1VZXA

Roles of active site tryptophans in substrate binding and catalysis by alpha-1,3 galactosyltransferase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQYHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVRNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Roles of active site tryptophans in substrate binding and catalysis by alpha-1,3 galactosyltransferase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 108
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1vzxA00
1ZCYA 4K6RA 1WT0A 1H7EA 2A8WA 2P72A 5C38A 4ARWA 1Z90A 1MC3A 4GBPA 1H5RB 1FXJA 3OAMA 4MNDA 1LZIA 1E5KA 3ZLKA 4D0ZA 1I52A 3OH3A 2WE9A 1ZI1A 2FYDB 1H7HA 2X5ZA 3Q80A 3CKJA 3KIAA 3OH1A 1TW1A 2PGVA 2VS4A 1XHBA 1FR9A 1V83A 2FYBA 5CMJA 2APCA 1QWJA 1MP5A 1ZCUA 5FTSA 4M2BA 3PNNA 4EEGA 3D98A 3SXAA 3I0DA 2I7BA 3SXBA 1O23B 1ON8A 2Y4KA 4KPXA 1S4PA 1ZCTA 3U2XA 2YQHA 3IOHA 2O1HA 4BQHA 2E3DA 1FGGA 1S4OA 2DPWA 1ZHJA 4L41C 1HM0A 3OH0A 2RJ9A 2GGOA 4EEOA 4P02A 5C3BA 2Z86A 2VFZA 3I0EA 3PKPA 4FQWA 3IOIA 2Y4JA 1FGXA 1JYKA 3V0PA 2PGYA 3BRKX 3IOJA 1JVDA 2ICXA 4KT7A 2OI5A 2MZBA 1H5TA 1ZI5A 2UX8A 5C1LA 5I1FA 3CKNA 4FCUA 1NHEB 2XWLA 2O1GA 1ZJ2A 5C8RA 1QGQA 4HO3A 3TQDA 4CJCA 4FREA 1PZTA 1H7FA 1R7UA 2VXMA 2QKXA 2D0JA 3CKQA 3OKRA 4IRQA 5C47A 5C48A 1XZ6A 2AM5A 4Y7VA 1ZJ1A 4CJBA 1W57A 2YC3A 1VZUA 2WVMA 4KRVA 5EJ1A 2V0LA 2YC5A 3E26A 4Y9XA 4EE4A 4FRBA 3RMWA 1YROB 3ST8A 1VGZA 4R7PA 1HJJA 1R81A 4FCEA 4JD0A 3SX7A 1NF5B 1LL3A 2Y4LA 1JV1A 1QG8A 2WEEA 2BO7A 4ASJA 2A8UA 4BMAA 1R82A 1R7TA 3PKQA 5C36A 1VGWA 3I0IX 1H4DA 4J18A 4ZDQA 1O7QA 1H5SD 1MP4A 4Y7TA 4B2XA 3F1YA 1ZJ0A 5IFYA 2PA4A 2W0VA 3EE5A 1HM8A 3LW6A 2WVKA 1G3LA 1TZFA 1W55A 2AH9A 3I0CA 2RJ6A 1O0RA 1FO9A 1R7YA 5J49A 1H5SB 4HCQA 5IDSA 4FRLA 2RIYA 1GWWA 2XWNA 4Y7FA 5C49A 2AM3A 3FWWA 1S4NA 1G9RA 4G3PA 5CMFX 5C1GA 5L6SA 3BCVA 4KXOA 5C4DA 4DECA 3D8VA 3K8EA 1ZJPA 1EYRA 2WGZA 1WT3A 4LW3A 4HO2A 1LZJA 4D11A 2E8BA 3POLA 4B4BA 4IRPA 3U2VA 2I5KA 3JUJA 3RSBA 1ZI4A 1ZJOA 2NXVA 4E1KA 1R7XA 4FROA 1ON6A 5FYEA 1PZYB 4HO9A 1FWYA 2BO6A 3T7OA 1WT1A 2Y4MA 1OMXA 5C4EA 1INIA 1HJLA 2YQCA 3U2WA 4AYJA 1ZIZA 1GX4A 5DDTA 2AECA 2VSIA 5C4BA 1VM8A 3FOQA 5CQPA 1H4CA 4D11C 4Y7UA 5C1HA 5CQOA 2AGDA 4B4MA 3OGZA 2Z87A 3CKVA 2RJ8A 3K8DA 1H3MA 2JCLA 4G3SA 4DE7A 3I0HA 4ASYA 2V0KA 1TVYA 1ZI3A 4EVWA 1NQIB 3V91A 2RIXA 2X60A 1JVGA 4G3QA 3T7NA 3CGXA 2RIZA 3DUVA 4FRMA 4CVHA 4HG6A 1H5RA 5FUHA 4HO0A 5L6VA 1V84A 2PX7A 3SX3A 3I0GA 1G93A 4FRAA 2JCJA 3SXDA 1KWSA 1H4EA 5AJPA 5C3DA 4B4GA 1ZJ3A 3I0LA 2VSHA 1GQCA 1YP3A 2XWMA 2FFVA 2D7RA 3Q4SA 1H5SC 3SX5A 3ZF8A 1LZ0A 1FRWA 3OH2A 1GA8A 2RJ0A 4AYLA 4C2SA 1G8OA 3SX8A 1G23A 2FY7A 2X65A 5CQMX 3ZLLA 4Y6UA 3V8YA 4NAKA 4Y63A 1HM9A 4M2AA 4FRHA 1VH3A 2JCOA 3RMVA 2OEGA 1WVCA 2FYAA 1TW5A 3U2UA 5IDTA 3V0LA 1FXOA 4M4KA 2XMHA 1VPAA 2RJ4A 2RJ7A 4DDZA 4NAIA 3O3PA 3I0FA 1G1LA 5CMHA 1H5TB 5CQLX 5FV9A 3I0KA 2W0WA 4EE3A 2ZU9A 2V0HA 4EE5A 2ZU8A 3DK5A 1FG5N 4D0TA 4HO8A 4G87A 3NGWA 3E25A 3R2WA 5AJOA 1HV9A 1MP3A 1FO8A 1NKHB 3JUKA 4HO4A 3SXCA 2OI7A 1G0RA 4KQLA 4KC4A 4B5BA 2O1FA 5C4FA 2Y7AA 1R7VA 2I5EA 4KC1A 2X5SA 5BXCA 3T7MA 3TZTA 1H7TA 4JISA 1W77A 3D5NA 4FRQA 4FRPA 4Y62A 1OQMB 2BO8A 2ZU7A 3USRA 2D7IA 2YCMA 1VICA 1ZDFA 2OI6A 4B3UA 5JQQA 1ZDGA 2JCKA 4EEMA 4EEAA 2YESA 4M28A 1G97A 3USQA 5C4CA 4MYBA 2VS3A 1QGSA 3ZGFA 1G2VA 2AM4A 1H5SA 3OH4A 2RJ5A 4FRDA 4XWIA 4B42A 3U2TA 4Y64A 2YQSA 1JV3A 2QH5A 3DJ4A 5DDVA 5HS2A 1VH1A 4KC2A 3QVBA 4NANA 2Y6PA 3SXGA 4HO6A 4Y6NA 1IINA 1H7LA 2XMEA 5C3AA 2P73A 2AE7A 3SXEA 2QGIA 3V0MA 5FU0A 4Y7GA 1SS9A 4NALA 3V90A 1JYLA 