1VZXA

Roles of active site tryptophans in substrate binding and catalysis by alpha-1,3 galactosyltransferase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQYHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVRNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Roles of active site tryptophans in substrate binding and catalysis by alpha-1,3 galactosyltransferase.
pubmed doi rcsb
source organism Bos taurus
total genus 108
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1vzxA00
1FRWA 4EVWA 2RIXA 2QH5A 2XWMA 3I0JA 1NF5B 5C47A 1G0RA 2ZU8A 1ZJ1A 1I52A 2Y6PA 3CU0A 4CVHA 4ARWA 4Y7GA 4G3PA 1H5TB 1QGQA 3U2VA 4M2AA 4FCUA 5FU0A 2ZU7A 4CJBA 1VH3A 1JV3A 2V0HA 3V0LA 4EEOA 2D0JA 3FOQA 3EE5A 3ZLKA 2JCLA 3CKOA 2RJ0A 4HO9A 3OH0A 1NKHB 2APCA 5FUHA 3TZTA 1H7FA 3I0IX 3D8VA 3ZF8A 1JV1A 5I1FA 5EJ1A 2YQCA 4EE3A 2RIZA 2WVMA 2WVKA 4GBPA 2DPWA 1WT3A 3CKJA 1LL0A 1O7QA 3O3PA 5L6VA 1R80A 3OH1A 3SX7A 4KNRA 1GX4A 1XZ6A 4FRAA 1HJJA 2BO7A 4CJCA 3HL3A 5C8RA 3V0PA 5C3BA 2YCMA 3U2WA 3OGZA 4EEMA 3LW6A 2V0IA 3IOIA 3OH3A 4B4GA 4EE4A 1GA8A 1H5TA 2Y4KA 3IOHA 4UEGA 2AM4A 1EYRA 4KC1A 5C49A 1LZ7A 1JVGA 1ZJ0A 1ZI5A 1INJA 1LVWA 4ZDQA 2VS5A 4DECA 1TVYA 4HO8A 2AECA 1ZHJA 4D11A 5C36A 5IFYA 2X5ZA 2QGIA 3BCVA 1FGGA 2FYCB 2XMHA 4YS8A 3Q4SA 5FU8A 1LZ0A 4FQWA 5IDTA 3E25A 1G9RA 1O7OA 3PKPA 1PZYB 2VFZA 5JQQA 5CQLX 4EEAA 1QG8A 3SPTA 3SXDA 2RITA 3JTJA 4IRQA 5DDVA 1ZDGA 1MP5A 2JCKA 3SX8A 1VGTA 2BO4A 4E1KA 1G93A 1GWWA 2A8WA 2PGYA 3R3IA 4HO5A 4BQHA 4FRDA 1G8OA 5AJPA 4AC3A 1FO9A 1W57A 2VSHA 4KQLA 2UX8A 1FO8A 4FRQA 1ZI4A 3I0DA 3K8DA 3DK5A 2I7BA 2X5SA 2VSIA 1ZCUA 5IDSA 1VZUA 3U0XA 1V82A 4D11C 4B2XA 2ICYA 2RJ7A 1FGXA 5C3DA 4NAKA 5C1HA 1O0RA 3FWWA 1JYLA 2I5EA 1W55A 2Y4LA 2WAWA 1VZTA 3V8ZA 2Y4MA 1ZCVA 3I0HA 4DE7A 4JISA 3RMWA 4EE5A 5C4FA 3OC9A 1ZJ3A 2WVLA 1H7QA 1WT0A 3SXGA 1LZIA 1OMXA 2AESA 1G23A 1R7VA 1HM9A 3OKRA 3QVBA 2JCJA 3V8YA 2RJ5A 3V91A 4LW6A 2P73A 4IRPA 4EEGA 5HS2A 2Q4JA 1R7XA 4G87A 1G3LA 3I0LA 1V84A 1LZJA 2E3DA 2V0LA 1VM8A 2VXLA 1OMZA 4KRVA 4M4KA 3U0YA 4Y64A 2AH9A 1KWSA 2VS4A 3GUEA 2X60A 3OH4A 3N9WA 5DDTA 5CQOA 1ZI3A 2VXMA 1FXJA 2VS3A 4Y7FA 1YP2A 3T7NA 4C2SA 2YQHA 5CMFX 5CMGX 1TZFA 1VICA 2YC5A 1G97A 1MP4A 1VGZA 1LL2A 1H5SA 2D7IA 4J18A 2OI5A 2AGDA 4HO4A 3U2UA 1JYKA 4HCQA 4XWIA 2Y7AA 2WGZA 4HO3A 4FRPA 3ZGFA 2A8UA 1S4PA 2JCOA 3F1YA 1R81A 3CKQA 4FRHA 1QWJA 1H7HA 1ZJPA 4L41C 3V0MA 2RJ1A 1WSZA 1VH1A 2AM5A 3T7MA 4KC4A 3DUVA 1IINA 2AM3A 1H7EA 4B42A 3V0NA 4DDZA 4FRBA 3D5NA 2ZU9A 1FOAA 1W77A 2FYBA 5FTSA 1FR8A 4NALA 1ZIZA 4B2WA 4NANA 1GX0A 1QGSA 4JD0A 2VD4A 1H3MA 3SX3A 3ZGGA 2D7RA 1R7UA 5FYEA 3PNNA 