3RMVA

Crystal structure of human glycogenin-1 (gyg1) t83m mutant complexed with manganese and udp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
249
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVMLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSILPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 249
sequence length 263
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3rmvA00
3T7MA 4EE3A 1ZI4A 3OH2A 2BO4A 3BCVA 2OI5A 1V83A 5FV9A 5HS2A 2OEGA 2QGIA 4LW3A 1FG5N 2AESA 2FYCB 1FXOA 1H4EA 1S4NA 5C8RA 1H3MA 1W77A 1XZ6A 2V0IA 2VXMA 1VGUA 4AYJA 5C4BA 2P6WA 1H5RB 3EE5A 2D7IA 2V0HA 4EE5A 3OH4A 4MNDA 3I0FA 5CQMX 4EEMA 4EEGA 1HJJA 2YQCA 3ZGGA 4B2XA 3E26A 4AYLA 2RJ1A 2Q4JA 3V0NA 1R7TA 1H7FA 1JV3A 2VSHA 2VSIA 4Y7TA 4ASYA 4D0ZA 3I0IX 3JUKA 2X60A 4G3PA 1HM0A 4CVHA 2RJ9A 5CMIA 4KNRA 1I52A 1FR8A 4AAWA 1R7UA 3T7OA 4DE7A 4J18A 2WGZA 5AJOA 3V90A 3DJ4A 2ZU8A 4M2AA 2RJ5A 2ICYA 4CJCA 3E25A 5DDVA 5CMJA 1ZCVA 1ZJ0A 4FRMA 5C1HA 4EEOA 5AJNA 1ZCUA 3D98A 4B5BA 2FFVA 3TZTA 2WE9A 3OKRA 1WVCA 2PGVA 2P73A 4Y7GA 4ARWA 3F1CA 4NAIA 4FCEA 3U2UA 4P02A 5C36A 2V0LA 1YP2A 2VS5A 1INIA 1QGSA 1JYLA 2JCJA 4NANA 2FYDB 4MYBA 2RJ8A 4M28A 1ZJ3A 2DPWA 3PKQA 1NKHB 5FTVA 2YQSA 3K8DA 1ZI1A 5FTSA 1OMXA 3V0OA 2MZBA 3V0MA 1XHBA 4B4GA 1LZ0A 1H5SB 4FRBA 3USRA 1ZJOA 3V91A 2I5KA 1FO8A 2Y4KA 1G97A 4IRQA 3I0EA 3I0KA 3NGWA 3U2WA 4Y9XA 1ZDFA 4XWIA 3FWWA 1H5SD 5IDTA 4Y64A 1GWWA 2XWLA 5C3DA 1WT2A 1QGQA 3OH1A 5CQNX 4BQHA 4HO6A 1R7YA 2OEFA 2FYBA 3U2XA 5C4EA 1NWGB 2FFUA 4FRAA 3I0DA 1YP4A 3OGZA 5JQQA 4EVWA 1LL0A 4FRHA 4HO8A 1WT0A 1PZTA 1G3LA 3IOHA 2VXLA 4D48A 3DUVA 4ASJA 1MP4A 4Y63A 3BRKX 1VGTA 1GWVA 1O23B 3JTJA 1G95A 1PZYB 2D7RA 1ZJ2A 1QG8A 3D8VA 1ZDGA 1HJLA 1Z90A 2Y4LA 1GX0A 2WVKA 4K6RA 3ST8A 1QWJA 3R3IA 2GGQA 1ZI5A 2RIZA 5C4CA 1S4OA 4HCQA 4HO4A 3CU0A 1S4PA 2XWMA 2NXVA 1W55A 2XMEA 3SX7A 3ZGFA 3SPTA 3Q7UA 3U0YA 1G9RA 1ON8A 4B2WA 2FY7A 3N9WA 1NQIB 3T7NA 5C4FA 1G1LA 1H5TA 1ZCTA 1GA8A 4DDZA 1GQ9A 1MP3A 4KC4A 3F1YA 3O3PA 1IINA 1LVWA 1ZJ1A 2O1FA 1ZI3A 2O1GA 1VZTA 5CQLX 2A8UA 3Q80A 1R81A 4Y62A 4JD0A 1ON6A 1V84A 3U2VA 5FUHA 1LZJA 1ZCYA 2BO7A 3ZLKA 2OI6A 2VFZA 5EJ1A 1V82A 2XWNA 2RIXA 3DK5A 1H7GA 4KPXA 4KPZA 2JCLA 2FYAA 5C1GA 3V0LA 4KRVA 3V8YA 1LZIA 4R7PA 2AGDA 4KQLA 3IOIA 2JCOA 1ZIZA 4HO0A 2AM3A 2I5EA 2AE7A 2ZU7A 3K8EA 3CKVA 5BXCA 4G87A 3CKQA 2X5ZA 1INJA 1IIMA 2V0JA 1W57A 3V8ZA 1JVDA 5C49A 1H7EA 5IFYA 3RMWA 5FU8A 1TZFA 2PX7A 5EJZA 1SS9A 2W0VA 5J49A 3PNNA 1VH1A 2QKXA 1MC3A 1VZUA 2RITA 4D11C 1R82A 2VS3A 2YESA 1H7HA 4KXOA 2RJ7A 3OC9A 3I0CA 3Q4SA 4KT7A 3SXCA 2UX8A 4G3QA 1LZ7A 4FRDA 2X65A 1FGXA 4B4MA 1WT3A 4D11A 3JUJA 3V0PA 3USQA 2E8BA 3OH0A 1JV1A 4NALA 5CMHA 3KIAA 5C3AA 2OI7A 1TW5A 5C4DA 5IDSA 5C1LA 5FU0A 4D0TA 4KC2A 1FXJA 3SX5A 4EE4A 5I1FA 1LL3A 1TW1A 5CMFX 2RJ4A 4HO3A 1JVGA 4YS8A 4BMAA 3SX3A 4FCUA 4L41C 4FROA 1VICA 1NF5B 3I0LA 1FR9A 1GQCA 3CKNA 5EIYA 2VD4A 4KC1A 5CQOA 2JCKA 3ZF8A 2YC5A 4CJBA 4GBPA 5C3BA 1FRWA 1KWSA 1R80A 1E5KA 4DECA 1VH3A 3LW6A 4HOCA 3SXEA 2AH9A 2PA4A 2AM5A 3I0JA 3PKPA 4HO9A 2Y6PA 5CMGX 2RJ0A 4FRLA 2QH5A 4Y7FA 1OQMB 1H5RA 5C38A 1G0RA 1R7VA 4HO5A 2Z87A 4FREA 4Y7VA 4ECMA 2Y4MA 2P72A 3U2TA 1H7TA 3I0GA 1NMMB 4G3SA 1YROB 2BO8A 2RJ6A 1FO9A 2Y4JA 1H5TB 1VGZA 5CQPA 1FGGA 3ZLLA 2YQJA 3OH3A 2AECA 2I7BA 4ZDQA 2X5SA 3CKOA 3RMVA 1LL2A 3HL3A 4B3UA 1HM8A 2WAWA 3U0XA 4B4BA 2WVLA 2A8WA 1VZXA 1G93A 1VGWA 4AC3A 1ZHJA 1OMZA 4JISA 5C47A 5L6SA 1WSZA 2E3DA 4E1KA 4HG6A 3V0QA 1EZIA 3R2WA 4IRPA 4KNXA 2ICXA 5DDTA 2GGOA 1NHEB 2O1HA 3POLA 1GX4A 1H5SC 3QVBA 4M4KA 2ZU9A 1O0RA 2D0JA 1O7OA 5C48A 4UEGA 3SXDA 1HM9A 3SX8A 4HO2A 1H5SA 4EEAA 1JYKA 5AJPA 2AM4A 2BO6A 5L6VA 2Z86A 1O7QA 1EYRA 3SXBA 1H4CA 4Y6NA 1FWYA 2WEEA 1R7XA 2PGYA 1FZWA 4Y6UA 1G8OA 1G2VA 1FOAA 3SXAA 4FRPA 3TQDA 4FRQA 4CJ8A 3FOQA 3CGXA 2YCMA 1H4DA 1ZJPA 3GUEA 1WT1A 3OAMA 5FYEA 4FQWA 3IOJA 1VPAA 1G23A 2RIYA 2VS4A 1TVYA 1K4VA 1HV9A 2APCA 2W0WA 3RSBA 2WVMA 3D5NA 3SXGA 4M2BA 1YP3A 2Y7AA 3CKJA 3I0HA 4Y7UA 1MP5A 1VM8A 2XMHA 2CU2A 1H7QA 2YC3A 4C2SA 2YQHA 4LW6A 4NAKA 4B42A 4P00A 2V0KA 1H7LA