1FOAA 5CQNX 1ZCVA 1O7OA 1GQ9A 4D48A 1H7QA 3I0JA 1LL2A 2P6WA 1LL0A 1VGUA 1V82A 4B2WA 2WAWA 4KPZA 1IIMA 3U0YA 3ZGGA 2WVLA 3U0XA 1FR8A 3V0OA 2BO4A 4AC3A 5EIYA 4HOCA 5CMGX 3CU0A 1VZXA 5EJZA 1GWVA 1WT2A 3V0NA 1YP4A 3OC9A 1NMMB 5CMIA 2FFUA 1R80A 3JTJA 2OEFA 2VD4A 2RJ1A 4LW6A 3F1CA 4P00A 3V8ZA 2AESA 2VXLA 1NWGB 3CKOA 2GGQA 3R3IA 4KNXA 3SPTA 1VZTA 1H7GA 2VS5A 1K4VA 1INJA 4UEGA 5FTVA 2FYCB 3V0QA 4ECMA 1OMZA 3N9WA 1YP2A 2V0JA 1LZ7A 4KNRA 2ICYA 5FU8A 1VGTA 2YQJA 5AJNA 1GX0A 4HO5A 2V0IA 1FZWA 1EZIA 1G95A 4AAWA 2Q4JA 1WSZA 1LVWA 3HL3A 2CU2A 3GUEA 2RITA 4CJ8A 3Q7UA 4YS8A
chains in the Genus database with same CATH superfamily
1ZCYA 4K6RA 1WT0A 1H7EA 4FIYA 2A8WA 2P72A 5C38A 4ARWA 1Z90A 1MC3A 4GBPA 1H5RB 1FXJA 3OAMA 4MNDA 1LZIA 1E5KA 3ZLKA 4D0ZA 1I52A 3OH3A 2WE9A 1ZI1A 2FYDB 1H7HA 2X5ZA 3Q80A 3CKJA 3KIAA 3OH1A 1TW1A 2PGVA 2VS4A 1XHBA 1FR9A 1V83A 2FYBA 5CMJA 2APCA 1QWJA 1MP5A 1ZCUA 4O6MA 4M2BA 5FTSA 3PNNA 4EEGA 3D98A 3SXAA 3I0DA 2I7BA 3SXBA 1O23B 1ON8A 2Y4KA 4KPXA 1S4PA 1ZCTA 3U2XA 2YQHA 3IOHA 2O1HA 4BQHA 2E3DA 1FGGA 1S4OA 2DPWA 1ZHJA 4L41C 1HM0A 3OH0A 2RJ9A 2GGOA 4EEOA 4P02A 5C3BA 2Z86A 2VFZA 3I0EA 3PKPA 4FQWA 3IOIA 2Y4JA 4FIXA 1FGXA 1JYKA 3V0PA 2PGYA 3BRKX 3IOJA 1JVDA 2ICXA 4KT7A 2OI5A 2MZBA 1H5TA 1ZI5A 2UX8A 5C1LA 5I1FA 3CKNA 4FCUA 1NHEB 2XWLA 2O1GA 1ZJ2A 5C8RA 1QGQA 4HO3A 3TQDA 4CJCA 4FREA 1PZTA 1H7FA 1R7UA 2VXMA 2QKXA 2D0JA 3CKQA 3OKRA 4IRQA 5C47A 5C48A 1XZ6A 2VK9A 2AM5A 4Y7VA 1ZJ1A 4CJBA 1W57A 2YC3A 1VZUA 2WVMA 4KRVA 5EJ1A 2V0LA 2YC5A 3E26A 4Y9XA 4EE4A 4FRBA 3RMWA 1YROB 3ST8A 1VGZA 4R7PA 1HJJA 1R81A 4FCEA 4JD0A 3SX7A 1NF5B 1LL3A 2Y4LA 1JV1A 1QG8A 2WEEA 2BO7A 4ASJA 2A8UA 4BMAA 1R82A 1R7TA 3PKQA 5C36A 1VGWA 3I0IX 1H4DA 4J18A 4ZDQA 1O7QA 1H5SD 1MP4A 4Y7TA 4B2XA 3F1YA 1ZJ0A 5IFYA 2PA4A 2W0VA 3EE5A 1HM8A 3LW6A 2WVKA 1G3LA 1TZFA 1W55A 4MIXA 2AH9A 3I0CA 2RJ6A 1O0RA 1FO9A 1R7YA 5J49A 1H5SB 4HCQA 5IDSA 4FRLA 2RIYA 1GWWA 2XWNA 4Y7FA 5C49A 2AM3A 3FWWA 1S4NA 1G9RA 4G3PA 5CMFX 5C1GA 5L6SA 3BCVA 4KXOA 5C4DA 4DECA 3D8VA 3K8EA 1ZJPA 1EYRA 2WGZA 1WT3A 4LW3A 4HO2A 1LZJA 4D11A 2E8BA 3POLA 4B4BA 4IRPA 3U2VA 2I5KA 3JUJA 3RSBA 1ZI4A 1ZJOA 2NXVA 4E1KA 1R7XA 4FROA 1ON6A 5FYEA 1PZYB 4HO9A 1FWYA 2BO6A 3T7OA 1WT1A 2Y4MA 1OMXA 5C4EA 1INIA 1HJLA 2YQCA 3U2WA 4AYJA 1ZIZA 1GX4A 5DDTA 2AECA 2VSIA 5C4BA 1VM8A 3FOQA 5CQPA 5D91A 1H4CA 4D11C 4Y7UA 5C1HA 5CQOA 2AGDA 4B4MA 3OGZA 5D92A 2Z87A 3CKVA 2RJ8A 3K8DA 1H3MA 2J0AA 2JCLA 4G3SA 4DE7A 3I0HA 4ASYA 2V0KA 1TVYA 1ZI3A 4EVWA 1NQIB 3V91A 2RIXA 2X60A 1JVGA 4G3QA 3T7NA 3CGXA 2RIZA 3DUVA 4FRMA 4CVHA 4HG6A 2J0BA 1H5RA 5FUHA 4O6NA 4HO0A 5L6VA 1V84A 4Q7CA 2PX7A 3SX3A 3I0GA 1G93A 4FRAA 2JCJA 3SXDA 1KWSA 1H4EA 5AJPA 5C3DA 4B4GA 1ZJ3A 3I0LA 2VSHA 1GQCA 1YP3A 2XWMA 2FFVA 2D7RA 3Q4SA 1H5SC 3SX5A 3ZF8A 1LZ0A 1FRWA 3OH2A 1GA8A 2RJ0A 4AYLA 4C2SA 1G8OA 3SX8A 1G23A 2FY7A 2X65A 5CQMX 3ZLLA 4Y6UA 3V8YA 2C0NA 4NAKA 4Y63A 1HM9A 4M2AA 4FRHA 1VH3A 2JCOA 3RMVA 2OEGA 1WVCA 2FYAA 1TW5A 3U2UA 5IDTA 3V0LA 1FXOA 4M4KA 2XMHA 1VPAA 2RJ4A 2RJ7A 4DDZA 4NAIA 3O3PA 3I0FA 1G1LA 5CMHA 1H5TB 5CQLX 5FV9A 3I0KA 2W0WA 4EE3A 2ZU9A 2V0HA 4EE5A 2ZU8A 3DK5A 1FG5N 4D0TA 4HO8A 4G87A 3NGWA 3E25A 3R2WA 5AJOA 1HV9A 1MP3A 1FO8A 1NKHB 3JUKA 4HO4A 3SXCA 2OI7A 1G0RA 4KQLA 4KC4A 4B5BA 2O1FA 5C4FA 2Y7AA 1R7VA 2I5EA 4KC1A 2X5SA 5BXCA 3T7MA 3TZTA 1H7TA 4JISA 1W77A 3D5NA 4FRQA 4FRPA 4Y62A 1OQMB 2BO8A 2ZU7A 3USRA 2D7IA 2YCMA 1VICA 1ZDFA 2OI6A 4B3UA 5JQQA 1ZDGA 2JCKA 4EEMA 4EEAA 2YESA 4M28A 1G97A 3USQA 5C4CA 4MYBA 2VS3A 1QGSA 3ZGFA 1G2VA 2AM4A 1H5SA 3OH4A 2RJ5A 4FRDA 