3RMVA

Crystal structure of human glycogenin-1 (gyg1) t83m mutant complexed with manganese and udp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
249
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVMLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSILPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 249
sequence length 263
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3rmvA00
4G3QA 3U0YA 2AECA 2VXLA 1VGUA 1WT2A 5CMHA 1YP4A 1EYRA 1O7QA 1FZWA 1GWVA 1H7FA 3SX5A 3POLA 2D0JA 3ZGGA 4DE7A 1V84A 4KXOA 3TQDA 1FOAA 3I0EA 2V0LA 1XZ6A 1H5SC 2RJ6A 4Y7FA 1ZDGA 2VS4A 3HL3A 3SXCA 2UX8A 1YP3A 2BO6A 4YS8A 1QG8A 4UEGA 1G2VA 2FY7A 2X60A 4NALA 3OH3A 5CMJA 1FRWA 4Y9XA 2RITA 2VXMA 4IRQA 1O23B 1VH3A 2RJ8A 3PKPA 1FWYA 1H5SA 4NAKA 3CKQA 5FU0A 1VZUA 1MP4A 4M2BA 1G93A 1OQMB 5HS2A 4R7PA 5AJPA 2PGYA 1V83A 4KC1A 1PZTA 5C47A 3SXGA 4ASJA 2WAWA 1S4NA 2P72A 4Y7VA 3SX8A 4CJBA 2ICXA 1WVCA 1YROB 1H5RA 2QGIA 3R2WA 3OH4A 5FUHA 4EEGA 4NANA 1HV9A 2BO8A 1VPAA 2APCA 3F1CA 2E8BA 4KC2A 2DPWA 1G95A 5FTVA 2O1HA 4KC4A 2OEFA 2YQJA 2I5EA 2ZU7A 4FRPA 5C49A 4GBPA 2Q4JA 1VGZA 2RJ4A 4FQWA 1H4DA 4HO6A 1ZCTA 2XWNA 4FROA 1G9RA 5EJ1A 3JTJA 2RJ7A 3FOQA 1GQ9A 2Z86A 4EEOA 2YQSA 1ZI1A 2P73A 4FRDA 5FYEA 2I7BA 2XWMA 2V0HA 4M4KA 1R7UA 2FYBA 4KT7A 3V0LA 3SXEA 3V8ZA 5AJOA 4FREA 1VGWA 4FRLA 1VGTA 5CQOA 5BXCA 2JCOA 3I0JA 2GGOA 3Q80A 2AM5A 4FRMA 3T7NA 4AYJA 1R82A 4B2XA 4BMAA 5C1GA 1LZIA 2D7RA 2E3DA 4HO2A 5L6SA 1ZI3A 3PKQA 5L6VA 3V0PA 4ASYA 2YESA 1S4OA 1ZHJA 5C36A 1VZTA 2RJ0A 2AH9A 1G0RA 4KRVA 2YQHA 4Y62A 1GQCA 4KNRA 4HCQA 2NXVA 1INJA 3TZTA 3QVBA 1QGSA 4Y63A 2VS3A 2RJ5A 4KPZA 4HOCA 1G3LA 3CKNA 3I0KA 1LL0A 3CKJA 2X5ZA 3I0CA 2YC5A 5C8RA 1FGXA 3JUJA 4BQHA 1HM9A 2VFZA 1Z90A 3I0HA 5EJZA 4EEAA 2Z87A 3OC9A 1MP3A 4FCEA 3U2XA 2YC3A 1H5TB 1H7LA 1FXOA 3DUVA 2AE7A 4FRAA 3PNNA 2Y4JA 4G3SA 4Y6UA 3K8DA 1G1LA 2O1GA 2V0KA 1R7YA 5C1LA 2AM4A 4Y7UA 1ZJ3A 1MP5A 3ZLKA 4XWIA 3R3IA 2VD4A 2D7IA 2AM3A 2WGZA 4HO9A 5FU8A 5C4EA 1O7OA 4B42A 4Y6NA 3D8VA 1FR9A 3OH0A 3ST8A 3ZLLA 5C38A 5C48A 4B3UA 1ZIZA 3U2UA 1LL2A 5CQPA 5AJNA 1GA8A 2FFVA 2QH5A 1FR8A 2PGVA 4KNXA 2Y4MA 4JISA 3SX7A 2V0IA 1TW5A 3U2WA 1R80A 1G8OA 4HO0A 1H5SB 1V82A 3DK5A 2YCMA 1ZJ2A 4FRQA 5C1HA 2FYCB 3N9WA 2A8UA 1NF5B 1IINA 1ON6A 2OI5A 2WE9A 1H5RB 1JV3A 5CMGX 3IOHA 1VM8A 4E1KA 5C3DA 1H3MA 1JVDA 5FTSA 4B4BA 2AESA 2XMEA 1YP2A 4NAIA 1R7TA 4MNDA 5CMIA 4ZDQA 3CKVA 1HM8A 1LL3A 4G87A 1H4EA 1WT3A 3SXAA 1LZJA 2PA4A 3V0OA 1W57A 1HM0A 3D98A 2BO4A 5J49A 1NHEB 1FG5N 4KQLA 3K8EA 2Y7AA 3JUKA 4FRBA 1PZYB 3T7MA 1WSZA 5JQQA 4EE4A 2WVLA 5CMFX 3I0IX 3V0NA 4D48A 4HO3A 3I0FA 4G3PA 1OMXA 1HJJA 1H4CA 3I0GA 2MZBA 1G23A 4P00A 5CQLX 1ZI5A 3BRKX 3I0LA 2ICYA 1JYLA 1NQIB 3I0DA 3SXBA 4B5BA 2A8WA 3IOIA 1ZCVA 2VS5A 3V90A 5C4CA 1KWSA 1I52A 3OAMA 4C2SA 1LVWA 2Y4LA 4D11C 3SX3A 1H7GA 2CU2A 1GX4A 3OH1A 4L41C 1OMZA 1QGQA 4FRHA 1JYKA 4JD0A 3CGXA 4B4MA 2V0JA 5FV9A 3CU0A 2VSIA 1H5SD 4EVWA 2X65A 4B2WA 4D11A 2JCLA 2JCJA 1SS9A 3RSBA 1H5TA 3E26A 4ECMA 2I5KA 2ZU9A 2Y6PA 1XHBA 1K4VA 1H7QA 2FYAA 3E25A 4D0TA 1JV1A 1FXJA 4FCUA 1INIA 2P6WA 5C4FA 3OH2A 1S4PA 3NGWA 3OKRA 1WT0A 2XMHA 4CJ8A 4CJCA 1NMMB 1R7XA 4M28A 2JCKA 2Y4KA 4M2AA 3USQA 4AYLA 3DJ4A 3ZGFA 4EE5A 5DDTA 4DECA 3D5NA 1LZ0A 4LW6A 2VSHA 1TZFA 2YQCA 5IDTA 2XWLA 1ZI4A 3OGZA 3V8YA 1W77A 4ARWA 3V0MA 4IRPA 2ZU8A 2RJ1A 1FGGA 2WVMA 1FO9A 3FWWA 1TVYA 1VZXA 1H7TA 4HO5A 4AC3A 3U2VA 5C4BA 1GX0A 3IOJA 1WT1A 2AGDA 2FFUA 1NKHB 4KPXA 3SPTA 2GGQA 3RMWA 1ZJ0A 3Q4SA 1W55A 3CKOA 2X5SA 1R7VA 4HG6A 1G97A 2OEGA 4J18A 4EE3A 2QKXA 2WVKA 5C3AA 5I1FA 4Y7TA 5EIYA 2OI7A 3V0QA 5IDSA 1QWJA 3KIAA 4D0ZA 1ZJOA 2RIXA 3T7OA 1LZ7A 2O1FA 1R81A 1IIMA 1JVGA 1H7EA 1ZCUA 1TW1A 5DDVA 3F1YA 2W0VA 2W0WA 3V91A 3RMVA 4K6RA 3ZF8A 5CQNX 3U0XA 4LW3A 1ZCYA 3BCVA 3SXDA 1HJLA 1ZJ1A 5C3BA 1EZIA 4B4GA 2OI6A 1MC3A 4AAWA 2RJ9A 2PX7A 4MYBA 3EE5A 4CVHA 2BO7A 3GUEA 1NWGB 1VICA 2WEEA 4DDZA 3O3PA 1VH1A 1H7HA 4Y7GA 3LW6A 3USRA 2RIZA 5IFYA 1ON8A 4Y64A 1E5KA 4P02A 3U2TA 5CQMX 1O0RA 5C4DA 4HO8A 1FO8A 2RIYA 4EEMA 1ZJPA 3Q7UA 4HO4A 1GWWA 1ZDFA 2FYDB