chains in the Genus database with same CATH superfamily
3T7MA 4EE3A 1ZI4A 3OH2A 2BO4A 3BCVA 2OI5A 1V83A 5FV9A 5HS2A 2OEGA 2QGIA 4LW3A 1FG5N 2AESA 2FYCB 1FXOA 1H4EA 1S4NA 5C8RA 1H3MA 1W77A 1XZ6A 2V0IA 2VXMA 1VGUA 4AYJA 5C4BA 2P6WA 1H5RB 3EE5A 2D7IA 2V0HA 4EE5A 3OH4A 4MNDA 3I0FA 5CQMX 4EEMA 4EEGA 1HJJA 2YQCA 3ZGGA 4B2XA 3E26A 4AYLA 2RJ1A 2Q4JA 3V0NA 1R7TA 1H7FA 1JV3A 2VSHA 2VSIA 4Y7TA 4ASYA 4D0ZA 3I0IX 3JUKA 2X60A 4G3PA 1HM0A 4CVHA 2RJ9A 5CMIA 4KNRA 1I52A 1FR8A 4AAWA 1R7UA 3T7OA 4DE7A 4J18A 2WGZA 5AJOA 3V90A 3DJ4A 2ZU8A 4M2AA 2RJ5A 2ICYA 4CJCA 3E25A 5DDVA 5CMJA 1ZCVA 1ZJ0A 4FRMA 5C1HA 4EEOA 5AJNA 1ZCUA 3D98A 4B5BA 2FFVA 3TZTA 2WE9A 3OKRA 5D92A 1WVCA 2PGVA 2P73A 4Y7GA 4ARWA 3F1CA 4NAIA 4FCEA 3U2UA 4P02A 5C36A 2V0LA 1YP2A 2VS5A 1INIA 1QGSA 1JYLA 2JCJA 4NANA 2FYDB 4MYBA 2RJ8A 4M28A 1ZJ3A 2DPWA 3PKQA 1NKHB 5FTVA 2YQSA 3K8DA 1ZI1A 5FTSA 1OMXA 3V0OA 2MZBA 3V0MA 1XHBA 4B4GA 1LZ0A 1H5SB 4FRBA 3USRA 1ZJOA 3V91A 2I5KA 1FO8A 2Y4KA 1G97A 4IRQA 3I0EA 3I0KA 3NGWA 3U2WA 4Y9XA 1ZDFA 4XWIA 3FWWA 1H5SD 5IDTA 4Y64A 1GWWA 2XWLA 5C3DA 1WT2A 1QGQA 3OH1A 5CQNX 4BQHA 4HO6A 1R7YA 2OEFA 2FYBA 3U2XA 5C4EA 1NWGB 2FFUA 4FRAA 3I0DA 1YP4A 3OGZA 5JQQA 4EVWA 1LL0A 4FRHA 4HO8A 1WT0A 1PZTA 1G3LA 3IOHA 2VXLA 4D48A 3DUVA 4ASJA 1MP4A 4Y63A 3BRKX 1VGTA 1GWVA 1O23B 3JTJA 1G95A 1PZYB 2D7RA 1ZJ2A 1QG8A 3D8VA 1ZDGA 1HJLA 1Z90A 2Y4LA 1GX0A 2WVKA 4K6RA 3ST8A 1QWJA 3R3IA 2GGQA 1ZI5A 2RIZA 5C4CA 1S4OA 4HCQA 4HO4A 3CU0A 1S4PA 2XWMA 2NXVA 1W55A 2XMEA 3SX7A 3ZGFA 3SPTA 3Q7UA 3U0YA 1G9RA 1ON8A 4B2WA 2FY7A 3N9WA 1NQIB 3T7NA 5C4FA 1G1LA 1H5TA 1ZCTA 1GA8A 4DDZA 1GQ9A 1MP3A 4KC4A 3F1YA 3O3PA 1IINA 1LVWA 1ZJ1A 2O1FA 1ZI3A 2O1GA 1VZTA 2VK9A 5CQLX 2A8UA 3Q80A 1R81A 4Y62A 4JD0A 1ON6A 1V84A 3U2VA 5FUHA 1LZJA 4O6MA 1ZCYA 2BO7A 3ZLKA 2OI6A 2VFZA 5EJ1A 1V82A 2XWNA 2RIXA 3DK5A 1H7GA 4KPXA 4KPZA 2JCLA 2FYAA 4FIYA 5C1GA 3V0LA 4KRVA 3V8YA 1LZIA 4R7PA 2AGDA 4KQLA 3IOIA 2JCOA 1ZIZA 4HO0A 2AM3A 2I5EA 2AE7A 2ZU7A 3K8EA 3CKVA 5BXCA 4G87A 3CKQA 2X5ZA 1INJA 1IIMA 2V0JA 1W57A 3V8ZA 1JVDA 5C49A 1H7EA 5IFYA 3RMWA 5FU8A 1TZFA 2PX7A 5EJZA 1SS9A 2W0VA 5J49A 3PNNA 1VH1A 2QKXA 1MC3A 1VZUA 2RITA 4D11C 1R82A 2VS3A 2YESA 1H7HA 4KXOA 2RJ7A 3OC9A 3I0CA 3Q4SA 4KT7A 3SXCA 2UX8A 4G3QA 1LZ7A 4FRDA 2X65A 1FGXA 4B4MA 1WT3A 4O6NA 4D11A 3JUJA 3V0PA 3USQA 2E8BA 3OH0A 1JV1A 4NALA 5CMHA 3KIAA 5C3AA 2OI7A 1TW5A 5C4DA 5IDSA 5C1LA 5FU0A 4D0TA 2J0BA 1FXJA 4KC2A 3SX5A 4EE4A 5I1FA 1LL3A 1TW1A 5CMFX 2RJ4A 4HO3A 1JVGA 4YS8A 4BMAA 3SX3A 4FCUA 4L41C 4FROA 1VICA 1NF5B 3I0LA 1FR9A 1GQCA 3CKNA 5EIYA 2VD4A 4KC1A 5CQOA 2JCKA 3ZF8A 2YC5A 4CJBA 4GBPA 2J0AA 5C3BA 1FRWA 1KWSA 1R80A 1E5KA 4DECA 1VH3A 3LW6A 4HOCA 3SXEA 2AH9A 2PA4A 2AM5A 3I0JA 3PKPA 4HO9A 2Y6PA 5CMGX 2RJ0A 4FRLA 2QH5A 4Y7FA 1OQMB 1H5RA 5C38A 1G0RA 1R7VA 4HO5A 2Z87A 4FREA 4Y7VA 4ECMA 4Q7CA 2Y4MA 2P72A 3U2TA 1H7TA 3I0GA 1NMMB 4G3SA 1YROB 2BO8A 2RJ6A 1FO9A 2Y4JA 1H5TB 1VGZA 5CQPA 1FGGA 3ZLLA 2YQJA 3OH3A 2AECA 2I7BA 4ZDQA 2X5SA 3CKOA 3RMVA 1LL2A 3HL3A 4B3UA 1HM8A 2WAWA 3U0XA 