3CKNA 3V0OA 5CQPA 4HO0A 3Q80A 1H5SC 3I0CA 1H7TA 1H7LA 3I0KA 2GGOA 4Y6UA 1H4CA 5C38A 2GGQA 3USQA 2BO6A 1H4DA 2FYDB 3JUKA 1ZCTA 4Y7TA 3I0EA 3V0QA 4KPZA 1H7GA 4AYJA 1V83A 4B3UA 5EJZA 3BRKX 4G3QA 1TW1A 1FG5N 2PGVA 2RJ9A 1VGUA 4CJ8A 2WEEA 1YROB 2XMEA 1OQMB 1INIA 2P6WA 3JUJA 1H5SB 3OAMA 5L6SA 1FXOA 3ST8A 3D98A 5BXCA 4KXOA 2YQJA 1NHEB 3USRA 1O23B 2RJ6A 2RJ4A 1GQCA 2MZBA 4Y9XA 4B4MA 4FRLA 4D0TA 3SXCA 1ON6A 1NQIB 1NWGB 4FCEA 4HOCA 3I0FA 2V0KA 3U2XA 3T7OA 4MYBA 2BO8A 2E8BA 2ICXA 2W0VA 1ZJOA 2P72A 5CMJA 4Y63A 3SXEA 1LL3A 1R7YA 4ASYA 1HM8A 2I5KA 2OEGA 3Q7UA 2RIYA 4NAIA 1S4NA 1R82A 1SS9A 2OI7A 2FFVA 2FY7A 4AYLA 1FWYA 3F1CA 4P00A 1PZTA 1XHBA 2W0WA 5CQNX 3TQDA 1NMMB 4B5BA 2FFUA 1JVDA 1FZWA 4Y7UA 4KT7A 4Y6NA 4HO2A 1YP4A 4MNDA 1WVCA 1S4OA 3PKQA 3IOJA 3CKVA 4P02A 1G2VA 2Z86A 4D0ZA 2OEFA 1VGWA 4M28A 1G1LA 2X65A 1E5KA 5C4EA 5FTVA 1WT1A 1ZCYA 2Z87A 3CGXA 1VPAA 4HG6A 1H5SD 3U2TA 2XWNA 1VZXA 3SX5A 3RSBA 1R7TA 2OI6A 2WE9A 3E26A 3SXBA 5AJNA 4FROA 5C3AA 3R2WA 2YQSA 4LW3A 3ZLLA 2O1GA 2PA4A 1HJLA 1H5RB 3K8EA 2Y4JA 1GWVA 1EZIA 5AJOA 1H4EA 1ZI1A 4KPXA 1MC3A 1K4VA 1ZDFA 2FYAA 5CMIA 5C4CA 5C1GA 4FREA 3POLA 1YP3A 5CMHA 4R7PA 1HV9A 5C4DA 2V0JA 2O1HA 5FV9A 1ZJ2A 1G95A 1ON8A 4ASJA 1WT2A 2NXVA 5C1LA 2QKXA 4G3SA 3NGWA 5C48A 3OH2A 4Y62A 4ECMA 2PX7A 2O1FA 2CU2A 2XWLA 3RMVA 1HM0A 1IIMA 3SXAA 4BMAA 4K6RA 5CQMX 4D48A 3DJ4A 4M2BA 3I0GA 1FR9A 1GQ9A 4KNXA 2RJ8A 2YC3A 3KIAA 4AAWA 1TW5A 4FRMA 1Z90A 2AE7A 5EIYA 4Y7VA 1MP3A 4KC2A 2YESA 5J49A 1H5RA 5C4BA 3V90A 4B4BA 4HO6A
chains in the Genus database with same CATH superfamily
1FRWA 4EVWA 2RIXA 2QH5A 2XWMA 3I0JA 1NF5B 5C47A 1G0RA 2ZU8A 1ZJ1A 1I52A 2Y6PA 3CU0A 4CVHA 4ARWA 4Y7GA 4G3PA 1H5TB 1QGQA 3U2VA 4M2AA 4FCUA 5FU0A 2ZU7A 2J0AA 4CJBA 1VH3A 1JV3A 2V0HA 3V0LA 4EEOA 4FIXA 2D0JA 3FOQA 3EE5A 3ZLKA 2JCLA 3CKOA 2RJ0A 4HO9A 3OH0A 1NKHB 2APCA 5FUHA 3TZTA 1H7FA 3I0IX 3D8VA 3ZF8A 1JV1A 5I1FA 5EJ1A 2YQCA 4EE3A 2RIZA 2WVMA 2WVKA 4GBPA 2DPWA 1WT3A 3CKJA 1LL0A 1O7QA 3O3PA 5L6VA 1R80A 3OH1A 3SX7A 4KNRA 1GX4A 1XZ6A 4FRAA 1HJJA 2BO7A 4CJCA 3HL3A 5C8RA 3V0PA 5C3BA 2YCMA 3U2WA 3OGZA 4EEMA 3LW6A 2V0IA 3IOIA 3OH3A 4B4GA 4EE4A 1GA8A 1H5TA 2Y4KA 3IOHA 4UEGA 2AM4A 1EYRA 4KC1A 5C49A 1LZ7A 1JVGA 1ZJ0A 1ZI5A 1INJA 1LVWA 4ZDQA 2VS5A 4DECA 1TVYA 4HO8A 2AECA 1ZHJA 4D11A 5C36A 5IFYA 2X5ZA 2QGIA 3BCVA 1FGGA 2FYCB 2XMHA 4YS8A 3Q4SA 5FU8A 1LZ0A 4FQWA 5IDTA 3E25A 1G9RA 1O7OA 3PKPA 1PZYB 2VFZA 5JQQA 5CQLX 4EEAA 1QG8A 3SPTA 3SXDA 2RITA 3JTJA 4IRQA 5DDVA 1ZDGA 1MP5A 2JCKA 3SX8A 1VGTA 2BO4A 4E1KA 1G93A 1GWWA 2A8WA 2PGYA 3R3IA 4HO5A 4BQHA 4FRDA 1G8OA 5AJPA 4AC3A 1FO9A 1W57A 2VSHA 4KQLA 