chains in the Genus database with same CATH superfamily
4G3QA 3U0YA 2AECA 2VXLA 1VGUA 1WT2A 5CMHA 1YP4A 1EYRA 1O7QA 1FZWA 1GWVA 1H7FA 3SX5A 3POLA 2D0JA 3ZGGA 4DE7A 1V84A 4KXOA 3TQDA 1FOAA 3I0EA 2V0LA 1XZ6A 1H5SC 2RJ6A 4Y7FA 1ZDGA 2VS4A 3HL3A 3SXCA 2UX8A 1YP3A 2BO6A 4YS8A 1QG8A 4UEGA 1G2VA 2FY7A 2X60A 4NALA 3OH3A 5CMJA 1FRWA 4O6NA 4FIXA 2RITA 4Y9XA 2VXMA 4IRQA 1O23B 1VH3A 2RJ8A 3PKPA 1FWYA 1H5SA 4NAKA 3CKQA 5FU0A 1VZUA 1MP4A 4M2BA 1G93A 1OQMB 5HS2A 4R7PA 5AJPA 2PGYA 1V83A 4KC1A 1PZTA 5C47A 3SXGA 4ASJA 2WAWA 1S4NA 2P72A 4Y7VA 3SX8A 4CJBA 2ICXA 1WVCA 1YROB 1H5RA 2QGIA 3R2WA 3OH4A 5FUHA 4EEGA 4NANA 1HV9A 2BO8A 1VPAA 2APCA 3F1CA 2E8BA 4KC2A 2DPWA 1G95A 5FTVA 2O1HA 4KC4A 2OEFA 2YQJA 2I5EA 2ZU7A 4FRPA 5C49A 4GBPA 2Q4JA 1VGZA 2RJ4A 4FQWA 1H4DA 4HO6A 1ZCTA 2XWNA 4FROA 1G9RA 5EJ1A 3JTJA 2RJ7A 3FOQA 1GQ9A 2Z86A 4EEOA 2YQSA 1ZI1A 2P73A 4FRDA 5FYEA 2I7BA 2XWMA 2V0HA 4M4KA 1R7UA 2FYBA 4KT7A 3V0LA 3SXEA 3V8ZA 5AJOA 4FREA 1VGWA 4FRLA 1VGTA 5CQOA 5BXCA 2JCOA 3I0JA 2J0AA 2GGOA 3Q80A 2AM5A 4FRMA 3T7NA 4AYJA 1R82A 4B2XA 4BMAA 5C1GA 1LZIA 2D7RA 2E3DA 4HO2A 5L6SA 1ZI3A 3PKQA 5L6VA 3V0PA 4ASYA 2YESA 1S4OA 1ZHJA 5C36A 1VZTA 2RJ0A 2AH9A 1G0RA 4KRVA 2YQHA 4Y62A 1GQCA 4KNRA 4HCQA 2NXVA 1INJA 3TZTA 3QVBA 1QGSA 4Y63A 2VS3A 2RJ5A 2VK9A 4KPZA 4HOCA 1G3LA 3CKNA 3I0KA 1LL0A 3CKJA 2X5ZA 3I0CA 2YC5A 5C8RA 1FGXA 3JUJA 4BQHA 1HM9A 2VFZA 1Z90A 3I0HA 5EJZA 4EEAA 2Z87A 3OC9A 1MP3A 4FCEA 3U2XA 2YC3A 1H5TB 1H7LA 4Q7CA 1FXOA 3DUVA 2AE7A 4FRAA 3PNNA 2Y4JA 4G3SA 4Y6UA 3K8DA 1G1LA 2O1GA 2V0KA 1R7YA 5C1LA 2AM4A 4Y7UA 1ZJ3A 1MP5A 3ZLKA 4XWIA 3R3IA 2VD4A 2D7IA 2AM3A 2WGZA 4HO9A 5FU8A 4MIXA 5C4EA 1O7OA 4B42A 4Y6NA 3D8VA 1FR9A 3OH0A 3ST8A 3ZLLA 5C38A 5C48A 4B3UA 1ZIZA 5D92A 3U2UA 1LL2A 4FIYA 5CQPA 5AJNA 1GA8A 2FFVA 2QH5A 1FR8A 2PGVA 4KNXA 2Y4MA 4JISA 3SX7A 2V0IA 1TW5A 3U2WA 1R80A 1G8OA 4HO0A 1H5SB 1V82A 3DK5A 2YCMA 1ZJ2A 4FRQA 5C1HA 2FYCB 3N9WA 2A8UA 1NF5B 1IINA 1ON6A 2OI5A 4O6MA 2WE9A 1H5RB 1JV3A 5CMGX 3IOHA 1VM8A 4E1KA 5C3DA 1H3MA 1JVDA 5FTSA 4B4BA 2AESA 2XMEA 1YP2A 4NAIA 1R7TA 4MNDA 5CMIA 4ZDQA 3CKVA 1HM8A 1LL3A 4G87A 1H4EA 1WT3A 3SXAA 1LZJA 2PA4A 3V0OA 1W57A 1HM0A 3D98A 2BO4A 5J49A 1NHEB 1FG5N 4KQLA 3K8EA 2Y7AA 3JUKA 4FRBA 1PZYB 3T7MA 1WSZA 5JQQA 4EE4A 2WVLA 5CMFX 3I0IX 3V0NA 4D48A 4HO3A 3I0FA 4G3PA 1OMXA 1HJJA 1H4CA 3I0GA 2MZBA 1G23A 4P00A 5CQLX 1ZI5A 3BRKX 3I0LA 2ICYA 1JYLA 1NQIB 3I0DA 3SXBA 4B5BA 2A8WA 3IOIA 1ZCVA 2VS5A 3V90A 5C4CA 1KWSA 1I52A 3OAMA 4C2SA 1LVWA 2Y4LA 4D11C 3SX3A 1H7GA 2CU2A 1GX4A 3OH1A 4L41C 1OMZA 1QGQA 4FRHA 1JYKA 4JD0A 3CGXA 4B4MA 2V0JA 5FV9A 3CU0A 2VSIA 1H5SD 4EVWA 2X65A 4B2WA 4D11A 2JCLA 2JCJA 1SS9A 3RSBA 1H5TA 3E26A 4ECMA 2I5KA 5D91A 2ZU9A 2Y6PA 1XHBA 1K4VA 1H7QA 2FYAA 2J0BA 3E25A 4D0TA 2C0NA 1JV1A 1FXJA 4FCUA 1INIA 2P6WA 5C4FA 3OH2A 1S4PA 3NGWA 3OKRA 1WT0A 2XMHA 4CJ8A 4CJCA 1NMMB 1R7XA 4M28A 2JCKA 2Y4KA 4M2AA 3USQA 4AYLA 3DJ4A 3ZGFA 4EE5A 5DDTA 4DECA 3D5NA 1LZ0A 4LW6A 2VSHA 1TZFA 2YQCA 5IDTA 2XWLA 1ZI4A 3OGZA 3V8YA 1W77A 4ARWA 3V0MA 4IRPA 