4B4BA 2WVLA 2A8WA 1VZXA 1G93A 1VGWA 4AC3A 1ZHJA 1OMZA 4JISA 5C47A 5L6SA 1WSZA 2E3DA 4E1KA 4HG6A 3V0QA 1EZIA 3R2WA 4IRPA 4KNXA 2ICXA 5DDTA 2GGOA 1NHEB 2O1HA 3POLA 1GX4A 1H5SC 3QVBA 4M4KA 2ZU9A 4MIXA 1O0RA 2D0JA 1O7OA 5C48A 4UEGA 3SXDA 1HM9A 3SX8A 4HO2A 1H5SA 4EEAA 1JYKA 5AJPA 2AM4A 2BO6A 5L6VA 2Z86A 1O7QA 1EYRA 3SXBA 1H4CA 4Y6NA 1FWYA 2WEEA 1R7XA 5D91A 2PGYA 1FZWA 4Y6UA 1G8OA 1G2VA 1FOAA 3SXAA 4FRPA 3TQDA 4FRQA 4CJ8A 3FOQA 3CGXA 2YCMA 1H4DA 1ZJPA 3GUEA 1WT1A 3OAMA 5FYEA 4FQWA 3IOJA 1VPAA 1G23A 2RIYA 2VS4A 1TVYA 1K4VA 1HV9A 2APCA 2W0WA 3RSBA 2WVMA 3D5NA 3SXGA 2C0NA 4M2BA 1YP3A 2Y7AA 3CKJA 3I0HA 4Y7UA 1MP5A 1VM8A 2XMHA 2CU2A 1H7QA 2YC3A 4C2SA 2YQHA 4LW6A 4NAKA 4B42A 4P00A 2V0KA 4FIXA 1H7LA
chains in the Genus database with same CATH topology
3T7MA 4EE3A 1ZI4A 3OH2A 2BO4A 3BCVA 2OI5A 1V83A 5FV9A 5HS2A 2OEGA 2QGIA 4LW3A 1FG5N 2AESA 2FYCB 1FXOA 1H4EA 1S4NA 5C8RA 1H3MA 1W77A 1XZ6A 2V0IA 2VXMA 1VGUA 4AYJA 5C4BA 2P6WA 1H5RB 3EE5A 2D7IA 2V0HA 4EE5A 3OH4A 4MNDA 3I0FA 5CQMX 4EEMA 4EEGA 1HJJA 2YQCA 3ZGGA 4B2XA 3E26A 4AYLA 2RJ1A 2Q4JA 3V0NA 1R7TA 1H7FA 1JV3A 2VSHA 2VSIA 4Y7TA 4ASYA 4D0ZA 3I0IX 3JUKA 2X60A 4G3PA 1HM0A 4CVHA 2RJ9A 5CMIA 4KNRA 1I52A 1FR8A 4AAWA 1R7UA 3T7OA 4DE7A 4J18A 2WGZA 5AJOA 3V90A 3DJ4A 2ZU8A 4M2AA 2RJ5A 2ICYA 4CJCA 3E25A 5DDVA 5CMJA 1ZCVA 1ZJ0A 4FRMA 5C1HA 4EEOA 5AJNA 1ZCUA 3D98A 4B5BA 2FFVA 3TZTA 2WE9A 3OKRA 5D92A 1WVCA 2PGVA 2P73A 4Y7GA 4ARWA 3F1CA 4NAIA 4FCEA 3U2UA 4P02A 5C36A 2V0LA 1YP2A 2VS5A 1INIA 1QGSA 1JYLA 2JCJA 4NANA 2FYDB 4MYBA 2RJ8A 4M28A 1ZJ3A 2DPWA 3PKQA 1NKHB 5FTVA 2YQSA 3K8DA 1ZI1A 5FTSA 1OMXA 3V0OA 2MZBA 3V0MA 1XHBA 4B4GA 1LZ0A 1H5SB 4FRBA 3USRA 1ZJOA 3V91A 2I5KA 1FO8A 2Y4KA 1G97A 4IRQA 3I0EA 3I0KA 3NGWA 3U2WA 4Y9XA 1ZDFA 4XWIA 3FWWA 1H5SD 5IDTA 4Y64A 1GWWA 2XWLA 5C3DA 1WT2A 1QGQA 3OH1A 5CQNX 4BQHA 4HO6A 1R7YA 2OEFA 2FYBA 3U2XA 5C4EA 1NWGB 2FFUA 4FRAA 3I0DA 1YP4A 3OGZA 5JQQA 4EVWA 1LL0A 4FRHA 4HO8A 1WT0A 1PZTA 1G3LA 3IOHA 2VXLA 4D48A 3DUVA 4ASJA 1MP4A 4Y63A 3BRKX 1VGTA 1GWVA 1O23B 3JTJA 1G95A 1PZYB 2D7RA 1ZJ2A 1QG8A 3D8VA 1ZDGA 1HJLA 1Z90A 2Y4LA 1GX0A 2WVKA 4K6RA 3ST8A 1QWJA 3R3IA 2GGQA 1ZI5A 2RIZA 5C4CA 1S4OA 4HCQA 4HO4A 3CU0A 1S4PA 2XWMA 2NXVA 1W55A 2XMEA 3SX7A 3ZGFA 3SPTA 3Q7UA 3U0YA 1G9RA 1ON8A 4B2WA 2FY7A 3N9WA 1NQIB 3T7NA 5C4FA 1G1LA 1H5TA 1ZCTA 1GA8A 4DDZA 1GQ9A 1MP3A 4KC4A 3F1YA 3O3PA 1IINA 1LVWA 1ZJ1A 2O1FA 1ZI3A 2O1GA 1VZTA 2VK9A 5CQLX 2A8UA 3Q80A 1R81A 4Y62A 4JD0A 1ON6A 1V84A 3U2VA 5FUHA 1LZJA 4O6MA 1ZCYA 2BO7A 3ZLKA 2OI6A 2VFZA 5EJ1A 1V82A 2XWNA 2RIXA 3DK5A 1H7GA 4KPXA 4KPZA 2JCLA 2FYAA 4FIYA 5C1GA 3V0LA 4KRVA 3V8YA 1LZIA 4R7PA 2AGDA 4KQLA 3IOIA 2JCOA 1ZIZA 4HO0A 2AM3A 2I5EA 2AE7A 2ZU7A 3K8EA 3CKVA 5BXCA 4G87A 3CKQA 2X5ZA 1INJA 1IIMA 2V0JA 1W57A 3V8ZA 1JVDA 5C49A 1H7EA 5IFYA 3RMWA 5FU8A 1TZFA 2PX7A 5EJZA 1SS9A 2W0VA 5J49A 3PNNA 1VH1A 2QKXA 1MC3A 1VZUA 2RITA 4D11C 1R82A 2VS3A 2YESA 1H7HA 4KXOA 2RJ7A 3OC9A 3I0CA 3Q4SA 4KT7A 3SXCA 2UX8A 4G3QA 1LZ7A 4FRDA 2X65A 1FGXA 4B4MA 1WT3A 4O6NA 4D11A 3JUJA 3V0PA 3USQA 2E8BA 3OH0A 1JV1A 4NALA 5CMHA 3KIAA 5C3AA 2OI7A 1TW5A 5C4DA 5IDSA 5C1LA 5FU0A 4D0TA 2J0BA 1FXJA 4KC2A 3SX5A 4EE4A 5I1FA 1LL3A 1TW1A 5CMFX 2RJ4A 4HO3A 1JVGA 4YS8A 4BMAA 3SX3A 4FCUA 4L41C 4FROA 1VICA 1NF5B 3I0LA 1FR9A 1GQCA 3CKNA 5EIYA 2VD4A 4KC1A 5CQOA 2JCKA 3ZF8A 2YC5A 4CJBA 4GBPA 2J0AA 5C3BA 1FRWA 1KWSA 1R80A 1E5KA 4DECA 1VH3A 3LW6A 4HOCA 3SXEA 2AH9A 2PA4A 2AM5A 3I0JA 3PKPA 4HO9A 2Y6PA 5CMGX 2RJ0A 4FRLA 2QH5A 4Y7FA 1OQMB 1H5RA 5C38A 1G0RA 1R7VA 4HO5A 2Z87A 4FREA 