2UX8A 1FO8A 4FRQA 1ZI4A 3I0DA 3K8DA 3DK5A 2I7BA 2X5SA 2VSIA 4O6NA 1ZCUA 5IDSA 1VZUA 3U0XA 1V82A 4D11C 4B2XA 2ICYA 2RJ7A 1FGXA 5C3DA 4NAKA 5C1HA 1O0RA 3FWWA 1JYLA 2I5EA 1W55A 2Y4LA 2WAWA 1VZTA 3V8ZA 2Y4MA 1ZCVA 3I0HA 4DE7A 4JISA 3RMWA 4EE5A 5C4FA 3OC9A 1ZJ3A 2WVLA 1H7QA 1WT0A 3SXGA 1LZIA 1OMXA 2AESA 1G23A 1R7VA 1HM9A 3OKRA 3QVBA 2JCJA 3V8YA 2RJ5A 3V91A 4LW6A 2J0BA 2P73A 4IRPA 4EEGA 5HS2A 2Q4JA 1R7XA 4G87A 1G3LA 3I0LA 1V84A 1LZJA 2C0NA 2E3DA 2V0LA 1VM8A 2VXLA 1OMZA 4KRVA 4M4KA 3U0YA 4Y64A 2AH9A 1KWSA 2VS4A 3GUEA 2X60A 3OH4A 3N9WA 5DDTA 5CQOA 1ZI3A 2VXMA 1FXJA 2VS3A 4Y7FA 1YP2A 3T7NA 4C2SA 2YQHA 5CMFX 5CMGX 1TZFA 1VICA 2YC5A 1G97A 1MP4A 1VGZA 1LL2A 1H5SA 2D7IA 4J18A 2OI5A 2AGDA 4HO4A 3U2UA 1JYKA 4HCQA 4XWIA 2Y7AA 2WGZA 4HO3A 4FRPA 4Q7CA 3ZGFA 2A8UA 1S4PA 2JCOA 3F1YA 1R81A 3CKQA 4FRHA 1QWJA 1H7HA 1ZJPA 4L41C 3V0MA 2RJ1A 1WSZA 1VH1A 2AM5A 3T7MA 4KC4A 3DUVA 1IINA 2AM3A 1H7EA 4B42A 3V0NA 4DDZA 4FRBA 3D5NA 2ZU9A 1FOAA 1W77A 2FYBA 5FTSA 1FR8A 4NALA 1ZIZA 4B2WA 4NANA 1GX0A 1QGSA 4JD0A 2VD4A 1H3MA 3SX3A 3ZGGA 2D7RA 1R7UA 5FYEA 3PNNA 3CKNA 4MIXA 3V0OA 5CQPA 4HO0A 3Q80A 1H5SC 3I0CA 1H7TA 4O6MA 1H7LA 3I0KA 2GGOA 4Y6UA 1H4CA 5C38A 2GGQA 3USQA 2BO6A 1H4DA 2FYDB 3JUKA 1ZCTA 4Y7TA 3I0EA 3V0QA 4KPZA 1H7GA 4AYJA 1V83A 4B3UA 5EJZA 3BRKX 4G3QA 1TW1A 1FG5N 2PGVA 2RJ9A 1VGUA 4CJ8A 2WEEA 1YROB 2XMEA 1OQMB 1INIA 2P6WA 3JUJA 1H5SB 3OAMA 5L6SA 1FXOA 3ST8A 3D98A 5BXCA 4KXOA 2YQJA 1NHEB 3USRA 1O23B 2RJ6A 2RJ4A 1GQCA 2MZBA 4Y9XA 4B4MA 4FRLA 4D0TA 3SXCA 1ON6A 1NQIB 1NWGB 4FCEA 4HOCA 3I0FA 2V0KA 3U2XA 3T7OA 4MYBA 2BO8A 2E8BA 2ICXA 2W0VA 1ZJOA 2P72A 5CMJA 4Y63A 3SXEA 1LL3A 1R7YA 4ASYA 1HM8A 2I5KA 2OEGA 3Q7UA 2RIYA 4NAIA 1S4NA 1R82A 1SS9A 2OI7A 2FFVA 2FY7A 4AYLA 1FWYA 3F1CA 4P00A 1PZTA 1XHBA 2W0WA 4FIYA 5CQNX 3TQDA 1NMMB 4B5BA 2FFUA 1JVDA 1FZWA 4Y7UA 4KT7A 4Y6NA 4HO2A 1YP4A 4MNDA 1WVCA 1S4OA 3PKQA 3IOJA 3CKVA 4P02A 1G2VA 2Z86A 5D91A 4D0ZA 2OEFA 1VGWA 4M28A 1G1LA 2X65A 1E5KA 5C4EA 5FTVA 1WT1A 1ZCYA 2Z87A 3CGXA 1VPAA 4HG6A 1H5SD 3U2TA 2XWNA 1VZXA 3SX5A 3RSBA 1R7TA 2OI6A 2WE9A 3E26A 3SXBA 5AJNA 4FROA 5C3AA 3R2WA 2YQSA 4LW3A 3ZLLA 2O1GA 2PA4A 1HJLA 1H5RB 3K8EA 2Y4JA 1GWVA 1EZIA 5AJOA 1H4EA 1ZI1A 4KPXA 1MC3A 1K4VA 1ZDFA 2FYAA 5CMIA 5C4CA 5C1GA 4FREA 3POLA 1YP3A 5CMHA 4R7PA 1HV9A 5C4DA 2V0JA 2O1HA 5FV9A 1ZJ2A 1G95A 1ON8A 5D92A 4ASJA 1WT2A 2VK9A 2NXVA 5C1LA 2QKXA 4G3SA 3NGWA 5C48A 3OH2A 4Y62A 4ECMA 2PX7A 2O1FA 2CU2A 2XWLA 3RMVA 1HM0A 1IIMA 3SXAA 4BMAA 4K6RA 5CQMX 4D48A 3DJ4A 4M2BA 3I0GA 1FR9A 1GQ9A 4KNXA 2RJ8A 2YC3A 3KIAA 4AAWA 1TW5A 4FRMA 1Z90A 2AE7A 5EIYA 4Y7VA 1MP3A 4KC2A 2YESA 5J49A 1H5RA 5C4BA 3V90A 4B4BA 4HO6A