4XWIA 4B42A 3U2TA 4Y64A 2YQSA 1JV3A 2QH5A 3DJ4A 5DDVA 5HS2A 1VH1A 4KC2A 3QVBA 4NANA 2Y6PA 3SXGA 4HO6A 4Y6NA 1IINA 1H7LA 2XMEA 5C3AA 2P73A 2AE7A 3SXEA 2QGIA 3V0MA 5FU0A 4Y7GA 1SS9A 4NALA 3V90A 1JYLA 1FOAA 5CQNX 1ZCVA 1O7OA 1GQ9A 4D48A 1H7QA 3I0JA 1LL2A 2P6WA 1LL0A 1VGUA 1V82A 4B2WA 2WAWA 4KPZA 1IIMA 3U0YA 3ZGGA 2WVLA 3U0XA 1FR8A 3V0OA 2BO4A 4AC3A 5EIYA 4HOCA 5CMGX 3CU0A 1VZXA 5EJZA 1GWVA 1WT2A 3V0NA 1YP4A 3OC9A 1NMMB 5CMIA 2FFUA 1R80A 3JTJA 2OEFA 2VD4A 2RJ1A 4LW6A 3F1CA 4P00A 3V8ZA 2AESA 2VXLA 1NWGB 3CKOA 2GGQA 3R3IA 4KNXA 3SPTA 1VZTA 1H7GA 2VS5A 1K4VA 1INJA 4UEGA 5FTVA 2FYCB 3V0QA 4ECMA 1OMZA 3N9WA 1YP2A 2V0JA 1LZ7A 4KNRA 2ICYA 5FU8A 1VGTA 2YQJA 5AJNA 1GX0A 4HO5A 2V0IA 1FZWA 1EZIA 1G95A 4AAWA 2Q4JA 1WSZA 1LVWA 3HL3A 2CU2A 3GUEA 2RITA 4CJ8A 3Q7UA 4YS8A
chains in the Genus database with same CATH topology
1ZCYA 4K6RA 1WT0A 1H7EA 4FIYA 2A8WA 2P72A 5C38A 4ARWA 1Z90A 1MC3A 4GBPA 1H5RB 1FXJA 3OAMA 4MNDA 1LZIA 1E5KA 3ZLKA 4D0ZA 1I52A 3OH3A 2WE9A 1ZI1A 2FYDB 1H7HA 2X5ZA 3Q80A 3CKJA 3KIAA 3OH1A 1TW1A 2PGVA 2VS4A 1XHBA 1FR9A 1V83A 2FYBA 5CMJA 2APCA 1QWJA 1MP5A 1ZCUA 4O6MA 4M2BA 5FTSA 3PNNA 4EEGA 3D98A 3SXAA 3I0DA 2I7BA 3SXBA 1O23B 1ON8A 2Y4KA 4KPXA 1S4PA 1ZCTA 3U2XA 2YQHA 3IOHA 2O1HA 4BQHA 2E3DA 1FGGA 1S4OA 2DPWA 1ZHJA 4L41C 1HM0A 3OH0A 2RJ9A 2GGOA 4EEOA 4P02A 5C3BA 2Z86A 2VFZA 3I0EA 3PKPA 4FQWA 3IOIA 2Y4JA 4FIXA 1FGXA 1JYKA 3V0PA 2PGYA 3BRKX 3IOJA 1JVDA 2ICXA 4KT7A 2OI5A 2MZBA 1H5TA 1ZI5A 2UX8A 5C1LA 5I1FA 3CKNA 4FCUA 1NHEB 2XWLA 2O1GA 1ZJ2A 5C8RA 1QGQA 4HO3A 3TQDA 4CJCA 4FREA 1PZTA 1H7FA 1R7UA 2VXMA 2QKXA 2D0JA 3CKQA 3OKRA 4IRQA 5C47A 5C48A 1XZ6A 2VK9A 2AM5A 4Y7VA 1ZJ1A 4CJBA 1W57A 2YC3A 1VZUA 2WVMA 4KRVA 5EJ1A 2V0LA 2YC5A 3E26A 4Y9XA 4EE4A 4FRBA 3RMWA 1YROB 3ST8A 1VGZA 4R7PA 1HJJA 1R81A 4FCEA 4JD0A 3SX7A 1NF5B 1LL3A 2Y4LA 1JV1A 1QG8A 2WEEA 2BO7A 4ASJA 2A8UA 4BMAA 1R82A 1R7TA 3PKQA 5C36A 1VGWA 3I0IX 1H4DA 4J18A 4ZDQA 1O7QA 1H5SD 1MP4A 4Y7TA 4B2XA 3F1YA 1ZJ0A 5IFYA 2PA4A 2W0VA 3EE5A 1HM8A 3LW6A 2WVKA 1G3LA 1TZFA 1W55A 4MIXA 2AH9A 3I0CA 2RJ6A 1O0RA 1FO9A 1R7YA 5J49A 1H5SB 4HCQA 5IDSA 4FRLA 2RIYA 1GWWA 2XWNA 4Y7FA 5C49A 2AM3A 3FWWA 1S4NA 1G9RA 4G3PA 5CMFX 5C1GA 5L6SA 3BCVA 4KXOA 5C4DA 4DECA 3D8VA 3K8EA 1ZJPA 1EYRA 2WGZA 1WT3A 4LW3A 4HO2A 1LZJA 4D11A 2E8BA 3POLA 4B4BA 4IRPA 3U2VA 2I5KA 3JUJA 3RSBA 1ZI4A 1ZJOA 2NXVA 4E1KA 1R7XA 4FROA 1ON6A 5FYEA 1PZYB 4HO9A 1FWYA 2BO6A 3T7OA 1WT1A 2Y4MA 1OMXA 5C4EA 1INIA 1HJLA 2YQCA 3U2WA 4AYJA 1ZIZA 1GX4A 5DDTA 2AECA 2VSIA 5C4BA 1VM8A 3FOQA 5CQPA 5D91A 1H4CA 4D11C 4Y7UA 5C1HA 5CQOA 2AGDA 4B4MA 3OGZA 5D92A 2Z87A 3CKVA 2RJ8A 3K8DA 1H3MA 2J0AA 2JCLA 4G3SA 4DE7A 3I0HA 4ASYA 2V0KA 1TVYA 1ZI3A 4EVWA 1NQIB 3V91A 2RIXA 2X60A 1JVGA 4G3QA 3T7NA 3CGXA 2RIZA 3DUVA 4FRMA 4CVHA 4HG6A 2J0BA 1H5RA 5FUHA 4O6NA 4HO0A 5L6VA 1V84A 4Q7CA 2PX7A 3SX3A 3I0GA 1G93A 4FRAA 2JCJA 3SXDA 1KWSA 1H4EA 5AJPA 5C3DA 4B4GA 1ZJ3A 3I0LA 2VSHA 1GQCA 1YP3A 2XWMA 2FFVA 2D7RA 3Q4SA 1H5SC 3SX5A 3ZF8A 1LZ0A 1FRWA 3OH2A 1GA8A 2RJ0A 4AYLA 4C2SA 1G8OA 3SX8A 1G23A 2FY7A 2X65A 5CQMX 3ZLLA 4Y6UA 3V8YA 2C0NA 4NAKA 4Y63A 1HM9A 4M2AA 4FRHA 1VH3A 2JCOA 3RMVA 2OEGA 1WVCA 2FYAA 1TW5A 3U2UA 5IDTA 3V0LA 1FXOA 4M4KA 2XMHA 1VPAA 2RJ4A 2RJ7A 4DDZA 4NAIA 3O3PA 3I0FA 1G1LA 5CMHA 1H5TB 5CQLX 5FV9A 3I0KA 2W0WA 4EE3A 2ZU9A 2V0HA 4EE5A 2ZU8A 3DK5A 1FG5N 4D0TA 4HO8A 4G87A 3NGWA 3E25A 3R2WA 5AJOA 1HV9A 1MP3A 1FO8A 1NKHB 3JUKA 4HO4A 3SXCA 2OI7A 1G0RA 4KQLA 4KC4A 4B5BA 2O1FA 5C4FA 2Y7AA 1R7VA 2I5EA 4KC1A 2X5SA 5BXCA 3T7MA 3TZTA 1H7TA 4JISA 1W77A 3D5NA 4FRQA 