2ZU8A 2RJ1A 1FGGA 2WVMA 1FO9A 3FWWA 1TVYA 1VZXA 1H7TA 4HO5A 4AC3A 3U2VA 5C4BA 1GX0A 3IOJA 1WT1A 2AGDA 2FFUA 1NKHB 4KPXA 3SPTA 2GGQA 3RMWA 1ZJ0A 3Q4SA 1W55A 3CKOA 2X5SA 1R7VA 4HG6A 1G97A 2OEGA 4J18A 4EE3A 2QKXA 2WVKA 5C3AA 5I1FA 4Y7TA 5EIYA 2OI7A 3V0QA 5IDSA 1QWJA 3KIAA 4D0ZA 1ZJOA 2RIXA 3T7OA 1LZ7A 2O1FA 1R81A 1IIMA 1JVGA 1H7EA 1ZCUA 1TW1A 5DDVA 3F1YA 2W0VA 2W0WA 3V91A 3RMVA 4K6RA 3ZF8A 5CQNX 3U0XA 4LW3A 1ZCYA 3BCVA 3SXDA 1HJLA 1ZJ1A 5C3BA 1EZIA 4B4GA 2OI6A 1MC3A 4AAWA 2RJ9A 2PX7A 4MYBA 3EE5A 4CVHA 2BO7A 3GUEA 1NWGB 1VICA 2WEEA 4DDZA 3O3PA 1VH1A 1H7HA 4Y7GA 3LW6A 3USRA 2RIZA 5IFYA 1ON8A 4Y64A 1E5KA 4P02A 3U2TA 5CQMX 1O0RA 5C4DA 4HO8A 1FO8A 2RIYA 4EEMA 1ZJPA 3Q7UA 4HO4A 1GWWA 1ZDFA 2FYDB
chains in the Genus database with same CATH topology
4G3QA 3U0YA 2AECA 2VXLA 1VGUA 1WT2A 5CMHA 1YP4A 1EYRA 1O7QA 1FZWA 1GWVA 1H7FA 3SX5A 3POLA 2D0JA 3ZGGA 4DE7A 1V84A 4KXOA 3TQDA 1FOAA 3I0EA 2V0LA 1XZ6A 1H5SC 2RJ6A 4Y7FA 1ZDGA 2VS4A 3HL3A 3SXCA 2UX8A 1YP3A 2BO6A 4YS8A 1QG8A 4UEGA 1G2VA 2FY7A 2X60A 4NALA 3OH3A 5CMJA 1FRWA 4O6NA 4FIXA 2RITA 4Y9XA 2VXMA 4IRQA 1O23B 1VH3A 2RJ8A 3PKPA 1FWYA 1H5SA 4NAKA 3CKQA 5FU0A 1VZUA 1MP4A 4M2BA 1G93A 1OQMB 5HS2A 4R7PA 5AJPA 2PGYA 1V83A 4KC1A 1PZTA 5C47A 3SXGA 4ASJA 2WAWA 1S4NA 2P72A 4Y7VA 3SX8A 4CJBA 2ICXA 1WVCA 1YROB 1H5RA 2QGIA 3R2WA 3OH4A 5FUHA 4EEGA 4NANA 1HV9A 2BO8A 1VPAA 2APCA 3F1CA 2E8BA 4KC2A 2DPWA 1G95A 5FTVA 2O1HA 4KC4A 2OEFA 2YQJA 2I5EA 2ZU7A 4FRPA 5C49A 4GBPA 2Q4JA 1VGZA 2RJ4A 4FQWA 1H4DA 4HO6A 1ZCTA 2XWNA 4FROA 1G9RA 5EJ1A 3JTJA 2RJ7A 3FOQA 1GQ9A 2Z86A 4EEOA 2YQSA 1ZI1A 2P73A 4FRDA 5FYEA 2I7BA 2XWMA 2V0HA 4M4KA 1R7UA 2FYBA 4KT7A 3V0LA 3SXEA 3V8ZA 5AJOA 4FREA 1VGWA 4FRLA 1VGTA 5CQOA 5BXCA 2JCOA 3I0JA 2J0AA 2GGOA 3Q80A 2AM5A 4FRMA 3T7NA 4AYJA 1R82A 4B2XA 4BMAA 5C1GA 1LZIA 2D7RA 2E3DA 4HO2A 5L6SA 1ZI3A 3PKQA 5L6VA 3V0PA 4ASYA 2YESA 1S4OA 1ZHJA 5C36A 1VZTA 2RJ0A 2AH9A 1G0RA 4KRVA 2YQHA 4Y62A 1GQCA 4KNRA 4HCQA 2NXVA 1INJA 3TZTA 3QVBA 1QGSA 4Y63A 2VS3A 2RJ5A 2VK9A 4KPZA 4HOCA 1G3LA 3CKNA 3I0KA 1LL0A 3CKJA 2X5ZA 3I0CA 2YC5A 5C8RA 1FGXA 3JUJA 4BQHA 1HM9A 2VFZA 1Z90A 3I0HA 5EJZA 4EEAA 2Z87A 3OC9A 1MP3A 4FCEA 3U2XA 2YC3A 1H5TB 1H7LA 4Q7CA 1FXOA 3DUVA 2AE7A 4FRAA 3PNNA 2Y4JA 4G3SA 4Y6UA 3K8DA 1G1LA 2O1GA 2V0KA 1R7YA 5C1LA 2AM4A 4Y7UA 1ZJ3A 1MP5A 3ZLKA 4XWIA 3R3IA 2VD4A 2D7IA 2AM3A 2WGZA 4HO9A 5FU8A 4MIXA 5C4EA 1O7OA 4B42A 4Y6NA 3D8VA 1FR9A 3OH0A 3ST8A 3ZLLA 5C38A 5C48A 4B3UA 1ZIZA 5D92A 3U2UA 1LL2A 4FIYA 5CQPA 5AJNA 1GA8A 2FFVA 2QH5A 1FR8A 2PGVA 4KNXA 2Y4MA 4JISA 3SX7A 2V0IA 1TW5A 3U2WA 1R80A 1G8OA 4HO0A 1H5SB 1V82A 3DK5A 2YCMA 1ZJ2A 4FRQA 5C1HA 2FYCB 3N9WA 2A8UA 1NF5B 1IINA 1ON6A 2OI5A 4O6MA 2WE9A 1H5RB 1JV3A 5CMGX 3IOHA 1VM8A 4E1KA 5C3DA 1H3MA 1JVDA 5FTSA 4B4BA 2AESA 2XMEA 1YP2A 4NAIA 1R7TA 4MNDA 5CMIA 4ZDQA 3CKVA 1HM8A 1LL3A 4G87A 1H4EA 1WT3A 3SXAA 1LZJA 2PA4A 3V0OA 1W57A 1HM0A 3D98A 2BO4A 5J49A 1NHEB 1FG5N 4KQLA 3K8EA 2Y7AA 3JUKA 4FRBA 1PZYB 3T7MA 1WSZA 5JQQA 4EE4A 2WVLA 5CMFX 3I0IX 3V0NA 4D48A 4HO3A 3I0FA 4G3PA 1OMXA 1HJJA 1H4CA 3I0GA 2MZBA 1G23A 4P00A 5CQLX 1ZI5A 3BRKX 3I0LA 2ICYA 1JYLA 1NQIB 3I0DA 3SXBA 4B5BA 2A8WA 3IOIA 1ZCVA 2VS5A 3V90A 5C4CA 1KWSA 1I52A 3OAMA 4C2SA 1LVWA 2Y4LA 4D11C 3SX3A 1H7GA 2CU2A 1GX4A 3OH1A 4L41C 1OMZA 1QGQA 4FRHA 1JYKA 4JD0A 3CGXA 4B4MA 2V0JA 5FV9A 3CU0A 2VSIA 1H5SD 4EVWA 2X65A 4B2WA 4D11A 2JCLA 2JCJA 1SS9A 3RSBA 1H5TA 3E26A 4ECMA 2I5KA 5D91A 2ZU9A 2Y6PA 1XHBA 1K4VA 1H7QA 2FYAA 2J0BA 3E25A 4D0TA 2C0NA 1JV1A 1FXJA 4FCUA 1INIA 2P6WA 5C4FA 3OH2A 1S4PA 