4Y7VA 4ECMA 4Q7CA 2Y4MA 2P72A 3U2TA 1H7TA 3I0GA 1NMMB 4G3SA 1YROB 2BO8A 2RJ6A 1FO9A 2Y4JA 1H5TB 1VGZA 5CQPA 1FGGA 3ZLLA 2YQJA 3OH3A 2AECA 2I7BA 4ZDQA 2X5SA 3CKOA 3RMVA 1LL2A 3HL3A 4B3UA 1HM8A 2WAWA 3U0XA 4B4BA 2WVLA 2A8WA 1VZXA 1G93A 1VGWA 4AC3A 1ZHJA 1OMZA 4JISA 5C47A 5L6SA 1WSZA 2E3DA 4E1KA 4HG6A 3V0QA 1EZIA 3R2WA 4IRPA 4KNXA 2ICXA 5DDTA 2GGOA 1NHEB 2O1HA 3POLA 1GX4A 1H5SC 3QVBA 4M4KA 2ZU9A 4MIXA 1O0RA 2D0JA 1O7OA 5C48A 4UEGA 3SXDA 1HM9A 3SX8A 4HO2A 1H5SA 4EEAA 1JYKA 5AJPA 2AM4A 2BO6A 5L6VA 2Z86A 1O7QA 1EYRA 3SXBA 1H4CA 4Y6NA 1FWYA 2WEEA 1R7XA 5D91A 2PGYA 1FZWA 4Y6UA 1G8OA 1G2VA 1FOAA 3SXAA 4FRPA 3TQDA 4FRQA 4CJ8A 3FOQA 3CGXA 2YCMA 1H4DA 1ZJPA 3GUEA 1WT1A 3OAMA 5FYEA 4FQWA 3IOJA 1VPAA 1G23A 2RIYA 2VS4A 1TVYA 1K4VA 1HV9A 2APCA 2W0WA 3RSBA 2WVMA 3D5NA 3SXGA 2C0NA 4M2BA 1YP3A 2Y7AA 3CKJA 3I0HA 4Y7UA 1MP5A 1VM8A 2XMHA 2CU2A 1H7QA 2YC3A 4C2SA 2YQHA 4LW6A 4NAKA 4B42A 4P00A 2V0KA 4FIXA 1H7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T7M A;  4EE3 A;  1ZI4 A;  3OH2 A;  2BO4 A;  3BCV A;  2OI5 A;  1V83 A;  5FV9 A;  5HS2 A;  2OEG A;  2QGI A;  4LW3 A;  1FG5 N;  2AES A;  2FYC B;  1FXO A;  1H4E A;  1S4N A;  5C8R A;  1H3M A;  1W77 A;  1XZ6 A;  2V0I A;  2VXM A;  1VGU A;  4AYJ A;  5C4B A;  2P6W A;  1H5R B;  3EE5 A;  2D7I A;  2V0H A;  4EE5 A;  3OH4 A;  4MND A;  3I0F A;  5CQM X;  4EEM A;  4EEG A;  1HJJ A;  2YQC A;  3ZGG A;  4B2X A;  3E26 A;  4AYL A;  2RJ1 A;  2Q4J A;  3V0N A;  1R7T A;  1H7F A;  1JV3 A;  2VSH A;  2VSI A;  4Y7T A;  4ASY A;  4D0Z A;  3I0I X;  3JUK A;  2X60 A;  4G3P A;  1HM0 A;  4CVH A;  2RJ9 A;  5CMI A;  4KNR A;  1I52 A;  1FR8 A;  4AAW A;  1R7U A;  3T7O A;  4DE7 A;  4J18 A;  2WGZ A;  5AJO A;  3V90 A;  3DJ4 A;  2ZU8 A;  4M2A A;  2RJ5 A;  2ICY A;  4CJC A;  3E25 A;  5DDV A;  5CMJ A;  1ZCV A;  1ZJ0 A;  4FRM A;  5C1H A;  4EEO A;  5AJN A;  1ZCU A;  3D98 A;  4B5B A;  2FFV A;  3TZT A;  2WE9 A;  3OKR A;  1WVC A;  2PGV A;  2P73 A;  4Y7G A;  4ARW A;  3F1C A;  4NAI A;  4FCE A;  3U2U A;  4P02 A;  5C36 A;  2V0L A;  1YP2 A;  2VS5 A;  1INI A;  1QGS A;  1JYL A;  2JCJ A;  4NAN A;  2FYD B;  4MYB A;  2RJ8 A;  4M28 A;  1ZJ3 A;  2DPW A;  3PKQ A;  1NKH B;  5FTV A;  2YQS A;  3K8D A;  1ZI1 A;  5FTS A;  1OMX A;  3V0O A;  2MZB A;  3V0M A;  1XHB A;  4B4G A;  1LZ0 A;  1H5S B;  4FRB A;  3USR A;  1ZJO A;  3V91 A;  2I5K A;  1FO8 A;  2Y4K A;  1G97 A;  4IRQ A;  3I0E A;  3I0K A;  3NGW A;  3U2W A;  4Y9X A;  1ZDF A;  4XWI A;  3FWW A;  1H5S D;  5IDT A;  4Y64 A;  1GWW A;  2XWL A;  5C3D A;  1WT2 A;  1QGQ A;  3OH1 A;  5CQN X;  4BQH A;  4HO6 A;  1R7Y A;  2OEF A;  2FYB A;  3U2X A;  5C4E A;  1NWG B;  2FFU A;  4FRA A;  3I0D A;  1YP4 A;  3OGZ A;  5JQQ A;  4EVW A;  1LL0 A;  4FRH A;  4HO8 A;  1WT0 A;  1PZT A;  1G3L A;  3IOH A;  2VXL A;  4D48 A;  3DUV A;  4ASJ A;  1MP4 A;  4Y63 A;  3BRK X;  1VGT A;  1GWV A;  1O23 B;  3JTJ A;  1G95 A;  1PZY B;  2D7R A;  1ZJ2 A;  1QG8 A;  3D8V A;  1ZDG A;  1HJL A;  1Z90 A;  2Y4L A;  1GX0 A;  2WVK A;  4K6R A;  3ST8 A;  1QWJ A;  3R3I A;  2GGQ A;  1ZI5 A;  2RIZ A;  5C4C A;  1S4O A;  4HCQ A;  4HO4 A;  3CU0 A;  1S4P A;  2XWM A;  2NXV A;  1W55 A;  2XME A;  3SX7 A;  3ZGF A;  3SPT A;  3Q7U A;  3U0Y A;  1G9R A;  1ON8 A;  4B2W A;  2FY7 A;  3N9W A;  1NQI B;  3T7N A;  5C4F A;  1G1L A;  1H5T A;  1ZCT A;  1GA8 A;  4DDZ A;  1GQ9 A;  1MP3 A;  4KC4 A;  3F1Y A;  3O3P A;  1IIN A;  1LVW A;  1ZJ1 A;  2O1F A;  1ZI3 A;  2O1G A;  1VZT A;  5CQL X;  2A8U A;  3Q80 A;  1R81 A;  4Y62 A;  4JD0 A;  1ON6 A;  1V84 A;  3U2V A;  5FUH A;  1LZJ A;  