4FRPA 4Y62A 1OQMB 2BO8A 2ZU7A 3USRA 2D7IA 2YCMA 1VICA 1ZDFA 2OI6A 4B3UA 5JQQA 1ZDGA 2JCKA 4EEMA 4EEAA 2YESA 4M28A 1G97A 3USQA 5C4CA 4MYBA 2VS3A 1QGSA 3ZGFA 1G2VA 2AM4A 1H5SA 3OH4A 2RJ5A 4FRDA 4XWIA 4B42A 3U2TA 4Y64A 2YQSA 1JV3A 2QH5A 3DJ4A 5DDVA 5HS2A 1VH1A 4KC2A 3QVBA 4NANA 2Y6PA 3SXGA 4HO6A 4Y6NA 1IINA 1H7LA 2XMEA 5C3AA 2P73A 2AE7A 3SXEA 2QGIA 3V0MA 5FU0A 4Y7GA 1SS9A 4NALA 3V90A 1JYLA 1FOAA 5CQNX 1ZCVA 1O7OA 1GQ9A 4D48A 1H7QA 3I0JA 1LL2A 2P6WA 1LL0A 1VGUA 1V82A 4B2WA 2WAWA 4KPZA 1IIMA 3U0YA 3ZGGA 2WVLA 3U0XA 1FR8A 3V0OA 2BO4A 4AC3A 5EIYA 4HOCA 5CMGX 3CU0A 1VZXA 5EJZA 1GWVA 1WT2A 3V0NA 1YP4A 3OC9A 1NMMB 5CMIA 2FFUA 1R80A 3JTJA 2OEFA 2VD4A 2RJ1A 4LW6A 3F1CA 4P00A 3V8ZA 2AESA 2VXLA 1NWGB 3CKOA 2GGQA 3R3IA 4KNXA 3SPTA 1VZTA 1H7GA 2VS5A 1K4VA 1INJA 4UEGA 5FTVA 2FYCB 3V0QA 4ECMA 1OMZA 3N9WA 1YP2A 2V0JA 1LZ7A 4KNRA 2ICYA 5FU8A 1VGTA 2YQJA 5AJNA 1GX0A 4HO5A 2V0IA 1FZWA 1EZIA 1G95A 4AAWA 2Q4JA 1WSZA 1LVWA 3HL3A 2CU2A 3GUEA 2RITA 4CJ8A 3Q7UA 4YS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCY A;  4K6R A;  1WT0 A;  1H7E A;  2A8W A;  2P72 A;  5C38 A;  4ARW A;  1Z90 A;  1MC3 A;  4GBP A;  1H5R B;  1FXJ A;  3OAM A;  4MND A;  1LZI A;  1E5K A;  3ZLK A;  4D0Z A;  1I52 A;  3OH3 A;  2WE9 A;  1ZI1 A;  2FYD B;  1H7H A;  2X5Z A;  3Q80 A;  3CKJ A;  3KIA A;  3OH1 A;  1TW1 A;  2PGV A;  2VS4 A;  1XHB A;  1FR9 A;  1V83 A;  2FYB A;  5CMJ A;  2APC A;  1QWJ A;  1MP5 A;  1ZCU A;  5FTS A;  4M2B A;  3PNN A;  4EEG A;  3D98 A;  3SXA A;  3I0D A;  2I7B A;  3SXB A;  1O23 B;  1ON8 A;  2Y4K A;  4KPX A;  1S4P A;  1ZCT A;  3U2X A;  2YQH A;  3IOH A;  2O1H A;  4BQH A;  2E3D A;  1FGG A;  1S4O A;  2DPW A;  1ZHJ A;  4L41 C;  1HM0 A;  3OH0 A;  2RJ9 A;  2GGO A;  4EEO A;  4P02 A;  5C3B A;  2Z86 A;  2VFZ A;  3I0E A;  3PKP A;  4FQW A;  3IOI A;  2Y4J A;  1FGX A;  1JYK A;  3V0P A;  2PGY A;  3BRK X;  3IOJ A;  1JVD A;  2ICX A;  4KT7 A;  2OI5 A;  2MZB A;  1H5T A;  1ZI5 A;  2UX8 A;  5C1L A;  5I1F A;  3CKN A;  4FCU A;  1NHE B;  2XWL A;  2O1G A;  1ZJ2 A;  5C8R A;  1QGQ A;  4HO3 A;  3TQD A;  4CJC A;  4FRE A;  1PZT A;  1H7F A;  1R7U A;  2VXM A;  2QKX A;  2D0J A;  3CKQ A;  3OKR A;  4IRQ A;  5C47 A;  5C48 A;  1XZ6 A;  2AM5 A;  4Y7V A;  1ZJ1 A;  4CJB A;  1W57 A;  2YC3 A;  1VZU A;  2WVM A;  4KRV A;  5EJ1 A;  2V0L A;  2YC5 A;  3E26 A;  4Y9X A;  4EE4 A;  4FRB A;  3RMW A;  1YRO B;  3ST8 A;  1VGZ A;  4R7P A;  1HJJ A;  1R81 A;  4FCE A;  4JD0 A;  3SX7 A;  1NF5 B;  1LL3 A;  2Y4L A;  1JV1 A;  1QG8 A;  2WEE A;  2BO7 A;  4ASJ A;  2A8U A;  4BMA A;  1R82 A;  1R7T A;  3PKQ A;  5C36 A;  1VGW A;  3I0I X;  1H4D A;  4J18 A;  4ZDQ A;  1O7Q A;  1H5S D;  1MP4 A;  4Y7T A;  4B2X A;  3F1Y A;  1ZJ0 A;  5IFY A;  2PA4 A;  2W0V A;  3EE5 A;  1HM8 A;  3LW6 A;  2WVK A;  1G3L A;  1TZF A;  1W55 A;  2AH9 A;  3I0C A;  2RJ6 A;  1O0R A;  1FO9 A;  1R7Y A;  5J49 A;  1H5S B;  4HCQ A;  5IDS A;  4FRL A;  2RIY A;  1GWW A;  2XWN A;  4Y7F A;  5C49 A;  2AM3 A;  3FWW A;  1S4N A;  1G9R A;  4G3P A;  5CMF X;  5C1G A;  5L6S A;  3BCV A;  4KXO A;  5C4D A;  4DEC A;  3D8V A;  3K8E A;  1ZJP A;  1EYR A;  2WGZ A;  1WT3 A;  4LW3 A;  4HO2 A;  1LZJ A;  4D11 A;  2E8B A;  3POL A;  4B4B A;  4IRP A;  3U2V A;  2I5K A;  3JUJ A;  3RSB A;  1ZI4 A;  1ZJO A;  2NXV A;  4E1K A;  1R7X A;  4FRO A;  1ON6 A;  5FYE A;  1PZY B;  4HO9 A;  1FWY A;  2BO6 A;  3T7O A;  1WT1 A;  2Y4M A;  1OMX A;  5C4E A;  1INI A;  1HJL A;  2YQC A;  3U2W A;  4AYJ A;  1ZIZ A;  1GX4 A;  5DDT A;  2AEC A;  2VSI A;  5C4B A;  1VM8 A;  3FOQ A;  5CQP A;  1H4C A;  4D11 C;  