chains in the Genus database with same CATH topology
1FRWA 4EVWA 2RIXA 2QH5A 2XWMA 3I0JA 1NF5B 5C47A 1G0RA 2ZU8A 1ZJ1A 1I52A 2Y6PA 3CU0A 4CVHA 4ARWA 4Y7GA 4G3PA 1H5TB 1QGQA 3U2VA 4M2AA 4FCUA 5FU0A 2ZU7A 2J0AA 4CJBA 1VH3A 1JV3A 2V0HA 3V0LA 4EEOA 4FIXA 2D0JA 3FOQA 3EE5A 3ZLKA 2JCLA 3CKOA 2RJ0A 4HO9A 3OH0A 1NKHB 2APCA 5FUHA 3TZTA 1H7FA 3I0IX 3D8VA 3ZF8A 1JV1A 5I1FA 5EJ1A 2YQCA 4EE3A 2RIZA 2WVMA 2WVKA 4GBPA 2DPWA 1WT3A 3CKJA 1LL0A 1O7QA 3O3PA 5L6VA 1R80A 3OH1A 3SX7A 4KNRA 1GX4A 1XZ6A 4FRAA 1HJJA 2BO7A 4CJCA 3HL3A 5C8RA 3V0PA 5C3BA 2YCMA 3U2WA 3OGZA 4EEMA 3LW6A 2V0IA 3IOIA 3OH3A 4B4GA 4EE4A 1GA8A 1H5TA 2Y4KA 3IOHA 4UEGA 2AM4A 1EYRA 4KC1A 5C49A 1LZ7A 1JVGA 1ZJ0A 1ZI5A 1INJA 1LVWA 4ZDQA 2VS5A 4DECA 1TVYA 4HO8A 2AECA 1ZHJA 4D11A 5C36A 5IFYA 2X5ZA 2QGIA 3BCVA 1FGGA 2FYCB 2XMHA 4YS8A 3Q4SA 5FU8A 1LZ0A 4FQWA 5IDTA 3E25A 1G9RA 1O7OA 3PKPA 1PZYB 2VFZA 5JQQA 5CQLX 4EEAA 1QG8A 3SPTA 3SXDA 2RITA 3JTJA 4IRQA 5DDVA 1ZDGA 1MP5A 2JCKA 3SX8A 1VGTA 2BO4A 4E1KA 1G93A 1GWWA 2A8WA 2PGYA 3R3IA 4HO5A 4BQHA 4FRDA 1G8OA 5AJPA 4AC3A 1FO9A 1W57A 2VSHA 4KQLA 2UX8A 1FO8A 4FRQA 1ZI4A 3I0DA 3K8DA 3DK5A 2I7BA 2X5SA 2VSIA 4O6NA 1ZCUA 5IDSA 1VZUA 3U0XA 1V82A 4D11C 4B2XA 2ICYA 2RJ7A 1FGXA 5C3DA 4NAKA 5C1HA 1O0RA 3FWWA 1JYLA 2I5EA 1W55A 2Y4LA 2WAWA 1VZTA 3V8ZA 2Y4MA 1ZCVA 3I0HA 4DE7A 4JISA 3RMWA 4EE5A 5C4FA 3OC9A 1ZJ3A 2WVLA 1H7QA 1WT0A 3SXGA 1LZIA 1OMXA 2AESA 1G23A 1R7VA 1HM9A 3OKRA 3QVBA 2JCJA 3V8YA 2RJ5A 3V91A 4LW6A 2J0BA 2P73A 4IRPA 4EEGA 5HS2A 2Q4JA 1R7XA 4G87A 1G3LA 3I0LA 1V84A 1LZJA 2C0NA 2E3DA 2V0LA 1VM8A 2VXLA 1OMZA 4KRVA 4M4KA 3U0YA 4Y64A 2AH9A 1KWSA 2VS4A 3GUEA 2X60A 3OH4A 3N9WA 5DDTA 5CQOA 1ZI3A 2VXMA 1FXJA 2VS3A 4Y7FA 1YP2A 3T7NA 4C2SA 2YQHA 5CMFX 5CMGX 1TZFA 1VICA 2YC5A 1G97A 1MP4A 1VGZA 1LL2A 1H5SA 2D7IA 4J18A 2OI5A 2AGDA 4HO4A 3U2UA 1JYKA 4HCQA 4XWIA 2Y7AA 2WGZA 4HO3A 4FRPA 4Q7CA 3ZGFA 2A8UA 1S4PA 2JCOA 3F1YA 1R81A 3CKQA 4FRHA 1QWJA 1H7HA 1ZJPA 4L41C 3V0MA 2RJ1A 1WSZA 1VH1A 2AM5A 3T7MA 4KC4A 3DUVA 1IINA 2AM3A 1H7EA 4B42A 3V0NA 4DDZA 4FRBA 3D5NA 2ZU9A 1FOAA 1W77A 2FYBA 5FTSA 1FR8A 4NALA 1ZIZA 4B2WA 4NANA 1GX0A 1QGSA 4JD0A 2VD4A 1H3MA 3SX3A 3ZGGA 2D7RA 1R7UA 5FYEA 3PNNA 3CKNA 4MIXA 3V0OA 5CQPA 4HO0A 3Q80A 1H5SC 3I0CA 1H7TA 4O6MA 1H7LA 3I0KA 2GGOA 4Y6UA 1H4CA 5C38A 2GGQA 3USQA 2BO6A 1H4DA 2FYDB 3JUKA 1ZCTA 4Y7TA 3I0EA 3V0QA 4KPZA 1H7GA 4AYJA 1V83A 4B3UA 5EJZA 3BRKX 4G3QA 1TW1A 1FG5N 2PGVA 2RJ9A 1VGUA 4CJ8A 2WEEA 1YROB 2XMEA 1OQMB 1INIA 2P6WA 3JUJA 1H5SB 3OAMA 5L6SA 1FXOA 3ST8A 3D98A 5BXCA 4KXOA 2YQJA 1NHEB 3USRA 1O23B 2RJ6A 2RJ4A 1GQCA 2MZBA 