1ZCY A;  2BO7 A;  3ZLK A;  2OI6 A;  2VFZ A;  5EJ1 A;  1V82 A;  2XWN A;  2RIX A;  3DK5 A;  1H7G A;  4KPX A;  4KPZ A;  2JCL A;  2FYA A;  5C1G A;  3V0L A;  4KRV A;  3V8Y A;  1LZI A;  4R7P A;  2AGD A;  4KQL A;  3IOI A;  2JCO A;  1ZIZ A;  4HO0 A;  2AM3 A;  2I5E A;  2AE7 A;  2ZU7 A;  3K8E A;  3CKV A;  5BXC A;  4G87 A;  3CKQ A;  2X5Z A;  1INJ A;  1IIM A;  2V0J A;  1W57 A;  3V8Z A;  1JVD A;  5C49 A;  1H7E A;  5IFY A;  3RMW A;  5FU8 A;  1TZF A;  2PX7 A;  5EJZ A;  1SS9 A;  2W0V A;  5J49 A;  3PNN A;  1VH1 A;  2QKX A;  1MC3 A;  1VZU A;  2RIT A;  4D11 C;  1R82 A;  2VS3 A;  2YES A;  1H7H A;  4KXO A;  2RJ7 A;  3OC9 A;  3I0C A;  3Q4S A;  4KT7 A;  3SXC A;  2UX8 A;  4G3Q A;  1LZ7 A;  4FRD A;  2X65 A;  1FGX A;  4B4M A;  1WT3 A;  4D11 A;  3JUJ A;  3V0P A;  3USQ A;  2E8B A;  3OH0 A;  1JV1 A;  4NAL A;  5CMH A;  3KIA A;  5C3A A;  2OI7 A;  1TW5 A;  5C4D A;  5IDS A;  5C1L A;  5FU0 A;  4D0T A;  4KC2 A;  1FXJ A;  3SX5 A;  4EE4 A;  5I1F A;  1LL3 A;  1TW1 A;  5CMF X;  2RJ4 A;  4HO3 A;  1JVG A;  4YS8 A;  4BMA A;  3SX3 A;  4FCU A;  4L41 C;  4FRO A;  1VIC A;  1NF5 B;  3I0L A;  1FR9 A;  1GQC A;  3CKN A;  5EIY A;  2VD4 A;  4KC1 A;  5CQO A;  2JCK A;  3ZF8 A;  2YC5 A;  4CJB A;  4GBP A;  5C3B A;  1FRW A;  1KWS A;  1R80 A;  1E5K A;  4DEC A;  1VH3 A;  3LW6 A;  4HOC A;  3SXE A;  2AH9 A;  2PA4 A;  2AM5 A;  3I0J A;  3PKP A;  4HO9 A;  2Y6P A;  5CMG X;  2RJ0 A;  4FRL A;  2QH5 A;  4Y7F A;  1OQM B;  1H5R A;  5C38 A;  1G0R A;  1R7V A;  4HO5 A;  2Z87 A;  4FRE A;  4Y7V A;  4ECM A;  2Y4M A;  2P72 A;  3U2T A;  1H7T A;  3I0G A;  1NMM B;  4G3S A;  1YRO B;  2BO8 A;  2RJ6 A;  1FO9 A;  2Y4J A;  1H5T B;  1VGZ A;  5CQP A;  1FGG A;  3ZLL A;  2YQJ A;  3OH3 A;  2AEC A;  2I7B A;  4ZDQ A;  2X5S A;  3CKO A;  3RMV A;  1LL2 A;  3HL3 A;  4B3U A;  1HM8 A;  2WAW A;  3U0X A;  4B4B A;  2WVL A;  2A8W A;  1VZX A;  1G93 A;  1VGW A;  4AC3 A;  1ZHJ A;  1OMZ A;  4JIS A;  5C47 A;  5L6S A;  1WSZ A;  2E3D A;  4E1K A;  4HG6 A;  3V0Q A;  1EZI A;  3R2W A;  4IRP A;  4KNX A;  2ICX A;  5DDT A;  2GGO A;  1NHE B;  2O1H A;  3POL A;  1GX4 A;  1H5S C;  3QVB A;  4M4K A;  2ZU9 A;  1O0R A;  2D0J A;  1O7O A;  5C48 A;  4UEG A;  3SXD A;  1HM9 A;  3SX8 A;  4HO2 A;  1H5S A;  4EEA A;  1JYK A;  5AJP A;  2AM4 A;  2BO6 A;  5L6V A;  2Z86 A;  1O7Q A;  1EYR A;  3SXB A;  1H4C A;  4Y6N A;  1FWY A;  2WEE A;  1R7X A;  2PGY A;  1FZW A;  4Y6U A;  1G8O A;  1G2V A;  1FOA A;  3SXA A;  4FRP A;  3TQD A;  4FRQ A;  4CJ8 A;  3FOQ A;  3CGX A;  2YCM A;  1H4D A;  1ZJP A;  3GUE A;  1WT1 A;  3OAM A;  5FYE A;  4FQW A;  3IOJ A;  1VPA A;  1G23 A;  2RIY A;  2VS4 A;  1TVY A;  1K4V A;  1HV9 A;  2APC A;  2W0W A;  3RSB A;  2WVM A;  3D5N A;  3SXG A;  4M2B A;  1YP3 A;  2Y7A A;  3CKJ A;  3I0H A;  4Y7U A;  1MP5 A;  1VM8 A;  2XMH A;  2CU2 A;  1H7Q A;  2YC3 A;  4C2S A;  2YQH A;  4LW6 A;  4NAK A;  4B42 A;  4P00 A;  2V0K A;  1H7L A; 
#chains in the Genus database with same CATH topology
 3T7M A;  4EE3 A;  1ZI4 A;  3OH2 A;  2BO4 A;  3BCV A;  2OI5 A;  1V83 A;  5FV9 A;  5HS2 A;  2OEG A;  2QGI A;  4LW3 A;  1FG5 N;  2AES A;  2FYC B;  1FXO A;  1H4E A;  1S4N A;  5C8R A;  1H3M A;  1W77 A;  1XZ6 A;  2V0I A;  2VXM A;  1VGU A;  4AYJ A;  5C4B A;  2P6W A;  1H5R B;  3EE5 A;  2D7I A;  2V0H A;  4EE5 A;  3OH4 A;  4MND A;  3I0F A;  5CQM X;  4EEM A;  4EEG A;  1HJJ A;  2YQC A;  3ZGG A;  4B2X A;  3E26 A;  4AYL A;  2RJ1 A;  2Q4J A;  3V0N A;  1R7T A;  1H7F A;  1JV3 A;  2VSH A;  2VSI A;  4Y7T A;  4ASY A;  4D0Z A;  3I0I X;  3JUK A;  2X60 A;  4G3P A;  1HM0 A;  