4Y7U A;  5C1H A;  5CQO A;  2AGD A;  4B4M A;  3OGZ A;  2Z87 A;  3CKV A;  2RJ8 A;  3K8D A;  1H3M A;  2JCL A;  4G3S A;  4DE7 A;  3I0H A;  4ASY A;  2V0K A;  1TVY A;  1ZI3 A;  4EVW A;  1NQI B;  3V91 A;  2RIX A;  2X60 A;  1JVG A;  4G3Q A;  3T7N A;  3CGX A;  2RIZ A;  3DUV A;  4FRM A;  4CVH A;  4HG6 A;  1H5R A;  5FUH A;  4HO0 A;  5L6V A;  1V84 A;  2PX7 A;  3SX3 A;  3I0G A;  1G93 A;  4FRA A;  2JCJ A;  3SXD A;  1KWS A;  1H4E A;  5AJP A;  5C3D A;  4B4G A;  1ZJ3 A;  3I0L A;  2VSH A;  1GQC A;  1YP3 A;  2XWM A;  2FFV A;  2D7R A;  3Q4S A;  1H5S C;  3SX5 A;  3ZF8 A;  1LZ0 A;  1FRW A;  3OH2 A;  1GA8 A;  2RJ0 A;  4AYL A;  4C2S A;  1G8O A;  3SX8 A;  1G23 A;  2FY7 A;  2X65 A;  5CQM X;  3ZLL A;  4Y6U A;  3V8Y A;  4NAK A;  4Y63 A;  1HM9 A;  4M2A A;  4FRH A;  1VH3 A;  2JCO A;  3RMV A;  2OEG A;  1WVC A;  2FYA A;  1TW5 A;  3U2U A;  5IDT A;  3V0L A;  1FXO A;  4M4K A;  2XMH A;  1VPA A;  2RJ4 A;  2RJ7 A;  4DDZ A;  4NAI A;  3O3P A;  3I0F A;  1G1L A;  5CMH A;  1H5T B;  5CQL X;  5FV9 A;  3I0K A;  2W0W A;  4EE3 A;  2ZU9 A;  2V0H A;  4EE5 A;  2ZU8 A;  3DK5 A;  1FG5 N;  4D0T A;  4HO8 A;  4G87 A;  3NGW A;  3E25 A;  3R2W A;  5AJO A;  1HV9 A;  1MP3 A;  1FO8 A;  1NKH B;  3JUK A;  4HO4 A;  3SXC A;  2OI7 A;  1G0R A;  4KQL A;  4KC4 A;  4B5B A;  2O1F A;  5C4F A;  2Y7A A;  1R7V A;  2I5E A;  4KC1 A;  2X5S A;  5BXC A;  3T7M A;  3TZT A;  1H7T A;  4JIS A;  1W77 A;  3D5N A;  4FRQ A;  4FRP A;  4Y62 A;  1OQM B;  2BO8 A;  2ZU7 A;  3USR A;  2D7I A;  2YCM A;  1VIC A;  1ZDF A;  2OI6 A;  4B3U A;  5JQQ A;  1ZDG A;  2JCK A;  4EEM A;  4EEA A;  2YES A;  4M28 A;  1G97 A;  3USQ A;  5C4C A;  4MYB A;  2VS3 A;  1QGS A;  3ZGF A;  1G2V A;  2AM4 A;  1H5S A;  3OH4 A;  2RJ5 A;  4FRD A;  4XWI A;  4B42 A;  3U2T A;  4Y64 A;  2YQS A;  1JV3 A;  2QH5 A;  3DJ4 A;  5DDV A;  5HS2 A;  1VH1 A;  4KC2 A;  3QVB A;  4NAN A;  2Y6P A;  3SXG A;  4HO6 A;  4Y6N A;  1IIN A;  1H7L A;  2XME A;  5C3A A;  2P73 A;  2AE7 A;  3SXE A;  2QGI A;  3V0M A;  5FU0 A;  4Y7G A;  1SS9 A;  4NAL A;  3V90 A;  1JYL A;  1FOA A;  5CQN X;  1ZCV A;  1O7O A;  1GQ9 A;  4D48 A;  1H7Q A;  3I0J A;  1LL2 A;  2P6W A;  1LL0 A;  1VGU A;  1V82 A;  4B2W A;  2WAW A;  4KPZ A;  1IIM A;  3U0Y A;  3ZGG A;  2WVL A;  3U0X A;  1FR8 A;  3V0O A;  2BO4 A;  4AC3 A;  5EIY A;  4HOC A;  5CMG X;  3CU0 A;  1VZX A;  5EJZ A;  1GWV A;  1WT2 A;  3V0N A;  1YP4 A;  3OC9 A;  1NMM B;  5CMI A;  2FFU A;  1R80 A;  3JTJ A;  2OEF A;  2VD4 A;  2RJ1 A;  4LW6 A;  3F1C A;  4P00 A;  3V8Z A;  2AES A;  2VXL A;  1NWG B;  3CKO A;  2GGQ A;  3R3I A;  4KNX A;  3SPT A;  1VZT A;  1H7G A;  2VS5 A;  1K4V A;  1INJ A;  4UEG A;  5FTV A;  2FYC B;  3V0Q A;  4ECM A;  1OMZ A;  3N9W A;  1YP2 A;  2V0J A;  1LZ7 A;  4KNR A;  2ICY A;  5FU8 A;  1VGT A;  2YQJ A;  5AJN A;  1GX0 A;  4HO5 A;  2V0I A;  1FZW A;  1EZI A;  1G95 A;  4AAW A;  2Q4J A;  1WSZ A;  1LVW A;  3HL3 A;  2CU2 A;  3GUE A;  2RIT A;  4CJ8 A;  3Q7U A;  4YS8 A; 
#chains in the Genus database with same CATH topology
 1ZCY A;  4K6R A;  1WT0 A;  1H7E A;  4FIY A;  2A8W A;  2P72 A;  5C38 A;  4ARW A;  1Z90 A;  1MC3 A;  4GBP A;  1H5R B;  1FXJ A;  3OAM A;  4MND A;  1LZI A;  1E5K A;  3ZLK A;  4D0Z A;  1I52 A;  3OH3 A;  2WE9 A;  1ZI1 A;  2FYD B;  1H7H A;  2X5Z A;  3Q80 A;  3CKJ A;  3KIA A;  3OH1 A;  1TW1 A;  2PGV A;  2VS4 A;  1XHB A;  1FR9 A;  1V83 A;  2FYB A;  5CMJ A;  2APC A;  1QWJ A;  1MP5 A;  1ZCU A;  4O6M A;  4M2B A;  5FTS A;  3PNN A;  4EEG A;  3D98 A;  3SXA A;  3I0D A;  2I7B A;  3SXB A;  1O23 B;  1ON8 A;  2Y4K A;  4KPX A;  1S4P A;  1ZCT