3NGWA 3OKRA 1WT0A 2XMHA 4CJ8A 4CJCA 1NMMB 1R7XA 4M28A 2JCKA 2Y4KA 4M2AA 3USQA 4AYLA 3DJ4A 3ZGFA 4EE5A 5DDTA 4DECA 3D5NA 1LZ0A 4LW6A 2VSHA 1TZFA 2YQCA 5IDTA 2XWLA 1ZI4A 3OGZA 3V8YA 1W77A 4ARWA 3V0MA 4IRPA 2ZU8A 2RJ1A 1FGGA 2WVMA 1FO9A 3FWWA 1TVYA 1VZXA 1H7TA 4HO5A 4AC3A 3U2VA 5C4BA 1GX0A 3IOJA 1WT1A 2AGDA 2FFUA 1NKHB 4KPXA 3SPTA 2GGQA 3RMWA 1ZJ0A 3Q4SA 1W55A 3CKOA 2X5SA 1R7VA 4HG6A 1G97A 2OEGA 4J18A 4EE3A 2QKXA 2WVKA 5C3AA 5I1FA 4Y7TA 5EIYA 2OI7A 3V0QA 5IDSA 1QWJA 3KIAA 4D0ZA 1ZJOA 2RIXA 3T7OA 1LZ7A 2O1FA 1R81A 1IIMA 1JVGA 1H7EA 1ZCUA 1TW1A 5DDVA 3F1YA 2W0VA 2W0WA 3V91A 3RMVA 4K6RA 3ZF8A 5CQNX 3U0XA 4LW3A 1ZCYA 3BCVA 3SXDA 1HJLA 1ZJ1A 5C3BA 1EZIA 4B4GA 2OI6A 1MC3A 4AAWA 2RJ9A 2PX7A 4MYBA 3EE5A 4CVHA 2BO7A 3GUEA 1NWGB 1VICA 2WEEA 4DDZA 3O3PA 1VH1A 1H7HA 4Y7GA 3LW6A 3USRA 2RIZA 5IFYA 1ON8A 4Y64A 1E5KA 4P02A 3U2TA 5CQMX 1O0RA 5C4DA 4HO8A 1FO8A 2RIYA 4EEMA 1ZJPA 3Q7UA 4HO4A 1GWWA 1ZDFA 2FYDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3Q A;  3U0Y A;  2AEC A;  2VXL A;  1VGU A;  1WT2 A;  5CMH A;  1YP4 A;  1EYR A;  1O7Q A;  1FZW A;  1GWV A;  1H7F A;  3SX5 A;  3POL A;  2D0J A;  3ZGG A;  4DE7 A;  1V84 A;  4KXO A;  3TQD A;  1FOA A;  3I0E A;  2V0L A;  1XZ6 A;  1H5S C;  2RJ6 A;  4Y7F A;  1ZDG A;  2VS4 A;  3HL3 A;  3SXC A;  2UX8 A;  1YP3 A;  2BO6 A;  4YS8 A;  1QG8 A;  4UEG A;  1G2V A;  2FY7 A;  2X60 A;  4NAL A;  3OH3 A;  5CMJ A;  1FRW A;  4Y9X A;  2RIT A;  2VXM A;  4IRQ A;  1O23 B;  1VH3 A;  2RJ8 A;  3PKP A;  1FWY A;  1H5S A;  4NAK A;  3CKQ A;  5FU0 A;  1VZU A;  1MP4 A;  4M2B A;  1G93 A;  1OQM B;  5HS2 A;  4R7P A;  5AJP A;  2PGY A;  1V83 A;  4KC1 A;  1PZT A;  5C47 A;  3SXG A;  4ASJ A;  2WAW A;  1S4N A;  2P72 A;  4Y7V A;  3SX8 A;  4CJB A;  2ICX A;  1WVC A;  1YRO B;  1H5R A;  2QGI A;  3R2W A;  3OH4 A;  5FUH A;  4EEG A;  4NAN A;  1HV9 A;  2BO8 A;  1VPA A;  2APC A;  3F1C A;  2E8B A;  4KC2 A;  2DPW A;  1G95 A;  5FTV A;  2O1H A;  4KC4 A;  2OEF A;  2YQJ A;  2I5E A;  2ZU7 A;  4FRP A;  5C49 A;  4GBP A;  2Q4J A;  1VGZ A;  2RJ4 A;  4FQW A;  1H4D A;  4HO6 A;  1ZCT A;  2XWN A;  4FRO A;  1G9R A;  5EJ1 A;  3JTJ A;  2RJ7 A;  3FOQ A;  1GQ9 A;  2Z86 A;  4EEO A;  2YQS A;  1ZI1 A;  2P73 A;  4FRD A;  5FYE A;  2I7B A;  2XWM A;  2V0H A;  4M4K A;  1R7U A;  2FYB A;  4KT7 A;  3V0L A;  3SXE A;  3V8Z A;  5AJO A;  4FRE A;  1VGW A;  4FRL A;  1VGT A;  5CQO A;  5BXC A;  2JCO A;  3I0J A;  2GGO A;  3Q80 A;  2AM5 A;  4FRM A;  3T7N A;  4AYJ A;  1R82 A;  4B2X A;  4BMA A;  5C1G A;  1LZI A;  2D7R A;  2E3D A;  4HO2 A;  5L6S A;  1ZI3 A;  3PKQ A;  5L6V A;  3V0P A;  4ASY A;  2YES A;  1S4O A;  1ZHJ A;  5C36 A;  1VZT A;  2RJ0 A;  2AH9 A;  1G0R A;  4KRV A;  2YQH A;  4Y62 A;  1GQC A;  4KNR A;  4HCQ A;  2NXV A;  1INJ A;  3TZT A;  3QVB A;  1QGS A;  4Y63 A;  2VS3 A;  2RJ5 A;  4KPZ A;  4HOC A;  1G3L A;  3CKN A;  3I0K A;  1LL0 A;  3CKJ A;  2X5Z A;  3I0C A;  2YC5 A;  5C8R A;  1FGX A;  3JUJ A;  4BQH A;  1HM9 A;  2VFZ A;  1Z90 A;  3I0H A;  5EJZ A;  4EEA A;  2Z87 A;  3OC9 A;  1MP3 A;  4FCE A;  3U2X A;  2YC3 A;  1H5T B;  1H7L A;  1FXO A;  3DUV A;  2AE7 A;  4FRA A;  3PNN A;  2Y4J A;  4G3S A;  4Y6U A;  3K8D A;  1G1L A;  2O1G A;  2V0K A;  1R7Y A;  5C1L A;  2AM4 A;  4Y7U A;  1ZJ3 A;  1MP5 A;  3ZLK A;  4XWI A;  3R3I A;  2VD4 A;  2D7I A;  2AM3 A;  2WGZ A;  4HO9 A;  5FU8 A;  5C4E A;  1O7O A;  4B42 A;  4Y6N A;  3D8V A;  1FR9 A;  3OH0 A;  3ST8 A;  3ZLL A;  5C38 A;  5C48 A;  4B3U A;  1ZIZ A;  3U2U A;  1LL2 A;  5CQP A;  5AJN A;  1GA8 A;  2FFV A;  2QH5 A;  1FR8 A;  2PGV A;  