4Y9XA 4B4MA 4FRLA 4D0TA 3SXCA 1ON6A 1NQIB 1NWGB 4FCEA 4HOCA 3I0FA 2V0KA 3U2XA 3T7OA 4MYBA 2BO8A 2E8BA 2ICXA 2W0VA 1ZJOA 2P72A 5CMJA 4Y63A 3SXEA 1LL3A 1R7YA 4ASYA 1HM8A 2I5KA 2OEGA 3Q7UA 2RIYA 4NAIA 1S4NA 1R82A 1SS9A 2OI7A 2FFVA 2FY7A 4AYLA 1FWYA 3F1CA 4P00A 1PZTA 1XHBA 2W0WA 4FIYA 5CQNX 3TQDA 1NMMB 4B5BA 2FFUA 1JVDA 1FZWA 4Y7UA 4KT7A 4Y6NA 4HO2A 1YP4A 4MNDA 1WVCA 1S4OA 3PKQA 3IOJA 3CKVA 4P02A 1G2VA 2Z86A 5D91A 4D0ZA 2OEFA 1VGWA 4M28A 1G1LA 2X65A 1E5KA 5C4EA 5FTVA 1WT1A 1ZCYA 2Z87A 3CGXA 1VPAA 4HG6A 1H5SD 3U2TA 2XWNA 1VZXA 3SX5A 3RSBA 1R7TA 2OI6A 2WE9A 3E26A 3SXBA 5AJNA 4FROA 5C3AA 3R2WA 2YQSA 4LW3A 3ZLLA 2O1GA 2PA4A 1HJLA 1H5RB 3K8EA 2Y4JA 1GWVA 1EZIA 5AJOA 1H4EA 1ZI1A 4KPXA 1MC3A 1K4VA 1ZDFA 2FYAA 5CMIA 5C4CA 5C1GA 4FREA 3POLA 1YP3A 5CMHA 4R7PA 1HV9A 5C4DA 2V0JA 2O1HA 5FV9A 1ZJ2A 1G95A 1ON8A 5D92A 4ASJA 1WT2A 2VK9A 2NXVA 5C1LA 2QKXA 4G3SA 3NGWA 5C48A 3OH2A 4Y62A 4ECMA 2PX7A 2O1FA 2CU2A 2XWLA 3RMVA 1HM0A 1IIMA 3SXAA 4BMAA 4K6RA 5CQMX 4D48A 3DJ4A 4M2BA 3I0GA 1FR9A 1GQ9A 4KNXA 2RJ8A 2YC3A 3KIAA 4AAWA 1TW5A 4FRMA 1Z90A 2AE7A 5EIYA 4Y7VA 1MP3A 4KC2A 2YESA 5J49A 1H5RA 5C4BA 3V90A 4B4BA 4HO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRW A;  4EVW A;  2RIX A;  2QH5 A;  2XWM A;  3I0J A;  1NF5 B;  5C47 A;  1G0R A;  2ZU8 A;  1ZJ1 A;  1I52 A;  2Y6P A;  3CU0 A;  4CVH A;  4ARW A;  4Y7G A;  4G3P A;  1H5T B;  1QGQ A;  3U2V A;  4M2A A;  4FCU A;  5FU0 A;  2ZU7 A;  4CJB A;  1VH3 A;  1JV3 A;  2V0H A;  3V0L A;  4EEO A;  2D0J A;  3FOQ A;  3EE5 A;  3ZLK A;  2JCL A;  3CKO A;  2RJ0 A;  4HO9 A;  3OH0 A;  1NKH B;  2APC A;  5FUH A;  3TZT A;  1H7F A;  3I0I X;  3D8V A;  3ZF8 A;  1JV1 A;  5I1F A;  5EJ1 A;  2YQC A;  4EE3 A;  2RIZ A;  2WVM A;  2WVK A;  4GBP A;  2DPW A;  1WT3 A;  3CKJ A;  1LL0 A;  1O7Q A;  3O3P A;  5L6V A;  1R80 A;  3OH1 A;  3SX7 A;  4KNR A;  1GX4 A;  1XZ6 A;  4FRA A;  1HJJ A;  2BO7 A;  4CJC A;  3HL3 A;  5C8R A;  3V0P A;  5C3B A;  2YCM A;  3U2W A;  3OGZ A;  4EEM A;  3LW6 A;  2V0I A;  3IOI A;  3OH3 A;  4B4G A;  4EE4 A;  1GA8 A;  1H5T A;  2Y4K A;  3IOH A;  4UEG A;  2AM4 A;  1EYR A;  4KC1 A;  5C49 A;  1LZ7 A;  1JVG A;  1ZJ0 A;  1ZI5 A;  1INJ A;  1LVW A;  4ZDQ A;  2VS5 A;  4DEC A;  1TVY A;  4HO8 A;  2AEC A;  1ZHJ A;  4D11 A;  5C36 A;  5IFY A;  2X5Z A;  2QGI A;  3BCV A;  1FGG A;  2FYC B;  2XMH A;  4YS8 A;  3Q4S A;  5FU8 A;  1LZ0 A;  4FQW A;  5IDT A;  3E25 A;  1G9R A;  1O7O A;  3PKP A;  1PZY B;  2VFZ A;  5JQQ A;  5CQL X;  4EEA A;  1QG8 A;  3SPT A;  3SXD A;  2RIT A;  3JTJ A;  4IRQ A;  5DDV A;  1ZDG A;  1MP5 A;  2JCK A;  3SX8 A;  1VGT A;  2BO4 A;  4E1K A;  1G93 A;  