A;  3U2X A;  2YQH A;  3IOH A;  2O1H A;  4BQH A;  2E3D A;  1FGG A;  1S4O A;  2DPW A;  1ZHJ A;  4L41 C;  1HM0 A;  3OH0 A;  2RJ9 A;  2GGO A;  4EEO A;  4P02 A;  5C3B A;  2Z86 A;  2VFZ A;  3I0E A;  3PKP A;  4FQW A;  3IOI A;  2Y4J A;  4FIX A;  1FGX A;  1JYK A;  3V0P A;  2PGY A;  3BRK X;  3IOJ A;  1JVD A;  2ICX A;  4KT7 A;  2OI5 A;  2MZB A;  1H5T A;  1ZI5 A;  2UX8 A;  5C1L A;  5I1F A;  3CKN A;  4FCU A;  1NHE B;  2XWL A;  2O1G A;  1ZJ2 A;  5C8R A;  1QGQ A;  4HO3 A;  3TQD A;  4CJC A;  4FRE A;  1PZT A;  1H7F A;  1R7U A;  2VXM A;  2QKX A;  2D0J A;  3CKQ A;  3OKR A;  4IRQ A;  5C47 A;  5C48 A;  1XZ6 A;  2VK9 A;  2AM5 A;  4Y7V A;  1ZJ1 A;  4CJB A;  1W57 A;  2YC3 A;  1VZU A;  2WVM A;  4KRV A;  5EJ1 A;  2V0L A;  2YC5 A;  3E26 A;  4Y9X A;  4EE4 A;  4FRB A;  3RMW A;  1YRO B;  3ST8 A;  1VGZ A;  4R7P A;  1HJJ A;  1R81 A;  4FCE A;  4JD0 A;  3SX7 A;  1NF5 B;  1LL3 A;  2Y4L A;  1JV1 A;  1QG8 A;  2WEE A;  2BO7 A;  4ASJ A;  2A8U A;  4BMA A;  1R82 A;  1R7T A;  3PKQ A;  5C36 A;  1VGW A;  3I0I X;  1H4D A;  4J18 A;  4ZDQ A;  1O7Q A;  1H5S D;  1MP4 A;  4Y7T A;  4B2X A;  3F1Y A;  1ZJ0 A;  5IFY A;  2PA4 A;  2W0V A;  3EE5 A;  1HM8 A;  3LW6 A;  2WVK A;  1G3L A;  1TZF A;  1W55 A;  4MIX A;  2AH9 A;  3I0C A;  2RJ6 A;  1O0R A;  1FO9 A;  1R7Y A;  5J49 A;  1H5S B;  4HCQ A;  5IDS A;  4FRL A;  2RIY A;  1GWW A;  2XWN A;  4Y7F A;  5C49 A;  2AM3 A;  3FWW A;  1S4N A;  1G9R A;  4G3P A;  5CMF X;  5C1G A;  5L6S A;  3BCV A;  4KXO A;  5C4D A;  4DEC A;  3D8V A;  3K8E A;  1ZJP A;  1EYR A;  2WGZ A;  1WT3 A;  4LW3 A;  4HO2 A;  1LZJ A;  4D11 A;  2E8B A;  3POL A;  4B4B A;  4IRP A;  3U2V A;  2I5K A;  3JUJ A;  3RSB A;  1ZI4 A;  1ZJO A;  2NXV A;  4E1K A;  1R7X A;  4FRO A;  1ON6 A;  5FYE A;  1PZY B;  4HO9 A;  1FWY A;  2BO6 A;  3T7O A;  1WT1 A;  2Y4M A;  1OMX A;  5C4E A;  1INI A;  1HJL A;  2YQC A;  3U2W A;  4AYJ A;  1ZIZ A;  1GX4 A;  5DDT A;  2AEC A;  2VSI A;  5C4B A;  1VM8 A;  3FOQ A;  5CQP A;  5D91 A;  1H4C A;  4D11 C;  4Y7U A;  5C1H A;  5CQO A;  2AGD A;  4B4M A;  3OGZ A;  5D92 A;  2Z87 A;  3CKV A;  2RJ8 A;  3K8D A;  1H3M A;  2J0A A;  2JCL A;  4G3S A;  4DE7 A;  3I0H A;  4ASY A;  2V0K A;  1TVY A;  1ZI3 A;  4EVW A;  1NQI B;  3V91 A;  2RIX A;  2X60 A;  1JVG A;  4G3Q A;  3T7N A;  3CGX A;  2RIZ A;  3DUV A;  4FRM A;  4CVH A;  4HG6 A;  2J0B A;  1H5R A;  5FUH A;  4O6N A;  4HO0 A;  5L6V A;  1V84 A;  4Q7C A;  2PX7 A;  3SX3 A;  3I0G A;  1G93 A;  4FRA A;  2JCJ A;  3SXD A;  1KWS A;  1H4E A;  5AJP A;  5C3D A;  4B4G A;  1ZJ3 A;  3I0L A;  2VSH A;  1GQC A;  1YP3 A;  2XWM A;  2FFV A;  2D7R A;  3Q4S A;  1H5S C;  3SX5 A;  3ZF8 A;  1LZ0 A;  1FRW A;  3OH2 A;  1GA8 A;  2RJ0 A;  4AYL A;  4C2S A;  1G8O A;  3SX8 A;  1G23 A;  2FY7 A;  2X65 A;  5CQM X;  3ZLL A;  4Y6U A;  3V8Y A;  2C0N A;  4NAK A;  4Y63 A;  1HM9 A;  4M2A A;  4FRH A;  1VH3 A;  2JCO A;  3RMV A;  2OEG A;  1WVC A;  2FYA A;  1TW5 A;  3U2U A;  5IDT A;  3V0L A;  1FXO A;  4M4K A;  2XMH A;  1VPA A;  2RJ4 A;  2RJ7 A;  4DDZ A;  4NAI A;  3O3P A;  3I0F A;  1G1L A;  5CMH A;  1H5T B;  5CQL X;  5FV9 A;  3I0K A;  2W0W A;  4EE3 A;  2ZU9 A;  2V0H A;  4EE5 A;  2ZU8 A;  3DK5 A;  1FG5 N;  4D0T A;  4HO8 A;  4G87 A;  3NGW A;  3E25 A;  3R2W A;  5AJO A;  1HV9 A;  1MP3 A;  1FO8 A;  1NKH B;  3JUK A;  4HO4 A;  3SXC A;  2OI7 A;  1G0R A;  4KQL A;  4KC4 A;  4B5B A;  2O1F A;  5C4F A;  2Y7A A;  1R7V A;  2I5E A;  4KC1 A;  2X5S A;  5BXC A;  3T7M A;  3TZT A;  1H7T A;  4JIS A;  1W77 A;  3D5N A;  4FRQ A;  4FRP A;  4Y62 A;  1OQM B;  2BO8 A;  2ZU7 A;  3USR A;  2D7I A;  