  4D11 A;  2C0N A;  1H4C A;  3N9W A;  1H4D A;  1NKH B;  2V0I A;  2WGZ A;  1R7Y A;  5C4F A;  2VS4 A;  1OMZ A;  1HM9 A;  2VS5 A;  3I0C A;  2FYB A;  3I0J A;  4CJ8 A;  1V84 A;  5IFY A;  4Y7T A;  3V0P A;  5L6V A;  2FFV A;  1S4N A;  2BO4 A;  4FRB A;  4BQH A;  2AE7 A;  2OI5 A;  4GBP A;  4HOC A;  2OEF A;  1GQC A;  3USR A;  1XHB A;  4B2W A;  3OH4 A;  1W77 A;  1R81 A;  3I0K A;  2A8U A;  1QG8 A;  1PZT A;  1YP4 A;  4HO8 A;  3OKR A;  5CQP A;  3CKJ A;  1HJL A;  3T7O A;  5C1H A;  2WE9 A;  2YQH A;  4G3P A;  3ZGF A;  5C4D A;  1ZDG A;  1YP3 A;  4B2X A;  1R7V A;  5C1G A;  4EE3 A;  4BMA A;  4KC4 A;  4HO5 A;  4D48 A;  5CQL X;  3V90 A;  1OMX A;  3USQ A;  3OC9 A;  1G93 A;  5IDT A;  4FRQ A;  1JV1 A;  3Q80 A;  4FRH A;  3I0D A;  1H7F A;  4HO4 A;  2QKX A;  4NAL A;  3KIA A;  3CU0 A;  4KT7 A;  2Y4K A;  4DDZ A;  2VSI A;  1LZI A;  3D98 A;  2PGY A;  4FRA A;  4KQL A;  4C2S A;  2RIZ A;  1R7T A;  3NGW A;  5BXC A;  2E3D A;  3IOI A;  5AJP A;  4Q7C A;  4Y6U A;  1H4E A;  2RJ7 A;  4IRQ A;  3Q4S A;  1G0R A;  1H7Q A;  4DEC A;  1S4O A;  1WSZ A;  3BCV A;  3RSB A;  3V0Q A;  3FOQ A;  2Z86 A;  1H5R B;  3V0N A;  4EE4 A;  2RJ1 A;  2RJ5 A;  1GQ9 A;  3V8Y A;  3I0E A;  4YS8 A;  4Y7G A;  4FIX A;  2YCM A;  1JVD A;  5C47 A;  1GA8 A;  5CMF X;  4FCU A;  4MYB A;  1H7T A;  1ZJ2 A;  1H7E A;  1JVG A;  5CMJ A;  2J0B A;  2JCJ A;  2V0K A;  4B4B A;  3SX8 A;  2D7I A;  4CJC A;  4EEO A;  3SX7 A;  2Y6P A;  4JIS A;  1HM0 A;  2WVK A;  2QH5 A;  2P6W A;  1NQI B;  1NF5 B;  4J18 A;  3JUK A;  1WT2 A;  4Y6N A;  5DDV A;  5C48 A;  2YC5 A;  3I0F A;  5JQQ A;  5C49 A;  2RIY A;  2W0V A;  2JCL A;  4AC3 A;  1TW1 A;  4IRP A;  1MP3 A;  1ZJP A;  1R82 A;  5C3A A;  2RJ4 A;  1ZI5 A;  4CVH A;  2MZB A;  1O7O A;  2Y4L A;  1O0R A;  4LW6 A;  5C8R A;  5D92 A;  1VH1 A;  2Y4M A;  2PGV A;  4KC2 A;  4KC1 A;  3RMV A;  3V91 A;  1GWW A;  3U0Y A;  3FWW A;  1H5R A;  1HM8 A;  5C4E A;  1VIC A;  3RMW A;  1G23 A;  2X65 A;  3OH3 A;  2AM4 A;  2FYD B;  2QGI A;  3D8V A;  1VGZ A;  1TVY A;  1XZ6 A;  4KPZ A;  1FO9 A;  1FR9 A;  5C3B A;  1ZI3 A;  1YP2 A;  3ST8 A;  2XMH A;  4ARW A;  2X60 A;  2ZU8 A;  1LVW A;  2UX8 A;  1ZDF A;  1WT3 A;  4AAW A;  5CQM X;  4KRV A;  4EEA A;  4P02 A;  4M4K A;  1HV9 A;  3V0M A;  5CQO A;  4G87 A;  1ZJ1 A;  3I0L A;  1LZ0 A;  1H7G A;  1ZCT A;  5C38 A;  2VK9 A;  3DK5 A;  3V0L A;  4B5B A;  5EJZ A;  1G97 A;  1R7X A;  