4CVH A;  2RJ9 A;  5CMI A;  4KNR A;  1I52 A;  1FR8 A;  4AAW A;  1R7U A;  3T7O A;  4DE7 A;  4J18 A;  2WGZ A;  5AJO A;  3V90 A;  3DJ4 A;  2ZU8 A;  4M2A A;  2RJ5 A;  2ICY A;  4CJC A;  3E25 A;  5DDV A;  5CMJ A;  1ZCV A;  1ZJ0 A;  4FRM A;  5C1H A;  4EEO A;  5AJN A;  1ZCU A;  3D98 A;  4B5B A;  2FFV A;  3TZT A;  2WE9 A;  3OKR A;  5D92 A;  1WVC A;  2PGV A;  2P73 A;  4Y7G A;  4ARW A;  3F1C A;  4NAI A;  4FCE A;  3U2U A;  4P02 A;  5C36 A;  2V0L A;  1YP2 A;  2VS5 A;  1INI A;  1QGS A;  1JYL A;  2JCJ A;  4NAN A;  2FYD B;  4MYB A;  2RJ8 A;  4M28 A;  1ZJ3 A;  2DPW A;  3PKQ A;  1NKH B;  5FTV A;  2YQS A;  3K8D A;  1ZI1 A;  5FTS A;  1OMX A;  3V0O A;  2MZB A;  3V0M A;  1XHB A;  4B4G A;  1LZ0 A;  1H5S B;  4FRB A;  3USR A;  1ZJO A;  3V91 A;  2I5K A;  1FO8 A;  2Y4K A;  1G97 A;  4IRQ A;  3I0E A;  3I0K A;  3NGW A;  3U2W A;  4Y9X A;  1ZDF A;  4XWI A;  3FWW A;  1H5S D;  5IDT A;  4Y64 A;  1GWW A;  2XWL A;  5C3D A;  1WT2 A;  1QGQ A;  3OH1 A;  5CQN X;  4BQH A;  4HO6 A;  1R7Y A;  2OEF A;  2FYB A;  3U2X A;  5C4E A;  1NWG B;  2FFU A;  4FRA A;  3I0D A;  1YP4 A;  3OGZ A;  5JQQ A;  4EVW A;  1LL0 A;  4FRH A;  4HO8 A;  1WT0 A;  1PZT A;  1G3L A;  3IOH A;  2VXL A;  4D48 A;  3DUV A;  4ASJ A;  1MP4 A;  4Y63 A;  3BRK X;  1VGT A;  1GWV A;  1O23 B;  3JTJ A;  1G95 A;  1PZY B;  2D7R A;  1ZJ2 A;  1QG8 A;  3D8V A;  1ZDG A;  1HJL A;  1Z90 A;  2Y4L A;  1GX0 A;  2WVK A;  4K6R A;  3ST8 A;  1QWJ A;  3R3I A;  2GGQ A;  1ZI5 A;  2RIZ A;  5C4C A;  1S4O A;  4HCQ A;  4HO4 A;  3CU0 A;  1S4P A;  2XWM A;  2NXV A;  1W55 A;  2XME A;  3SX7 A;  3ZGF A;  3SPT A;  3Q7U A;  3U0Y A;  1G9R A;  1ON8 A;  4B2W A;  2FY7 A;  3N9W A;  1NQI B;  3T7N A;  5C4F A;  1G1L A;  1H5T A;  1ZCT A;  1GA8 A;  4DDZ A;  1GQ9 A;  1MP3 A;  4KC4 A;  3F1Y A;  3O3P A;  1IIN A;  1LVW A;  1ZJ1 A;  2O1F A;  1ZI3 A;  2O1G A;  1VZT A;  2VK9 A;  5CQL X;  2A8U A;  3Q80 A;  1R81 A;  4Y62 A;  4JD0 A;  1ON6 A;  1V84 A;  3U2V A;  5FUH A;  1LZJ A;  4O6M A;  1ZCY A;  2BO7 A;  3ZLK A;  2OI6 A;  2VFZ A;  5EJ1 A;  1V82 A;  2XWN A;  2RIX A;  3DK5 A;  1H7G A;  4KPX A;  4KPZ A;  2JCL A;  2FYA A;  4FIY A;  5C1G A;  3V0L A;  4KRV A;  3V8Y A;  1LZI A;  4R7P A;  2AGD A;  4KQL A;  3IOI A;  2JCO A;  1ZIZ A;  4HO0 A;  2AM3 A;  2I5E A;  2AE7 A;  2ZU7 A;  3K8E A;  3CKV A;  5BXC A;  4G87 A;  3CKQ A;  2X5Z A;  1INJ A;  1IIM A;  2V0J A;  1W57 A;  3V8Z A;  1JVD A;  5C49 A;  1H7E A;  5IFY A;  3RMW A;  5FU8 A;  1TZF A;  2PX7 A;  5EJZ A;  1SS9 A;  2W0V A;  5J49 A;  3PNN A;  1VH1 A;  2QKX A;  1MC3 A;  1VZU A;  2RIT A;  4D11 C;  1R82 A;  2VS3 A;  2YES A;  1H7H A;  4KXO A;  2RJ7 A;  3OC9 A;  3I0C A;  3Q4S A;  4KT7 A;  3SXC A;  2UX8 A;  4G3Q A;  1LZ7 A;  4FRD A;  2X65 A;  1FGX A;  4B4M A;  1WT3 A;  4O6N A;  4D11 A;  3JUJ A;  3V0P A;  3USQ A;  2E8B A;  3OH0 A;  1JV1 A;  4NAL A;  5CMH A;  3KIA A;  5C3A A;  2OI7 A;  1TW5 A;  5C4D A;  5IDS A;  5C1L A;  5FU0 A;  4D0T A;  2J0B A;  1FXJ A;  4KC2 A;  3SX5 A;  4EE4 A;  5I1F A;  1LL3 A;  1TW1 A;  5CMF X;  2RJ4 A;  4HO3 A;  1JVG A;  4YS8 A;  4BMA A;  3SX3 A;  4FCU A;  4L41 C;  4FRO A;  1VIC A;  1NF5 B;  3I0L A;  1FR9 A;  1GQC A;  3CKN A;  5EIY A;  2VD4 A;  4KC1 A;  5CQO A;  2JCK A;  3ZF8 A;  2YC5 A;  4CJB A;  4GBP A;  2J0A A;  5C3B A;  1FRW A;  1KWS A;  1R80 A;  1E5K A;  4DEC A;  1VH3 A;  3LW6 A;  4HOC A;  3SXE A;  2AH9 A;  2PA4 A;  2AM5 A;  3I0J A;  3PKP A;  4HO9 A;  2Y6P A;  5CMG X;  2RJ0 A;  4FRL A;  2QH5 A;  4Y7F A;  1OQM B;  1H5R A;  5C38 A;  1G0R A;  1R7V A;  4HO5 A;  2Z87 A;  4FRE A;  