1GWW A;  2A8W A;  2PGY A;  3R3I A;  4HO5 A;  4BQH A;  4FRD A;  1G8O A;  5AJP A;  4AC3 A;  1FO9 A;  1W57 A;  2VSH A;  4KQL A;  2UX8 A;  1FO8 A;  4FRQ A;  1ZI4 A;  3I0D A;  3K8D A;  3DK5 A;  2I7B A;  2X5S A;  2VSI A;  1ZCU A;  5IDS A;  1VZU A;  3U0X A;  1V82 A;  4D11 C;  4B2X A;  2ICY A;  2RJ7 A;  1FGX A;  5C3D A;  4NAK A;  5C1H A;  1O0R A;  3FWW A;  1JYL A;  2I5E A;  1W55 A;  2Y4L A;  2WAW A;  1VZT A;  3V8Z A;  2Y4M A;  1ZCV A;  3I0H A;  4DE7 A;  4JIS A;  3RMW A;  4EE5 A;  5C4F A;  3OC9 A;  1ZJ3 A;  2WVL A;  1H7Q A;  1WT0 A;  3SXG A;  1LZI A;  1OMX A;  2AES A;  1G23 A;  1R7V A;  1HM9 A;  3OKR A;  3QVB A;  2JCJ A;  3V8Y A;  2RJ5 A;  3V91 A;  4LW6 A;  2P73 A;  4IRP A;  4EEG A;  5HS2 A;  2Q4J A;  1R7X A;  4G87 A;  1G3L A;  3I0L A;  1V84 A;  1LZJ A;  2E3D A;  2V0L A;  1VM8 A;  2VXL A;  1OMZ A;  4KRV A;  4M4K A;  3U0Y A;  4Y64 A;  2AH9 A;  1KWS A;  2VS4 A;  3GUE A;  2X60 A;  3OH4 A;  3N9W A;  5DDT A;  5CQO A;  1ZI3 A;  2VXM A;  1FXJ A;  2VS3 A;  4Y7F A;  1YP2 A;  3T7N A;  4C2S A;  2YQH A;  5CMF X;  5CMG X;  1TZF A;  1VIC A;  2YC5 A;  1G97 A;  1MP4 A;  1VGZ A;  1LL2 A;  1H5S A;  2D7I A;  4J18 A;  2OI5 A;  2AGD A;  4HO4 A;  3U2U A;  1JYK A;  4HCQ A;  4XWI A;  2Y7A A;  2WGZ A;  4HO3 A;  4FRP A;  3ZGF A;  2A8U A;  1S4P A;  2JCO A;  3F1Y A;  1R81 A;  3CKQ A;  4FRH A;  1QWJ A;  1H7H A;  1ZJP A;  4L41 C;  3V0M A;  2RJ1 A;  1WSZ A;  1VH1 A;  2AM5 A;  3T7M A;  4KC4 A;  3DUV A;  1IIN A;  2AM3 A;  1H7E A;  4B42 A;  3V0N A;  4DDZ A;  4FRB A;  3D5N A;  2ZU9 A;  1FOA A;  1W77 A;  2FYB A;  5FTS A;  1FR8 A;  4NAL A;  1ZIZ A;  4B2W A;  4NAN A;  1GX0 A;  1QGS A;  4JD0 A;  2VD4 A;  1H3M A;  3SX3 A;  3ZGG A;  2D7R A;  1R7U A;  5FYE A;  3PNN A;  3CKN A;  3V0O A;  5CQP A;  4HO0 A;  3Q80 A;  1H5S C;  3I0C A;  1H7T A;  1H7L A;  3I0K A;  2GGO A;  4Y6U A;  1H4C A;  5C38 A;  2GGQ A;  3USQ A;  2BO6 A;  1H4D A;  2FYD B;  3JUK A;  1ZCT A;  4Y7T A;  3I0E A;  3V0Q A;  4KPZ A;  1H7G A;  4AYJ A;  1V83 A;  4B3U A;  5EJZ A;  3BRK X;  4G3Q A;  1TW1 A;  1FG5 N;  2PGV A;  2RJ9 A;  1VGU A;  4CJ8 A;  2WEE A;  1YRO B;  2XME A;  1OQM B;  1INI A;  2P6W A;  3JUJ A;  1H5S B;  3OAM A;  5L6S A;  1FXO A;  3ST8 A;  3D98 A;  5BXC A;  4KXO A;  2YQJ A;  1NHE B;  3USR A;  1O23 B;  2RJ6 A;  2RJ4 A;  1GQC A;  2MZB A;  4Y9X A;  4B4M A;  4FRL A;  4D0T A;  3SXC A;  1ON6 A;  1NQI B;  1NWG B;  4FCE A;  4HOC A;  3I0F A;  2V0K A;  3U2X A;  3T7O A;  4MYB A;  2BO8 A;  2E8B A;  2ICX A;  2W0V A;  1ZJO A;  2P72 A;  5CMJ A;  4Y63 A;  3SXE A;  1LL3 A;  1R7Y A;  4ASY A;  1HM8 A;  2I5K A;  2OEG A;  3Q7U A;  2RIY A;  4NAI A;  