4KNX A;  4Y63 A;  2WEE A;  1YRO B;  5L6S A;  4B3U A;  4HCQ A;  4B4G A;  3K8E A;  2CU2 A;  4HO3 A;  5C4C A;  1ZI4 A;  2AM5 A;  4KNR A;  3SXB A;  1EYR A;  3PKQ A;  3U2T A;  5AJO A;  3GUE A;  5FUH A;  1MC3 A;  2RJ8 A;  5EIY A;  1ZCV A;  1O23 B;  2I5K A;  2ZU9 A;  2P72 A;  2VXM A;  3PKP A;  2A8W A;  4P00 A;  2BO7 A;  5AJN A;  1VH3 A;  1ZIZ A;  4Y64 A;  3SPT A;  5FTV A;  1IIN A;  3E26 A;  1LZJ A;  4FQW A;  4KPX A;  1G1L A;  3F1Y A;  1G8O A;  2VSH A;  1S4P A;  1ZI1 A;  2AEC A;  1NMM B;  4ECM A;  1TW5 A;  5CQN X;  5FYE A;  2Y4J A;  2Q4J A;  1LL0 A;  5DDT A;  2YQS A;  3I0G A;  3JTJ A;  4KXO A;  1G2V A;  1R7U A;  1FWY A;  1MP4 A;  1LL2 A;  5FU8 A;  3CKQ A;  3E25 A;  3SXG A;  1H3M A;  2AES A;  2O1F A;  1E5K A;  4ASY A;  1ZJ0 A;  2APC A;  2FFU A;  3SXA A;  5D91 A;  2RIX A;  4G3S A;  3U0X A;  4Y62 A;  2E8B A;  4D0Z A;  3U2W A;  1JYL A;  1H5S D;  2P73 A;  4AYL A;  3OH1 A;  5FU0 A;  3I0H A;  4UEG A;  1FOA A;  2OI7 A;  4HO2 A;  2ZU7 A;  2VFZ A;  3SXD A;  2YQC A;  2RJ9 A;  3R2W A;  2WAW A;  5I1F A;  1ZCY A;  4FIY A;  5CMG X;  4M2A A;  2PA4 A;  3U2U A;  3CKO A;  3LW6 A;  2GGO A;  3ZLK A;  4ZDQ A;  4AYJ A;  1WT0 A;  2D7R A;  2WVL A;  3U2V A;  2W0W A;  2JCK A;  2FY7 A;  5CMI A;  4XWI A;  1H7L A;  2YQJ A;  2Z87 A;  4NAK A;  3ZGG A;  4Y7V A;  2RJ6 A;  1FXO A;  1QGS A;  2ICX A;  1I52 A;  1VGU A;  1ZHJ A;  4EEM A;  1FRW A;  1NWG B;  3OAM A;  4DE7 A;  3SX3 A;  4K6R A;  5HS2 A;  2JCO A;  2V0L A;  3PNN A;  4FRM A; 
#chains in the Genus database with same CATH homology
 1HJJ A;  1PZY B;  3DJ4 A;  1H5S C;  1EZI A;  2ICY A;  3TZT A;  1TZF A;  4FRP A;  4FRE A;  1IIM A;  1V83 A;  5C36 A;  5C1L A;  1INI A;  2YES A;  3SXE A;  3OH2 A;  3ZLL A;  1VZT A;  2J0A A;  1ON8 A;  1VM8 A;  3EE5 A;  2I5E A;  3TQD A;  5IDS A;  5C3D A;  4R7P A;  4CJB A;  4D11 C;  1G9R A;  3Q7U A;  4Y9X A;  2V0H A;  3CKV A;  3OGZ A;  3SX5 A;  1FXJ A;  1VZU A;  4FCE A;  1GWV A;  1KWS A;  5EJ1 A;  4NAN A;  2WVM A;  3CGX A;  4HG6 A;  4EEG A;  1GX4 A;  2GGQ A;  4O6N A;  4D0T A;  1H5T B;  1LL3 A;  2RIT A;  4ASJ A;  2VD4 A;  3K8D A;  1ZCU A;  4EE5 A;  1MP5 A;  1H5S B;  1G3L A;  1FGG A;  1QGQ A;  4Y7F A;  3DUV A;  3POL A;  3BRK X;  1GX0 A;  1FZW A;  1FGX A;  2AM3 A;  1K4V A;  4LW3 A;  4NAI A;  4MIX A;  2OEG A;  2V0J A;  1WVC A;  2OI6 A;  3SXC A;  1FO8 A;  3T7M A;  2BO8 A;  3V0O A;  4B42 A;  