4KNX A;  2Y4M A;  4JIS A;  3SX7 A;  2V0I A;  1TW5 A;  3U2W A;  1R80 A;  1G8O A;  4HO0 A;  1H5S B;  1V82 A;  3DK5 A;  2YCM A;  1ZJ2 A;  4FRQ A;  5C1H A;  2FYC B;  3N9W A;  2A8U A;  1NF5 B;  1IIN A;  1ON6 A;  2OI5 A;  2WE9 A;  1H5R B;  1JV3 A;  5CMG X;  3IOH A;  1VM8 A;  4E1K A;  5C3D A;  1H3M A;  1JVD A;  5FTS A;  4B4B A;  2AES A;  2XME A;  1YP2 A;  4NAI A;  1R7T A;  4MND A;  5CMI A;  4ZDQ A;  3CKV A;  1HM8 A;  1LL3 A;  4G87 A;  1H4E A;  1WT3 A;  3SXA A;  1LZJ A;  2PA4 A;  3V0O A;  1W57 A;  1HM0 A;  3D98 A;  2BO4 A;  5J49 A;  1NHE B;  1FG5 N;  4KQL A;  3K8E A;  2Y7A A;  3JUK A;  4FRB A;  1PZY B;  3T7M A;  1WSZ A;  5JQQ A;  4EE4 A;  2WVL A;  5CMF X;  3I0I X;  3V0N A;  4D48 A;  4HO3 A;  3I0F A;  4G3P A;  1OMX A;  1HJJ A;  1H4C A;  3I0G A;  2MZB A;  1G23 A;  4P00 A;  5CQL X;  1ZI5 A;  3BRK X;  3I0L A;  2ICY A;  1JYL A;  1NQI B;  3I0D A;  3SXB A;  4B5B A;  2A8W A;  3IOI A;  1ZCV A;  2VS5 A;  3V90 A;  5C4C A;  1KWS A;  1I52 A;  3OAM A;  4C2S A;  1LVW A;  2Y4L A;  4D11 C;  3SX3 A;  1H7G A;  2CU2 A;  1GX4 A;  3OH1 A;  4L41 C;  1OMZ A;  1QGQ A;  4FRH A;  1JYK A;  4JD0 A;  3CGX A;  4B4M A;  2V0J A;  5FV9 A;  3CU0 A;  2VSI A;  1H5S D;  4EVW A;  2X65 A;  4B2W A;  4D11 A;  2JCL A;  2JCJ A;  1SS9 A;  3RSB A;  1H5T A;  3E26 A;  4ECM A;  2I5K A;  2ZU9 A;  2Y6P A;  1XHB A;  1K4V A;  1H7Q A;  2FYA A;  3E25 A;  4D0T A;  1JV1 A;  1FXJ A;  4FCU A;  1INI A;  2P6W A;  5C4F A;  3OH2 A;  1S4P A;  3NGW A;  3OKR A;  1WT0 A;  2XMH A;  4CJ8 A;  4CJC A;  1NMM B;  1R7X A;  4M28 A;  2JCK A;  2Y4K A;  4M2A A;  3USQ A;  4AYL A;  3DJ4 A;  3ZGF A;  4EE5 A;  5DDT A;  4DEC A;  3D5N A;  1LZ0 A;  4LW6 A;  2VSH A;  1TZF A;  2YQC A;  5IDT A;  2XWL A;  1ZI4 A;  3OGZ A;  3V8Y A;  1W77 A;  4ARW A;  3V0M A;  4IRP A;  2ZU8 A;  2RJ1 A;  1FGG A;  2WVM A;  1FO9 A;  3FWW A;  1TVY A;  1VZX A;  1H7T A;  4HO5 A;  4AC3 A;  3U2V A;  5C4B A;  1GX0 A;  3IOJ A;  1WT1 A;  2AGD A;  2FFU A;  1NKH B;  4KPX A;  3SPT A;  2GGQ A;  3RMW A;  1ZJ0 A;  3Q4S A;  1W55 A;  3CKO A;  2X5S A;  1R7V A;  4HG6 A;  1G97 A;  2OEG A;  4J18 A;  4EE3 A;  2QKX A;  2WVK A;  5C3A A;  5I1F A;  4Y7T A;  5EIY A;  2OI7 A;  3V0Q A;  5IDS A;  1QWJ A;  3KIA A;  4D0Z A;  1ZJO A;  2RIX A;  3T7O A;  1LZ7 A;  2O1F A;  1R81 A;  1IIM A;  1JVG A;  1H7E A;  1ZCU A;  1TW1 A;  5DDV A;  3F1Y A;  2W0V A;  2W0W A;  3V91 A;  3RMV A;  4K6R A;  3ZF8 A;  5CQN X;  3U0X A;  4LW3 A;  1ZCY A;  3BCV A;  3SXD A;  1HJL A;  1ZJ1 A;  5C3B A;  1EZI A;  4B4G A;  2OI6 A;  1MC3 A;  4AAW A;  2RJ9 A;  2PX7 A;  4MYB A;  3EE5 A;  4CVH A;  2BO7 A;  3GUE A;  1NWG B;  1VIC A;  2WEE A;  4DDZ A;  3O3P A;  1VH1 A;  1H7H A;  4Y7G A;  3LW6 A;  3USR A;  2RIZ A;  5IFY A;  1ON8 A;  4Y64 A;  1E5K A;  4P02 A;  3U2T A;  5CQM X;  1O0R A;  5C4D A;  4HO8 A;  1FO8 A;  2RIY A;  4EEM A;  1ZJP A;  3Q7U A;  4HO4 A;  1GWW A;  1ZDF A;  2FYD B; 
#chains in the Genus database with same CATH topology
 4G3Q A;  3U0Y A;  2AEC A;  2VXL A;  1VGU A;  1WT2 A;  5CMH A;  1YP4 A;  1EYR A;  1O7Q A;  1FZW A;  1GWV A;  1H7F A;  3SX5 A;  3POL A;  2D0J A;  3ZGG A;  4DE7 A;  1V84 A;  4KXO A;  3TQD A;  1FOA A;  3I0E A;  2V0L A;  1XZ6 A;  1H5S C;  2RJ6 A;  4Y7F A;  1ZDG A;  2VS4 A;  3HL3 A;  3SXC A;  2UX8 A;  1YP3 A;  2BO6 A;  4YS8 A;  1QG8 A;  4UEG A;  1G2V A;  2FY7 A;  2X60 A;  4NAL A;  3OH3 A;  5CMJ A;  1FRW A;  4O6N A;  4FIX A;  2RIT A;  4Y9X A;  2VXM A;  4IRQ A;  1O23 B;  1VH3 A;  2RJ8 A;  3PKP A;  1FWY A;  1H5S A;  4NAK A;  3CKQ A;  5FU0 A;  1VZU A;  1MP4 A;  