1S4N A;  1R82 A;  1SS9 A;  2OI7 A;  2FFV A;  2FY7 A;  4AYL A;  1FWY A;  3F1C A;  4P00 A;  1PZT A;  1XHB A;  2W0W A;  5CQN X;  3TQD A;  1NMM B;  4B5B A;  2FFU A;  1JVD A;  1FZW A;  4Y7U A;  4KT7 A;  4Y6N A;  4HO2 A;  1YP4 A;  4MND A;  1WVC A;  1S4O A;  3PKQ A;  3IOJ A;  3CKV A;  4P02 A;  1G2V A;  2Z86 A;  4D0Z A;  2OEF A;  1VGW A;  4M28 A;  1G1L A;  2X65 A;  1E5K A;  5C4E A;  5FTV A;  1WT1 A;  1ZCY A;  2Z87 A;  3CGX A;  1VPA A;  4HG6 A;  1H5S D;  3U2T A;  2XWN A;  1VZX A;  3SX5 A;  3RSB A;  1R7T A;  2OI6 A;  2WE9 A;  3E26 A;  3SXB A;  5AJN A;  4FRO A;  5C3A A;  3R2W A;  2YQS A;  4LW3 A;  3ZLL A;  2O1G A;  2PA4 A;  1HJL A;  1H5R B;  3K8E A;  2Y4J A;  1GWV A;  1EZI A;  5AJO A;  1H4E A;  1ZI1 A;  4KPX A;  1MC3 A;  1K4V A;  1ZDF A;  2FYA A;  5CMI A;  5C4C A;  5C1G A;  4FRE A;  3POL A;  1YP3 A;  5CMH A;  4R7P A;  1HV9 A;  5C4D A;  2V0J A;  2O1H A;  5FV9 A;  1ZJ2 A;  1G95 A;  1ON8 A;  4ASJ A;  1WT2 A;  2NXV A;  5C1L A;  2QKX A;  4G3S A;  3NGW A;  5C48 A;  3OH2 A;  4Y62 A;  4ECM A;  2PX7 A;  2O1F A;  2CU2 A;  2XWL A;  3RMV A;  1HM0 A;  1IIM A;  3SXA A;  4BMA A;  4K6R A;  5CQM X;  4D48 A;  3DJ4 A;  4M2B A;  3I0G A;  1FR9 A;  1GQ9 A;  4KNX A;  2RJ8 A;  2YC3 A;  3KIA A;  4AAW A;  1TW5 A;  4FRM A;  1Z90 A;  2AE7 A;  5EIY A;  4Y7V A;  1MP3 A;  4KC2 A;  2YES A;  5J49 A;  1H5R A;  5C4B A;  3V90 A;  4B4B A;  4HO6 A; 
#chains in the Genus database with same CATH topology
 1FRW A;  4EVW A;  2RIX A;  2QH5 A;  2XWM A;  3I0J A;  1NF5 B;  5C47 A;  1G0R A;  2ZU8 A;  1ZJ1 A;  1I52 A;  2Y6P A;  3CU0 A;  4CVH A;  4ARW A;  4Y7G A;  4G3P A;  1H5T B;  1QGQ A;  3U2V A;  4M2A A;  4FCU A;  5FU0 A;  2ZU7 A;  2J0A A;  4CJB A;  1VH3 A;  1JV3 A;  2V0H A;  3V0L A;  4EEO A;  4FIX A;  2D0J A;  3FOQ A;  3EE5 A;  3ZLK A;  2JCL A;  3CKO A;  2RJ0 A;  4HO9 A;  3OH0 A;  1NKH B;  2APC A;  5FUH A;  3TZT A;  1H7F A;  3I0I X;  3D8V A;  3ZF8 A;  1JV1 A;  5I1F A;  5EJ1 A;  2YQC A;  4EE3 A;  2RIZ A;  2WVM A;  2WVK A;  4GBP A;  2DPW A;  1WT3 A;  3CKJ A;  1LL0 A;  1O7Q A;  3O3P A;  5L6V A;  1R80 A;  3OH1 A;  3SX7 A;  4KNR A;  1GX4 A;  1XZ6 A;  4FRA A;  1HJJ A;  2BO7 A;  4CJC A;  3HL3 A;  5C8R A;  3V0P A;  5C3B A;  2YCM A;  3U2W A;  3OGZ A;  4EEM A;  3LW6 A;  2V0I A;  3IOI A;  3OH3 A;  4B4G A;  4EE4 A;  1GA8 A;  1H5T A;  2Y4K A;  3IOH A;  4UEG A;  2AM4 A;  1EYR A;  4KC1 A;  5C49 A;  1LZ7 A;  1JVG A;  1ZJ0 A;  1ZI5 A;  1INJ A;  1LVW A;  4ZDQ A;  2VS5 A;  4DEC A;  1TVY A;  4HO8 A;  2AEC A;  1ZHJ A;  4D11 A;  5C36 A;  5IFY A;  2X5Z A;  2QGI A;  3BCV A;  1FGG A;  2FYC B;  2XMH A;  4YS8 A;  3Q4S A;  5FU8 