4JD0 A;  2AGD A;  2O1H A;  4FRD A;  3I0I X;  3IOJ A;  3T7N A;  2FYA A;  2D0J A;  5C4B A;  4G3Q A;  4M2B A;  2XWM A;  2DPW A;  4Y7U A;  3U2X A;  3IOH A;  1R80 A;  2VS3 A;  3CKN A;  1W57 A;  1INJ A;  4FRL A;  1WT1 A;  3JUJ A;  2PX7 A;  1JV3 A;  1O7Q A;  3QVB A;  3R3I A;  1G95 A;  4EVW A;  1FG5 N;  1V82 A;  2XWL A;  4HO9 A;  4MND A;  1NHE B;  3F1C A;  4M28 A;  1ON6 A;  1W55 A;  3V8Z A;  1VGW A;  1VPA A;  2XME A;  1Z90 A;  2O1G A;  4HO6 A;  3ZF8 A;  1VZX A;  2AH9 A;  5J49 A;  1H5T A;  1ZJ3 A;  5FTS A;  2BO6 A;  2I7B A;  1VGT A;  4L41 C;  2X5Z A;  1FR8 A;  4B4M A;  3HL3 A;  1JYK A;  4O6M A;  1H5S A;  1SS9 A;  3D5N A;  2X5S A;  3O3P A;  2VXL A;  1OQM B;  2NXV A;  1LZ7 A;  3OH0 A;  4E1K A;  4FRO A;  1ZJO A;  2Y7A A;  5CMH A;  1QWJ A;  2YC3 A;  4HO0 A;  5FV9 A;  1H7H A;  2RJ0 A;  2XWN A;  2FYC B;  4D11 A;  2C0N A;  1H4C A;  3N9W A;  1H4D A;  1NKH B;  2V0I A;  2WGZ A;  1R7Y A;  5C4F A;  2VS4 A;  1OMZ A;  1HM9 A;  2VS5 A;  3I0C A;  2FYB A;  3I0J A;  4CJ8 A;  1V84 A;  5IFY A;  4Y7T A;  3V0P A;  5L6V A;  2FFV A;  1S4N A;  2BO4 A;  4FRB A;  4BQH A;  2AE7 A;  2OI5 A;  4GBP A;  4HOC A;  2OEF A;  1GQC A;  3USR A;  1XHB A;  4B2W A;  3OH4 A;  1W77 A;  1R81 A;  3I0K A;  2A8U A;  1QG8 A;  1PZT A;  1YP4 A;  4HO8 A;  3OKR A;  5CQP A;  3CKJ A;  1HJL A;  3T7O A;  5C1H A;  2WE9 A;  2YQH A;  4G3P A;  3ZGF A;  5C4D A;  1ZDG A;  1YP3 A;  4B2X A;  1R7V A;  5C1G A;  4EE3 A;  4BMA A;  4KC4 A;  4HO5 A;  4D48 A;  5CQL X;  3V90 A;  1OMX A;  3USQ A;  3OC9 A;  1G93 A;  5IDT A;  4FRQ A;  1JV1 A;  3Q80 A;  4FRH A;  3I0D A;  1H7F A;  4HO4 A;  2QKX A;  4NAL A;  3KIA A;  3CU0 A;  4KT7 A;  2Y4K A;  4DDZ A;  2VSI A;  1LZI A;  3D98 A;  2PGY A;  4FRA A;  4KQL A;  4C2S A;  2RIZ A;  1R7T A;  3NGW A;  5BXC A;  2E3D A;  3IOI A;  5AJP A;  4Q7C A;  4Y6U A;  1H4E A;  2RJ7 A;  4IRQ A;  3Q4S A;  1G0R A;  1H7Q A;  4DEC A;  1S4O A;  1WSZ A;  3BCV A;  3RSB A;  3V0Q A;  3FOQ A;  2Z86 A;  1H5R B;  3V0N A;  4EE4 A;  2RJ1 A;  2RJ5 A;  1GQ9 A;  3V8Y A;  3I0E A;  4YS8 A;  4Y7G A;  4FIX A;  2YCM A;  1JVD A;  5C47 A;  1GA8 A;  5CMF X;  4FCU A;  4MYB A;  1H7T A;  1ZJ2 A;  1H7E A;  1JVG A;  5CMJ A;  2J0B A;  2JCJ A;  2V0K A;  4B4B A;  3SX8 A;  2D7I A;  4CJC A;  4EEO A;  3SX7 A;  2Y6P A;  4JIS A;  1HM0 A;  2WVK A;  2QH5 A;  2P6W A;  1NQI B;  1NF5 B;  4J18 A;  3JUK A;  1WT2 A;  4Y6N A;  5DDV A;  5C48 A;  2YC5 A;  3I0F A;  5JQQ A;  5C49 A;  2RIY A;  2W0V A;  2JCL A;  4AC3 A;  1TW1 A;  4IRP A;  1MP3 A;  1ZJP A;  1R82 A;  5C3A A;  2RJ4 A;  1ZI5 A;  4CVH A;  2MZB A;  1O7O A;  2Y4L A;  1O0R A;  4LW6 A;  5C8R A;  5D92 A;  1VH1 A;  2Y4M A;  2PGV A;  4KC2 A;  4KC1 A;  3RMV A;  3V91 A;  1GWW A;  3U0Y A;  3FWW A;  1H5R A;  1HM8 A;  5C4E A;  1VIC A;  3RMW A;  1G23 A;  2X65 A;  3OH3 A;  2AM4 A;  2FYD B;  2QGI A;  3D8V A;  1VGZ A;  1TVY A;  1XZ6 A;  4KPZ A;  1FO9 A;  1FR9 A;  5C3B A;  1ZI3 A;  1YP2 A;  3ST8 A;  2XMH A;  4ARW A;  2X60 A;  2ZU8 A;  1LVW A;  2UX8 A;  1ZDF A;  1WT3 A;  4AAW A;  5CQM X;  4KRV A;  4EEA A;  4P02 A;  4M4K A;  1HV9 A;  3V0M A;  5CQO A;  4G87 A;  1ZJ1 A;  3I0L A;  1LZ0 A;  1H7G A;  1ZCT A;  5C38 A;  2VK9 A;  3DK5 A;  3V0L A;  4B5B A;  5EJZ A;  1G97 A;  1R7X A;  4KNX A;  4Y63 A;  2WEE A;  1YRO B;  5L6S A;  4B3U A;  4HCQ A;  4B4G A;  3K8E A;  2CU2 A;  4HO3 A;  5C4C A;  1ZI4 A;  2AM5 A;  4KNR A;  3SXB A;  1EYR A;  3PKQ A;  3U2T A;  5AJO A;  3GUE A;  5FUH A;  1MC3 A;  2RJ8 A;  5EIY A;  1ZCV A;  1O23 B;  2I5K A;  2ZU9 A;  2P72 A;  2VXM A;  3PKP A;  2A8W A;  4P00 A;  2BO7 A;  5AJN A;  1VH3 A;  1ZIZ A;  4Y64 A;  3SPT A;  5FTV A;  1IIN A;  3E26 A;  1LZJ A;  4FQW A;  4KPX A;  1G1L A;  3F1Y A;  1G8O A;  2VSH A;  1S4P A;  1ZI1 A;  2AEC A;  1NMM B;  4ECM A;  1TW5 A;  5CQN X;  5FYE A;  2Y4J A;  2Q4J A;  1LL0 A;  5DDT A;  2YQS A;  3I0G A;  3JTJ A;  4KXO A;  1G2V A;  1R7U A;  1FWY A;  1MP4 A;  1LL2 A;  5FU8 A;  3CKQ A;  3E25 A;  3SXG A;  1H3M A;  2AES A;  2O1F A;  1E5K A;  4ASY A;  1ZJ0 A;  2APC A;  2FFU A;  3SXA A;  5D91 A;  2RIX A;  4G3S A;  3U0X A;  4Y62 A;  2E8B A;  4D0Z A;  3U2W A;  1JYL A;  1H5S D;  2P73 A;  4AYL A;  3OH1 A;  5FU0 A;  3I0H A;  4UEG A;  1FOA A;  2OI7 A;  4HO2 A;  2ZU7 A;  2VFZ A;  3SXD A;  2YQC A;  2RJ9 A;  3R2W A;  2WAW A;  5I1F A;  1ZCY A;  4FIY A;  5CMG X;  4M2A A;  2PA4 A;  3U2U A;  3CKO A;  3LW6 A;  2GGO A;  3ZLK A;  4ZDQ A;  4AYJ A;  1WT0 A;  2D7R A;  2WVL A;  3U2V A;  2W0W A;  2JCK A;  2FY7 A;  5CMI A;  4XWI A;  1H7L A;  2YQJ A;  2Z87 A;  4NAK A;  3ZGG A;  4Y7V A;  2RJ6 A;  1FXO A;  1QGS A;  2ICX A;  1I52 A;  1VGU A;  1ZHJ A;  4EEM A;  1FRW A;  1NWG B;  3OAM A;  4DE7 A;  3SX3 A;  4K6R A;  5HS2 A;  2JCO A;  2V0L A;  3PNN A;  4FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...