4M2B A;  1G93 A;  1OQM B;  5HS2 A;  4R7P A;  5AJP A;  2PGY A;  1V83 A;  4KC1 A;  1PZT A;  5C47 A;  3SXG A;  4ASJ A;  2WAW A;  1S4N A;  2P72 A;  4Y7V A;  3SX8 A;  4CJB A;  2ICX A;  1WVC A;  1YRO B;  1H5R A;  2QGI A;  3R2W A;  3OH4 A;  5FUH A;  4EEG A;  4NAN A;  1HV9 A;  2BO8 A;  1VPA A;  2APC A;  3F1C A;  2E8B A;  4KC2 A;  2DPW A;  1G95 A;  5FTV A;  2O1H A;  4KC4 A;  2OEF A;  2YQJ A;  2I5E A;  2ZU7 A;  4FRP A;  5C49 A;  4GBP A;  2Q4J A;  1VGZ A;  2RJ4 A;  4FQW A;  1H4D A;  4HO6 A;  1ZCT A;  2XWN A;  4FRO A;  1G9R A;  5EJ1 A;  3JTJ A;  2RJ7 A;  3FOQ A;  1GQ9 A;  2Z86 A;  4EEO A;  2YQS A;  1ZI1 A;  2P73 A;  4FRD A;  5FYE A;  2I7B A;  2XWM A;  2V0H A;  4M4K A;  1R7U A;  2FYB A;  4KT7 A;  3V0L A;  3SXE A;  3V8Z A;  5AJO A;  4FRE A;  1VGW A;  4FRL A;  1VGT A;  5CQO A;  5BXC A;  2JCO A;  3I0J A;  2J0A A;  2GGO A;  3Q80 A;  2AM5 A;  4FRM A;  3T7N A;  4AYJ A;  1R82 A;  4B2X A;  4BMA A;  5C1G A;  1LZI A;  2D7R A;  2E3D A;  4HO2 A;  5L6S A;  1ZI3 A;  3PKQ A;  5L6V A;  3V0P A;  4ASY A;  2YES A;  1S4O A;  1ZHJ A;  5C36 A;  1VZT A;  2RJ0 A;  2AH9 A;  1G0R A;  4KRV A;  2YQH A;  4Y62 A;  1GQC A;  4KNR A;  4HCQ A;  2NXV A;  1INJ A;  3TZT A;  3QVB A;  1QGS A;  4Y63 A;  2VS3 A;  2RJ5 A;  2VK9 A;  4KPZ A;  4HOC A;  1G3L A;  3CKN A;  3I0K A;  1LL0 A;  3CKJ A;  2X5Z A;  3I0C A;  2YC5 A;  5C8R A;  1FGX A;  3JUJ A;  4BQH A;  1HM9 A;  2VFZ A;  1Z90 A;  3I0H A;  5EJZ A;  4EEA A;  2Z87 A;  3OC9 A;  1MP3 A;  4FCE A;  3U2X A;  2YC3 A;  1H5T B;  1H7L A;  4Q7C A;  1FXO A;  3DUV A;  2AE7 A;  4FRA A;  3PNN A;  2Y4J A;  4G3S A;  4Y6U A;  3K8D A;  1G1L A;  2O1G A;  2V0K A;  1R7Y A;  5C1L A;  2AM4 A;  4Y7U A;  1ZJ3 A;  1MP5 A;  3ZLK A;  4XWI A;  3R3I A;  2VD4 A;  2D7I A;  2AM3 A;  2WGZ A;  4HO9 A;  5FU8 A;  4MIX A;  5C4E A;  1O7O A;  4B42 A;  4Y6N A;  3D8V A;  1FR9 A;  3OH0 A;  3ST8 A;  3ZLL A;  5C38 A;  5C48 A;  4B3U A;  1ZIZ A;  5D92 A;  3U2U A;  1LL2 A;  4FIY A;  5CQP A;  5AJN A;  1GA8 A;  2FFV A;  2QH5 A;  1FR8 A;  2PGV A;  4KNX A;  2Y4M A;  4JIS A;  3SX7 A;  2V0I A;  1TW5 A;  3U2W A;  1R80 A;  1G8O A;  4HO0 A;  1H5S B;  1V82 A;  3DK5 A;  2YCM A;  1ZJ2 A;  4FRQ A;  5C1H A;  2FYC B;  3N9W A;  2A8U A;  1NF5 B;  1IIN A;  1ON6 A;  2OI5 A;  4O6M A;  2WE9 A;  1H5R B;  1JV3 A;  5CMG X;  3IOH A;  1VM8 A;  4E1K A;  5C3D A;  1H3M A;  1JVD A;  5FTS A;  4B4B A;  2AES A;  2XME A;  1YP2 A;  4NAI A;  1R7T A;  4MND A;  5CMI A;  4ZDQ A;  3CKV A;  1HM8 A;  1LL3 A;  4G87 A;  1H4E A;  1WT3 A;  3SXA A;  1LZJ A;  2PA4 A;  3V0O A;  1W57 A;  1HM0 A;  3D98 A;  2BO4 A;  5J49 A;  1NHE B;  1FG5 N;  4KQL A;  3K8E A;  2Y7A A;  3JUK A;  4FRB A;  1PZY B;  3T7M A;  1WSZ A;  5JQQ A;  4EE4 A;  2WVL A;  5CMF X;  3I0I X;  3V0N A;  4D48 A;  4HO3 A;  3I0F A;  4G3P A;  1OMX A;  1HJJ A;  1H4C A;  3I0G A;  2MZB A;  1G23 A;  4P00 A;  5CQL X;  1ZI5 A;  3BRK X;  3I0L A;  2ICY A;  1JYL A;  1NQI B;  3I0D A;  3SXB A;  4B5B A;  2A8W A;  3IOI A;  1ZCV A;  2VS5 A;  3V90 A;  5C4C A;  1KWS A;  1I52 A;  3OAM A;  4C2S A;  1LVW A;  2Y4L A;  4D11 C;  3SX3 A;  1H7G A;  2CU2 A;  1GX4 A;  3OH1 A;  4L41 C;  1OMZ A;  1QGQ A;  4FRH A;  1JYK A;  4JD0 A;  3CGX A;  4B4M A;  2V0J A;  5FV9 A;  3CU0 A;  2VSI A;  1H5S D;  4EVW A;  2X65 A;  4B2W A;  4D11 A;  2JCL A;  2JCJ A;  1SS9 A;  3RSB A;  1H5T A;  3E26 A;  4ECM A;  2I5K A;  5D91 A;  2ZU9 A;  2Y6P A;  1XHB A;  1K4V A;  1H7Q A;  2FYA A;  2J0B A;  3E25 A;  4D0T A;  2C0N A;  1JV1 A;  1FXJ A;  4FCU A;  1INI A;  2P6W A;  5C4F A;  3OH2 A;  1S4P A;  3NGW