2YCM A;  1VIC A;  1ZDF A;  2OI6 A;  4B3U A;  5JQQ A;  1ZDG A;  2JCK A;  4EEM A;  4EEA A;  2YES A;  4M28 A;  1G97 A;  3USQ A;  5C4C A;  4MYB A;  2VS3 A;  1QGS A;  3ZGF A;  1G2V A;  2AM4 A;  1H5S A;  3OH4 A;  2RJ5 A;  4FRD A;  4XWI A;  4B42 A;  3U2T A;  4Y64 A;  2YQS A;  1JV3 A;  2QH5 A;  3DJ4 A;  5DDV A;  5HS2 A;  1VH1 A;  4KC2 A;  3QVB A;  4NAN A;  2Y6P A;  3SXG A;  4HO6 A;  4Y6N A;  1IIN A;  1H7L A;  2XME A;  5C3A A;  2P73 A;  2AE7 A;  3SXE A;  2QGI A;  3V0M A;  5FU0 A;  4Y7G A;  1SS9 A;  4NAL A;  3V90 A;  1JYL A;  1FOA A;  5CQN X;  1ZCV A;  1O7O A;  1GQ9 A;  4D48 A;  1H7Q A;  3I0J A;  1LL2 A;  2P6W A;  1LL0 A;  1VGU A;  1V82 A;  4B2W A;  2WAW A;  4KPZ A;  1IIM A;  3U0Y A;  3ZGG A;  2WVL A;  3U0X A;  1FR8 A;  3V0O A;  2BO4 A;  4AC3 A;  5EIY A;  4HOC A;  5CMG X;  3CU0 A;  1VZX A;  5EJZ A;  1GWV A;  1WT2 A;  3V0N A;  1YP4 A;  3OC9 A;  1NMM B;  5CMI A;  2FFU A;  1R80 A;  3JTJ A;  2OEF A;  2VD4 A;  2RJ1 A;  4LW6 A;  3F1C A;  4P00 A;  3V8Z A;  2AES A;  2VXL A;  1NWG B;  3CKO A;  2GGQ A;  3R3I A;  4KNX A;  3SPT A;  1VZT A;  1H7G A;  2VS5 A;  1K4V A;  1INJ A;  4UEG A;  5FTV A;  2FYC B;  3V0Q A;  4ECM A;  1OMZ A;  3N9W A;  1YP2 A;  2V0J A;  1LZ7 A;  4KNR A;  2ICY A;  5FU8 A;  1VGT A;  2YQJ A;  5AJN A;  1GX0 A;  4HO5 A;  2V0I A;  1FZW A;  1EZI A;  1G95 A;  4AAW A;  2Q4J A;  1WSZ A;  1LVW A;  3HL3 A;  2CU2 A;  3GUE A;  2RIT A;  4CJ8 A;  3Q7U A;  4YS8 A; 
#chains in the Genus database with same CATH homology
 1ZCY A;  4K6R A;  1WT0 A;  1H7E A;  4FIY A;  2A8W A;  2P72 A;  5C38 A;  4ARW A;  1Z90 A;  1MC3 A;  4GBP A;  1H5R B;  1FXJ A;  3OAM A;  4MND A;  1LZI A;  1E5K A;  3ZLK A;  4D0Z A;  1I52 A;  3OH3 A;  2WE9 A;  1ZI1 A;  2FYD B;  1H7H A;  2X5Z A;  3Q80 A;  3CKJ A;  3KIA A;  3OH1 A;  1TW1 A;  2PGV A;  2VS4 A;  1XHB A;  1FR9 A;  1V83 A;  2FYB A;  5CMJ A;  2APC A;  1QWJ A;  1MP5 A;  1ZCU A;  4O6M A;  4M2B A;  5FTS A;  3PNN A;  4EEG A;  3D98 A;  3SXA A;  3I0D A;  2I7B A;  3SXB A;  1O23 B;  1ON8 A;  2Y4K A;  4KPX A;  1S4P A;  1ZCT A;  3U2X A;  2YQH A;  3IOH A;  2O1H A;  4BQH A;  2E3D A;  1FGG A;  1S4O A;  2DPW A;  1ZHJ A;  4L41 C;  1HM0 A;  3OH0 A;  2RJ9 A;  2GGO A;  4EEO A;  4P02 A;  5C3B A;  2Z86 A;  2VFZ A;  3I0E A;  3PKP A;  4FQW A;  3IOI A;  2Y4J A;  4FIX A;  1FGX A;  1JYK A;  3V0P A;  2PGY A;  3BRK X;  3IOJ A;  1JVD A;  2ICX A;  4KT7 A;  2OI5 A;  2MZB A;  1H5T A;  1ZI5 A;  2UX8 A;  5C1L A;  5I1F A;  3CKN A;  4FCU A;  1NHE B;  2XWL A;  2O1G A;  1ZJ2 A;  5C8R A;  1QGQ A;  4HO3 A;  3TQD A;  4CJC A;  4FRE A;  1PZT A;  1H7F A;  1R7U A;  2VXM A;  2QKX A;  2D0J A;  3CKQ A;  3OKR A;  4IRQ A;  5C47 A;  5C48 A;  1XZ6 A;  2VK9 A;  2AM5 A;  4Y7V A;  1ZJ1 A;  4CJB A;  1W57 A;  2YC3 A;  1VZU A;  2WVM A;  4KRV A;  5EJ1 A;  2V0L A;  2YC5 A;  3E26 A;  4Y9X A;  4EE4 A;  4FRB A;  3RMW A;  1YRO B;  3ST8 A;  1VGZ A;  4R7P A;  1HJJ A;  1R81 A;  4FCE A;  4JD0 A;  3SX7 A;  1NF5 B;  1LL3 A;  2Y4L A;  1JV1 A;  1QG8 A;  2WEE A;  2BO7 A;  4ASJ A;  2A8U A;  4BMA A;  1R82 A;  1R7T A;  3PKQ A;  5C36 A;  1VGW A;  3I0I X;  1H4D A;  4J18 A;  4ZDQ A;  1O7Q A;  1H5S D;  1MP4 A;  4Y7T A;  4B2X A;  3F1Y A;  1ZJ0 A;  5IFY A;  2PA4 A;  2W0V A;  3EE5 A;  1HM8 A;  3LW6 A;  2WVK A;  1G3L A;  1TZF A;  1W55 A;  4MIX A;  2AH9 A;  3I0C A;  2RJ6 A;  1O0R A;  1FO9 A;  1R7Y A;  5J49 A;  1H5S B;  4HCQ A;  5IDS A;  4FRL A;  2RIY A;  1GWW A;  2XWN A;  4Y7F A;  5C49 A;  2AM3 A;  3FWW A;  1S4N A;  1G9R A;  4G3P A;  5CMF X;  5C1G A;  5L6S A;  3BCV A;  4KXO A;  5C4D A;  