4Y7V A;  4ECM A;  4Q7C A;  2Y4M A;  2P72 A;  3U2T A;  1H7T A;  3I0G A;  1NMM B;  4G3S A;  1YRO B;  2BO8 A;  2RJ6 A;  1FO9 A;  2Y4J A;  1H5T B;  1VGZ A;  5CQP A;  1FGG A;  3ZLL A;  2YQJ A;  3OH3 A;  2AEC A;  2I7B A;  4ZDQ A;  2X5S A;  3CKO A;  3RMV A;  1LL2 A;  3HL3 A;  4B3U A;  1HM8 A;  2WAW A;  3U0X A;  4B4B A;  2WVL A;  2A8W A;  1VZX A;  1G93 A;  1VGW A;  4AC3 A;  1ZHJ A;  1OMZ A;  4JIS A;  5C47 A;  5L6S A;  1WSZ A;  2E3D A;  4E1K A;  4HG6 A;  3V0Q A;  1EZI A;  3R2W A;  4IRP A;  4KNX A;  2ICX A;  5DDT A;  2GGO A;  1NHE B;  2O1H A;  3POL A;  1GX4 A;  1H5S C;  3QVB A;  4M4K A;  2ZU9 A;  4MIX A;  1O0R A;  2D0J A;  1O7O A;  5C48 A;  4UEG A;  3SXD A;  1HM9 A;  3SX8 A;  4HO2 A;  1H5S A;  4EEA A;  1JYK A;  5AJP A;  2AM4 A;  2BO6 A;  5L6V A;  2Z86 A;  1O7Q A;  1EYR A;  3SXB A;  1H4C A;  4Y6N A;  1FWY A;  2WEE A;  1R7X A;  5D91 A;  2PGY A;  1FZW A;  4Y6U A;  1G8O A;  1G2V A;  1FOA A;  3SXA A;  4FRP A;  3TQD A;  4FRQ A;  4CJ8 A;  3FOQ A;  3CGX A;  2YCM A;  1H4D A;  1ZJP A;  3GUE A;  1WT1 A;  3OAM A;  5FYE A;  4FQW A;  3IOJ A;  1VPA A;  1G23 A;  2RIY A;  2VS4 A;  1TVY A;  1K4V A;  1HV9 A;  2APC A;  2W0W A;  3RSB A;  2WVM A;  3D5N A;  3SXG A;  2C0N A;  4M2B A;  1YP3 A;  2Y7A A;  3CKJ A;  3I0H A;  4Y7U A;  1MP5 A;  1VM8 A;  2XMH A;  2CU2 A;  1H7Q A;  2YC3 A;  4C2S A;  2YQH A;  4LW6 A;  4NAK A;  4B42 A;  4P00 A;  2V0K A;  4FIX A;  1H7L A; 
#chains in the Genus database with same CATH homology
 3T7M A;  4EE3 A;  1ZI4 A;  3OH2 A;  2BO4 A;  3BCV A;  2OI5 A;  1V83 A;  5FV9 A;  5HS2 A;  2OEG A;  2QGI A;  4LW3 A;  1FG5 N;  2AES A;  2FYC B;  1FXO A;  1H4E A;  1S4N A;  5C8R A;  1H3M A;  1W77 A;  1XZ6 A;  2V0I A;  2VXM A;  1VGU A;  4AYJ A;  5C4B A;  2P6W A;  1H5R B;  3EE5 A;  2D7I A;  2V0H A;  4EE5 A;  3OH4 A;  4MND A;  3I0F A;  5CQM X;  4EEM A;  4EEG A;  1HJJ A;  2YQC A;  3ZGG A;  4B2X A;  3E26 A;  4AYL A;  2RJ1 A;  2Q4J A;  3V0N A;  1R7T A;  1H7F A;  1JV3 A;  2VSH A;  2VSI A;  4Y7T A;  4ASY A;  4D0Z A;  3I0I X;  3JUK A;  2X60 A;  4G3P A;  1HM0 A;  4CVH A;  2RJ9 A;  5CMI A;  4KNR A;  1I52 A;  1FR8 A;  4AAW A;  1R7U A;  3T7O A;  4DE7 A;  4J18 A;  2WGZ A;  5AJO A;  3V90 A;  3DJ4 A;  2ZU8 A;  4M2A A;  2RJ5 A;  2ICY A;  4CJC A;  3E25 A;  5DDV A;  5CMJ A;  1ZCV A;  1ZJ0 A;  4FRM A;  5C1H A;  4EEO A;  5AJN A;  1ZCU A;  3D98 A;  4B5B A;  2FFV A;  3TZT A;  2WE9 A;  3OKR A;  5D92 A;  1WVC A;  2PGV A;  2P73 A;  4Y7G A;  4ARW A;  3F1C A;  4NAI A;  4FCE A;  3U2U A;  4P02 A;  5C36 A;  2V0L A;  1YP2 A;  2VS5 A;  1INI A;  1QGS A;  1JYL A;  2JCJ A;  4NAN A;  2FYD B;  4MYB A;  2RJ8 A;  4M28 A;  1ZJ3 A;  2DPW A;  3PKQ A;  1NKH B;  5FTV A;  2YQS A;  3K8D A;  1ZI1 A;  5FTS A;  1OMX A;  3V0O A;  2MZB A;  3V0M A;  1XHB A;  4B4G A;  1LZ0 A;  1H5S B;  4FRB A;  3USR A;  1ZJO A;  3V91 A;  2I5K A;  1FO8 A;  2Y4K A;  1G97 A;  4IRQ A;  3I0E A;  3I0K A;  3NGW A;  3U2W A;  4Y9X A;  1ZDF A;  4XWI A;  3FWW A;  1H5S D;  5IDT A;  4Y64 A;  1GWW A;  2XWL A;  5C3D A;  1WT2 A;  1QGQ A;  3OH1 A;  5CQN X;  4BQH A;  4HO6 A;  1R7Y A;  2OEF A;  2FYB A;  3U2X A;  5C4E A;  1NWG B;  2FFU A;  4FRA A;  3I0D A;  1YP4 A;  3OGZ A;  5JQQ A;  4EVW A;  1LL0 A;  4FRH A;  4HO8 A;  1WT0 A;  1PZT A;  1G3L A;  3IOH A;  2VXL A;  4D48 A;  3DUV A;  4ASJ A;  1MP4 A;  4Y63 A;  3BRK X;  1VGT A;  1GWV A;  1O23 B;  3JTJ A;  1G95 A;  1PZY B;  2D7R A;  1ZJ2 A;  1QG8 A;  3D8V A;  1ZDG A;  1HJL A;  1Z90 A;  2Y4L A;  1GX0 A;  2WVK A;  4K6R A;  3ST8 A;  1QWJ A;  3R3I A;  2GGQ A;  1ZI5 A;  2RIZ A;  5C4C A;  1S4O A;  4HCQ A;  4HO4 A;  3CU0 A;  1S4P A;  2XWM A;  2NXV A;  1W55 A;  2XME A;  3SX7 A;  3ZGF A;  3SPT A;  3Q7U A;  3U0Y A;  1G9R A;  1ON8 A;  4B2W A;  2FY7 A;  3N9W A;  1NQI B;  3T7N A;  5C4F A;  1G1L A;  1H5T A;  1ZCT A;  1GA8 A;  4DDZ A;  1GQ9 A;  1MP3 A;  4KC4 A;  3F1Y A;  3O3P A;  1IIN A;  1LVW A;  1ZJ1 A;  2O1F A;  1ZI3 A;  2O1G A;  1VZT A;  2VK9 A;  5CQL X;  2A8U A;  3Q80 A;  1R81 A;  4Y62 A;  4JD0 A;  1ON6 A;  1V84 A;  3U2V A;  5FUH A;  1LZJ A;  4O6M A;  1ZCY A;  2BO7 A;  3ZLK A;  2OI6 A;  2VFZ A;  5EJ1 A;  1V82 A;  2XWN A;  2RIX A;  3DK5 A;  1H7G A;  4KPX A;  4KPZ A;  2JCL A;  2FYA A;  4FIY A;  5C1G A;  3V0L A;  4KRV A;  3V8Y A;  1LZI A;  4R7P A;  2AGD A;  4KQL A;  3IOI A;  2JCO A;  1ZIZ A;  4HO0 A;  2AM3 A;  2I5E A;  2AE7 A;  2ZU7 A;  3K8E A;  3CKV A;  5BXC A;  4G87 A;  3CKQ A;  2X5Z A;  1INJ A;  1IIM A;  2V0J A;  1W57 A;  3V8Z A;  1JVD A;  5C49 A;  1H7E A;  5IFY A;  3RMW A;  5FU8 A;  1TZF A;  2PX7 A;  5EJZ A;  1SS9 A;  2W0V A;  5J49 A;  3PNN A;  1VH1 A;  2QKX A;  1MC3 A;  1VZU A;  2RIT A;  4D11 C;  1R82 A;  2VS3 A;  2YES A;  1H7H A;  4KXO A;  2RJ7 A;  3OC9 A;  3I0C A;  3Q4S A;  4KT7 A;  3SXC A;  2UX8 A;  4G3Q A;  1LZ7 A;  4FRD A;  2X65 A;  1FGX A;  4B4M A;  1WT3 A;  4O6N A;  4D11 A;  3JUJ A;  3V0P A;  3USQ A;  2E8B A;  3OH0 A;  1JV1 A;  4NAL A;  5CMH A;  3KIA A;  5C3A A;  2OI7 A;  1TW5 A;  5C4D A;  5IDS A;  5C1L A;  5FU0 A;  4D0T A;  2J0B A;  1FXJ A;  4KC2 A;  3SX5 A;  4EE4 A;  5I1F A;  1LL3 A;  1TW1 A;  5CMF X;  2RJ4 A;  4HO3 A;  1JVG A;  4YS8 A;  4BMA A;  3SX3 A;  4FCU A;  4L41 C;  4FRO A;  1VIC A;  1NF5 B;  3I0L A;  1FR9 A;  1GQC A;  3CKN A;  5EIY A;  2VD4 A;  4KC1 A;  5CQO A;  2JCK A;  3ZF8 A;  2YC5 A;  4CJB A;  4GBP A;  2J0A A;  5C3B A;  1FRW A;  1KWS A;  1R80 A;  1E5K A;  4DEC A;  1VH3 A;  3LW6 A;  4HOC A;  3SXE A;  2AH9 A;  2PA4 A;  2AM5 A;  3I0J A;  3PKP A;  4HO9 A;  2Y6P A;  5CMG X;  2RJ0 A;  4FRL A;  2QH5 A;  4Y7F A;  1OQM B;  1H5R A;  5C38 A;  1G0R A;  1R7V A;  4HO5 A;  2Z87 A;  4FRE A;  4Y7V A;  4ECM A;  4Q7C A;  2Y4M A;  2P72 A;  3U2T A;  1H7T A;  3I0G A;  1NMM B;  4G3S A;  1YRO B;  2BO8 A;  2RJ6 A;  1FO9 A;  2Y4J A;  1H5T B;  1VGZ A;  5CQP A;  1FGG A;  3ZLL A;  2YQJ A;  3OH3 A;  2AEC A;  2I7B A;  4ZDQ A;  2X5S A;  3CKO A;  3RMV A;  1LL2 A;  3HL3 A;  4B3U A;  1HM8 A;  2WAW A;  3U0X A;  4B4B A;  2WVL A;  2A8W A;  1VZX A;  1G93 A;  1VGW A;  4AC3 A;  1ZHJ A;  1OMZ A;  4JIS A;  5C47 A;  5L6S A;  1WSZ A;  2E3D A;  4E1K A;  4HG6 A;  3V0Q A;  1EZI A;  3R2W A;  4IRP A;  4KNX A;  2ICX A;  5DDT A;  2GGO A;  1NHE B;  2O1H A;  3POL A;  1GX4 A;  1H5S C;  3QVB A;  4M4K A;  2ZU9 A;  4MIX A;  1O0R A;  2D0J A;  1O7O A;  5C48 A;  4UEG A;  3SXD A;  1HM9 A;  3SX8 A;  4HO2 A;  1H5S A;  4EEA A;  1JYK A;  5AJP A;  2AM4 A;  2BO6 A;  5L6V A;  2Z86 A;  1O7Q A;  1EYR A;  3SXB A;  1H4C A;  4Y6N A;  1FWY A;  2WEE A;  1R7X A;  5D91 A;  2PGY A;  1FZW A;  4Y6U A;  1G8O A;  1G2V A;  1FOA A;  3SXA A;  4FRP A;  3TQD A;  4FRQ A;  4CJ8 A;  3FOQ A;  3CGX A;  2YCM A;  1H4D A;  1ZJP A;  3GUE A;  1WT1 A;  3OAM A;  5FYE A;  4FQW A;  3IOJ A;  1VPA A;  1G23 A;  2RIY A;  2VS4 A;  1TVY A;  1K4V A;  1HV9 A;  2APC A;  2W0W A;  3RSB A;  2WVM A;  3D5N A;  3SXG A;  2C0N A;  4M2B A;  1YP3 A;  2Y7A A;  3CKJ A;  3I0H A;  4Y7U A;  1MP5 A;  1VM8 A;  2XMH A;  2CU2 A;  1H7Q A;  2YC3 A;  4C2S A;  2YQH A;  4LW6 A;  4NAK A;  4B42 A;  4P00 A;  2V0K A;  4FIX A;  1H7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...