A;  3OKR A;  1WT0 A;  2XMH A;  4CJ8 A;  4CJC A;  1NMM B;  1R7X A;  4M28 A;  2JCK A;  2Y4K A;  4M2A A;  3USQ A;  4AYL A;  3DJ4 A;  3ZGF A;  4EE5 A;  5DDT A;  4DEC A;  3D5N A;  1LZ0 A;  4LW6 A;  2VSH A;  1TZF A;  2YQC A;  5IDT A;  2XWL A;  1ZI4 A;  3OGZ A;  3V8Y A;  1W77 A;  4ARW A;  3V0M A;  4IRP A;  2ZU8 A;  2RJ1 A;  1FGG A;  2WVM A;  1FO9 A;  3FWW A;  1TVY A;  1VZX A;  1H7T A;  4HO5 A;  4AC3 A;  3U2V A;  5C4B A;  1GX0 A;  3IOJ A;  1WT1 A;  2AGD A;  2FFU A;  1NKH B;  4KPX A;  3SPT A;  2GGQ A;  3RMW A;  1ZJ0 A;  3Q4S A;  1W55 A;  3CKO A;  2X5S A;  1R7V A;  4HG6 A;  1G97 A;  2OEG A;  4J18 A;  4EE3 A;  2QKX A;  2WVK A;  5C3A A;  5I1F A;  4Y7T A;  5EIY A;  2OI7 A;  3V0Q A;  5IDS A;  1QWJ A;  3KIA A;  4D0Z A;  1ZJO A;  2RIX A;  3T7O A;  1LZ7 A;  2O1F A;  1R81 A;  1IIM A;  1JVG A;  1H7E A;  1ZCU A;  1TW1 A;  5DDV A;  3F1Y A;  2W0V A;  2W0W A;  3V91 A;  3RMV A;  4K6R A;  3ZF8 A;  5CQN X;  3U0X A;  4LW3 A;  1ZCY A;  3BCV A;  3SXD A;  1HJL A;  1ZJ1 A;  5C3B A;  1EZI A;  4B4G A;  2OI6 A;  1MC3 A;  4AAW A;  2RJ9 A;  2PX7 A;  4MYB A;  3EE5 A;  4CVH A;  2BO7 A;  3GUE A;  1NWG B;  1VIC A;  2WEE A;  4DDZ A;  3O3P A;  1VH1 A;  1H7H A;  4Y7G A;  3LW6 A;  3USR A;  2RIZ A;  5IFY A;  1ON8 A;  4Y64 A;  1E5K A;  4P02 A;  3U2T A;  5CQM X;  1O0R A;  5C4D A;  4HO8 A;  1FO8 A;  2RIY A;  4EEM A;  1ZJP A;  3Q7U A;  4HO4 A;  1GWW A;  1ZDF A;  2FYD B; 
#chains in the Genus database with same CATH homology
 4G3Q A;  3U0Y A;  2AEC A;  2VXL A;  1VGU A;  1WT2 A;  5CMH A;  1YP4 A;  1EYR A;  1O7Q A;  1FZW A;  1GWV A;  1H7F A;  3SX5 A;  3POL A;  2D0J A;  3ZGG A;  4DE7 A;  1V84 A;  4KXO A;  3TQD A;  1FOA A;  3I0E A;  2V0L A;  1XZ6 A;  1H5S C;  2RJ6 A;  4Y7F A;  1ZDG A;  2VS4 A;  3HL3 A;  3SXC A;  2UX8 A;  1YP3 A;  2BO6 A;  4YS8 A;  1QG8 A;  4UEG A;  1G2V A;  2FY7 A;  2X60 A;  4NAL A;  3OH3 A;  5CMJ A;  1FRW A;  4O6N A;  4FIX A;  2RIT A;  4Y9X A;  2VXM A;  4IRQ A;  1O23 B;  1VH3 A;  2RJ8 A;  3PKP A;  1FWY A;  1H5S A;  4NAK A;  3CKQ A;  5FU0 A;  1VZU A;  1MP4 A;  4M2B A;  1G93 A;  1OQM B;  5HS2 A;  4R7P A;  5AJP A;  2PGY A;  1V83 A;  4KC1 A;  1PZT A;  5C47 A;  3SXG A;  4ASJ A;  2WAW A;  1S4N A;  2P72 A;  4Y7V A;  3SX8 A;  4CJB A;  2ICX A;  1WVC A;  1YRO B;  1H5R A;  2QGI A;  3R2W A;  3OH4 A;  5FUH A;  4EEG A;  4NAN A;  1HV9 A;  2BO8 A;  1VPA A;  2APC A;  3F1C A;  2E8B A;  4KC2 A;  2DPW A;  1G95 A;  5FTV A;  2O1H A;  4KC4 A;  2OEF A;  2YQJ A;  2I5E A;  2ZU7 A;  4FRP A;  5C49 A;  4GBP A;  2Q4J A;  1VGZ A;  2RJ4 A;  4FQW A;  1H4D A;  4HO6 A;  1ZCT A;  2XWN A;  4FRO A;  1G9R A;  5EJ1 A;  3JTJ A;  2RJ7 A;  3FOQ A;  1GQ9 A;  2Z86 A;  4EEO A;  2YQS A;  1ZI1 A;  2P73 A;  4FRD A;  5FYE A;  2I7B A;  2XWM A;  2V0H A;  4M4K A;  1R7U A;  2FYB A;  4KT7 A;  3V0L A;  3SXE A;  3V8Z A;  5AJO A;  4FRE A;  1VGW A;  4FRL A;  1VGT A;  5CQO A;  5BXC A;  2JCO A;  3I0J A;  2J0A A;  2GGO A;  3Q80 A;  2AM5 A;  4FRM A;  3T7N A;  4AYJ A;  1R82 A;  4B2X A;  4BMA A;  5C1G A;  1LZI A;  2D7R A;  2E3D A;  4HO2 A;  5L6S A;  1ZI3 A;  3PKQ A;  5L6V A;  3V0P A;  4ASY A;  2YES A;  1S4O A;  1ZHJ A;  5C36 A;  1VZT A;  2RJ0 A;  2AH9 A;  1G0R A;  4KRV A;  2YQH A;  4Y62 A;  1GQC A;  4KNR A;  4HCQ A;  2NXV A;  1INJ A;  3TZT A;  3QVB A;  1QGS A;  4Y63 A;  2VS3 A;  2RJ5 A;  2VK9 A;  4KPZ A;  4HOC A;  1G3L A;  3CKN A;  3I0K A;  1LL0 A;  3CKJ A;  2X5Z A;  3I0C A;  2YC5 A;  5C8R A;  1FGX A;  3JUJ A;  4BQH A;  1HM9 A;  2VFZ A;  1Z90 A;  3I0H A;  5EJZ A;  4EEA A;  2Z87 A;  3OC9 A;  1MP3 