4DEC A;  3D8V A;  3K8E A;  1ZJP A;  1EYR A;  2WGZ A;  1WT3 A;  4LW3 A;  4HO2 A;  1LZJ A;  4D11 A;  2E8B A;  3POL A;  4B4B A;  4IRP A;  3U2V A;  2I5K A;  3JUJ A;  3RSB A;  1ZI4 A;  1ZJO A;  2NXV A;  4E1K A;  1R7X A;  4FRO A;  1ON6 A;  5FYE A;  1PZY B;  4HO9 A;  1FWY A;  2BO6 A;  3T7O A;  1WT1 A;  2Y4M A;  1OMX A;  5C4E A;  1INI A;  1HJL A;  2YQC A;  3U2W A;  4AYJ A;  1ZIZ A;  1GX4 A;  5DDT A;  2AEC A;  2VSI A;  5C4B A;  1VM8 A;  3FOQ A;  5CQP A;  5D91 A;  1H4C A;  4D11 C;  4Y7U A;  5C1H A;  5CQO A;  2AGD A;  4B4M A;  3OGZ A;  5D92 A;  2Z87 A;  3CKV A;  2RJ8 A;  3K8D A;  1H3M A;  2J0A A;  2JCL A;  4G3S A;  4DE7 A;  3I0H A;  4ASY A;  2V0K A;  1TVY A;  1ZI3 A;  4EVW A;  1NQI B;  3V91 A;  2RIX A;  2X60 A;  1JVG A;  4G3Q A;  3T7N A;  3CGX A;  2RIZ A;  3DUV A;  4FRM A;  4CVH A;  4HG6 A;  2J0B A;  1H5R A;  5FUH A;  4O6N A;  4HO0 A;  5L6V A;  1V84 A;  4Q7C A;  2PX7 A;  3SX3 A;  3I0G A;  1G93 A;  4FRA A;  2JCJ A;  3SXD A;  1KWS A;  1H4E A;  5AJP A;  5C3D A;  4B4G A;  1ZJ3 A;  3I0L A;  2VSH A;  1GQC A;  1YP3 A;  2XWM A;  2FFV A;  2D7R A;  3Q4S A;  1H5S C;  3SX5 A;  3ZF8 A;  1LZ0 A;  1FRW A;  3OH2 A;  1GA8 A;  2RJ0 A;  4AYL A;  4C2S A;  1G8O A;  3SX8 A;  1G23 A;  2FY7 A;  2X65 A;  5CQM X;  3ZLL A;  4Y6U A;  3V8Y A;  2C0N A;  4NAK A;  4Y63 A;  1HM9 A;  4M2A A;  4FRH A;  1VH3 A;  2JCO A;  3RMV A;  2OEG A;  1WVC A;  2FYA A;  1TW5 A;  3U2U A;  5IDT A;  3V0L A;  1FXO A;  4M4K A;  2XMH A;  1VPA A;  2RJ4 A;  2RJ7 A;  4DDZ A;  4NAI A;  3O3P A;  3I0F A;  1G1L A;  5CMH A;  1H5T B;  5CQL X;  5FV9 A;  3I0K A;  2W0W A;  4EE3 A;  2ZU9 A;  2V0H A;  4EE5 A;  2ZU8 A;  3DK5 A;  1FG5 N;  4D0T A;  4HO8 A;  4G87 A;  3NGW A;  3E25 A;  3R2W A;  5AJO A;  1HV9 A;  1MP3 A;  1FO8 A;  1NKH B;  3JUK A;  4HO4 A;  3SXC A;  2OI7 A;  1G0R A;  4KQL A;  4KC4 A;  4B5B A;  2O1F A;  5C4F A;  2Y7A A;  1R7V A;  2I5E A;  4KC1 A;  2X5S A;  5BXC A;  3T7M A;  3TZT A;  1H7T A;  4JIS A;  1W77 A;  3D5N A;  4FRQ A;  4FRP A;  4Y62 A;  1OQM B;  2BO8 A;  2ZU7 A;  3USR A;  2D7I A;  2YCM A;  1VIC A;  1ZDF A;  2OI6 A;  4B3U A;  5JQQ A;  1ZDG A;  2JCK A;  4EEM A;  4EEA A;  2YES A;  4M28 A;  1G97 A;  3USQ A;  5C4C A;  4MYB A;  2VS3 A;  1QGS A;  3ZGF A;  1G2V A;  2AM4 A;  1H5S A;  3OH4 A;  2RJ5 A;  4FRD A;  4XWI A;  4B42 A;  3U2T A;  4Y64 A;  2YQS A;  1JV3 A;  2QH5 A;  3DJ4 A;  5DDV A;  5HS2 A;  1VH1 A;  4KC2 A;  3QVB A;  4NAN A;  2Y6P A;  3SXG A;  4HO6 A;  4Y6N A;  1IIN A;  1H7L A;  2XME A;  5C3A A;  2P73 A;  2AE7 A;  3SXE A;  2QGI A;  3V0M A;  5FU0 A;  4Y7G A;  1SS9 A;  4NAL A;  3V90 A;  1JYL A;  1FOA A;  5CQN X;  1ZCV A;  1O7O A;  1GQ9 A;  4D48 A;  1H7Q A;  3I0J A;  1LL2 A;  2P6W A;  1LL0 A;  1VGU A;  1V82 A;  4B2W A;  2WAW A;  4KPZ A;  1IIM A;  3U0Y A;  3ZGG A;  2WVL A;  3U0X A;  1FR8 A;  3V0O A;  2BO4 A;  4AC3 A;  5EIY A;  4HOC A;  5CMG X;  3CU0 A;  1VZX A;  5EJZ A;  1GWV A;  1WT2 A;  3V0N A;  1YP4 A;  3OC9 A;  1NMM B;  5CMI A;  2FFU A;  1R80 A;  3JTJ A;  2OEF A;  2VD4 A;  2RJ1 A;  4LW6 A;  3F1C A;  4P00 A;  3V8Z A;  2AES A;  2VXL A;  1NWG B;  3CKO A;  2GGQ A;  3R3I A;  4KNX A;  3SPT A;  1VZT A;  1H7G A;  2VS5 A;  1K4V A;  1INJ A;  4UEG A;  5FTV A;  2FYC B;  3V0Q A;  4ECM A;  1OMZ A;  3N9W A;  1YP2 A;  2V0J A;  1LZ7 A;  4KNR A;  2ICY A;  5FU8 A;  1VGT A;  2YQJ A;  5AJN A;  1GX0 A;  4HO5 A;  2V0I A;  1FZW A;  1EZI A;  1G95 A;  4AAW A;  2Q4J A;  1WSZ A;  1LVW A;  3HL3 A;  2CU2 A;  3GUE A;  2RIT A;  4CJ8 A;  3Q7U A;  4YS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...