A;  4FCE A;  3U2X A;  2YC3 A;  1H5T B;  1H7L A;  4Q7C A;  1FXO A;  3DUV A;  2AE7 A;  4FRA A;  3PNN A;  2Y4J A;  4G3S A;  4Y6U A;  3K8D A;  1G1L A;  2O1G A;  2V0K A;  1R7Y A;  5C1L A;  2AM4 A;  4Y7U A;  1ZJ3 A;  1MP5 A;  3ZLK A;  4XWI A;  3R3I A;  2VD4 A;  2D7I A;  2AM3 A;  2WGZ A;  4HO9 A;  5FU8 A;  4MIX A;  5C4E A;  1O7O A;  4B42 A;  4Y6N A;  3D8V A;  1FR9 A;  3OH0 A;  3ST8 A;  3ZLL A;  5C38 A;  5C48 A;  4B3U A;  1ZIZ A;  5D92 A;  3U2U A;  1LL2 A;  4FIY A;  5CQP A;  5AJN A;  1GA8 A;  2FFV A;  2QH5 A;  1FR8 A;  2PGV A;  4KNX A;  2Y4M A;  4JIS A;  3SX7 A;  2V0I A;  1TW5 A;  3U2W A;  1R80 A;  1G8O A;  4HO0 A;  1H5S B;  1V82 A;  3DK5 A;  2YCM A;  1ZJ2 A;  4FRQ A;  5C1H A;  2FYC B;  3N9W A;  2A8U A;  1NF5 B;  1IIN A;  1ON6 A;  2OI5 A;  4O6M A;  2WE9 A;  1H5R B;  1JV3 A;  5CMG X;  3IOH A;  1VM8 A;  4E1K A;  5C3D A;  1H3M A;  1JVD A;  5FTS A;  4B4B A;  2AES A;  2XME A;  1YP2 A;  4NAI A;  1R7T A;  4MND A;  5CMI A;  4ZDQ A;  3CKV A;  1HM8 A;  1LL3 A;  4G87 A;  1H4E A;  1WT3 A;  3SXA A;  1LZJ A;  2PA4 A;  3V0O A;  1W57 A;  1HM0 A;  3D98 A;  2BO4 A;  5J49 A;  1NHE B;  1FG5 N;  4KQL A;  3K8E A;  2Y7A A;  3JUK A;  4FRB A;  1PZY B;  3T7M A;  1WSZ A;  5JQQ A;  4EE4 A;  2WVL A;  5CMF X;  3I0I X;  3V0N A;  4D48 A;  4HO3 A;  3I0F A;  4G3P A;  1OMX A;  1HJJ A;  1H4C A;  3I0G A;  2MZB A;  1G23 A;  4P00 A;  5CQL X;  1ZI5 A;  3BRK X;  3I0L A;  2ICY A;  1JYL A;  1NQI B;  3I0D A;  3SXB A;  4B5B A;  2A8W A;  3IOI A;  1ZCV A;  2VS5 A;  3V90 A;  5C4C A;  1KWS A;  1I52 A;  3OAM A;  4C2S A;  1LVW A;  2Y4L A;  4D11 C;  3SX3 A;  1H7G A;  2CU2 A;  1GX4 A;  3OH1 A;  4L41 C;  1OMZ A;  1QGQ A;  4FRH A;  1JYK A;  4JD0 A;  3CGX A;  4B4M A;  2V0J A;  5FV9 A;  3CU0 A;  2VSI A;  1H5S D;  4EVW A;  2X65 A;  4B2W A;  4D11 A;  2JCL A;  2JCJ A;  1SS9 A;  3RSB A;  1H5T A;  3E26 A;  4ECM A;  2I5K A;  5D91 A;  2ZU9 A;  2Y6P A;  1XHB A;  1K4V A;  1H7Q A;  2FYA A;  2J0B A;  3E25 A;  4D0T A;  2C0N A;  1JV1 A;  1FXJ A;  4FCU A;  1INI A;  2P6W A;  5C4F A;  3OH2 A;  1S4P A;  3NGW A;  3OKR A;  1WT0 A;  2XMH A;  4CJ8 A;  4CJC A;  1NMM B;  1R7X A;  4M28 A;  2JCK A;  2Y4K A;  4M2A A;  3USQ A;  4AYL A;  3DJ4 A;  3ZGF A;  4EE5 A;  5DDT A;  4DEC A;  3D5N A;  1LZ0 A;  4LW6 A;  2VSH A;  1TZF A;  2YQC A;  5IDT A;  2XWL A;  1ZI4 A;  3OGZ A;  3V8Y A;  1W77 A;  4ARW A;  3V0M A;  4IRP A;  2ZU8 A;  2RJ1 A;  1FGG A;  2WVM A;  1FO9 A;  3FWW A;  1TVY A;  1VZX A;  1H7T A;  4HO5 A;  4AC3 A;  3U2V A;  5C4B A;  1GX0 A;  3IOJ A;  1WT1 A;  2AGD A;  2FFU A;  1NKH B;  4KPX A;  3SPT A;  2GGQ A;  3RMW A;  1ZJ0 A;  3Q4S A;  1W55 A;  3CKO A;  2X5S A;  1R7V A;  4HG6 A;  1G97 A;  2OEG A;  4J18 A;  4EE3 A;  2QKX A;  2WVK A;  5C3A A;  5I1F A;  4Y7T A;  5EIY A;  2OI7 A;  3V0Q A;  5IDS A;  1QWJ A;  3KIA A;  4D0Z A;  1ZJO A;  2RIX A;  3T7O A;  1LZ7 A;  2O1F A;  1R81 A;  1IIM A;  1JVG A;  1H7E A;  1ZCU A;  1TW1 A;  5DDV A;  3F1Y A;  2W0V A;  2W0W A;  3V91 A;  3RMV A;  4K6R A;  3ZF8 A;  5CQN X;  3U0X A;  4LW3 A;  1ZCY A;  3BCV A;  3SXD A;  1HJL A;  1ZJ1 A;  5C3B A;  1EZI A;  4B4G A;  2OI6 A;  1MC3 A;  4AAW A;  2RJ9 A;  2PX7 A;  4MYB A;  3EE5 A;  4CVH A;  2BO7 A;  3GUE A;  1NWG B;  1VIC A;  2WEE A;  4DDZ A;  3O3P A;  1VH1 A;  1H7H A;  4Y7G A;  3LW6 A;  3USR A;  2RIZ A;  5IFY A;  1ON8 A;  4Y64 A;  1E5K A;  4P02 A;  3U2T A;  5CQM X;  1O0R A;  5C4D A;  4HO8 A;  1FO8 A;  2RIY A;  4EEM A;  1ZJP A;  3Q7U A;  4HO4 A;  1GWW A;  1ZDF A;  2FYD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...