A;  1LZ0 A;  4FQW A;  5IDT A;  3E25 A;  1G9R A;  1O7O A;  3PKP A;  1PZY B;  2VFZ A;  5JQQ A;  5CQL X;  4EEA A;  1QG8 A;  3SPT A;  3SXD A;  2RIT A;  3JTJ A;  4IRQ A;  5DDV A;  1ZDG A;  1MP5 A;  2JCK A;  3SX8 A;  1VGT A;  2BO4 A;  4E1K A;  1G93 A;  1GWW A;  2A8W A;  2PGY A;  3R3I A;  4HO5 A;  4BQH A;  4FRD A;  1G8O A;  5AJP A;  4AC3 A;  1FO9 A;  1W57 A;  2VSH A;  4KQL A;  2UX8 A;  1FO8 A;  4FRQ A;  1ZI4 A;  3I0D A;  3K8D A;  3DK5 A;  2I7B A;  2X5S A;  2VSI A;  4O6N A;  1ZCU A;  5IDS A;  1VZU A;  3U0X A;  1V82 A;  4D11 C;  4B2X A;  2ICY A;  2RJ7 A;  1FGX A;  5C3D A;  4NAK A;  5C1H A;  1O0R A;  3FWW A;  1JYL A;  2I5E A;  1W55 A;  2Y4L A;  2WAW A;  1VZT A;  3V8Z A;  2Y4M A;  1ZCV A;  3I0H A;  4DE7 A;  4JIS A;  3RMW A;  4EE5 A;  5C4F A;  3OC9 A;  1ZJ3 A;  2WVL A;  1H7Q A;  1WT0 A;  3SXG A;  1LZI A;  1OMX A;  2AES A;  1G23 A;  1R7V A;  1HM9 A;  3OKR A;  3QVB A;  2JCJ A;  3V8Y A;  2RJ5 A;  3V91 A;  4LW6 A;  2J0B A;  2P73 A;  4IRP A;  4EEG A;  5HS2 A;  2Q4J A;  1R7X A;  4G87 A;  1G3L A;  3I0L A;  1V84 A;  1LZJ A;  2C0N A;  2E3D A;  2V0L A;  1VM8 A;  2VXL A;  1OMZ A;  4KRV A;  4M4K A;  3U0Y A;  4Y64 A;  2AH9 A;  1KWS A;  2VS4 A;  3GUE A;  2X60 A;  3OH4 A;  3N9W A;  5DDT A;  5CQO A;  1ZI3 A;  2VXM A;  1FXJ A;  2VS3 A;  4Y7F A;  1YP2 A;  3T7N A;  4C2S A;  2YQH A;  5CMF X;  5CMG X;  1TZF A;  1VIC A;  2YC5 A;  1G97 A;  1MP4 A;  1VGZ A;  1LL2 A;  1H5S A;  2D7I A;  4J18 A;  2OI5 A;  2AGD A;  4HO4 A;  3U2U A;  1JYK A;  4HCQ A;  4XWI A;  2Y7A A;  2WGZ A;  4HO3 A;  4FRP A;  4Q7C A;  3ZGF A;  2A8U A;  1S4P A;  2JCO A;  3F1Y A;  1R81 A;  3CKQ A;  4FRH A;  1QWJ A;  1H7H A;  1ZJP A;  4L41 C;  3V0M A;  2RJ1 A;  1WSZ A;  1VH1 A;  2AM5 A;  3T7M A;  4KC4 A;  3DUV A;  1IIN A;  2AM3 A;  1H7E A;  4B42 A;  3V0N A;  4DDZ A;  4FRB A;  3D5N A;  2ZU9 A;  1FOA A;  1W77 A;  2FYB A;  5FTS A;  1FR8 A;  4NAL A;  1ZIZ A;  4B2W A;  4NAN A;  1GX0 A;  1QGS A;  4JD0 A;  2VD4 A;  1H3M A;  3SX3 A;  3ZGG A;  2D7R A;  1R7U A;  5FYE A;  3PNN A;  3CKN A;  4MIX A;  3V0O A;  5CQP A;  4HO0 A;  3Q80 A;  1H5S C;  3I0C A;  1H7T A;  4O6M A;  1H7L A;  3I0K A;  2GGO A;  4Y6U A;  1H4C A;  5C38 A;  2GGQ A;  3USQ A;  2BO6 A;  1H4D A;  2FYD B;  3JUK A;  1ZCT A;  4Y7T A;  3I0E A;  3V0Q A;  4KPZ A;  1H7G A;  4AYJ A;  1V83 A;  4B3U A;  5EJZ A;  3BRK X;  4G3Q A;  1TW1 A;  1FG5 N;  2PGV A;  2RJ9 A;  1VGU A;  4CJ8 A;  2WEE A;  1YRO B;  2XME A;  1OQM B;  1INI A;  2P6W A;  3JUJ A;  1H5S B;  3OAM A;  5L6S A;  1FXO A;  3ST8 A;  3D98 A;  5BXC A;  4KXO A;  2YQJ A;  1NHE B;  3USR A;  1O23 B;  2RJ6 A;  2RJ4 A;  1GQC A;  2MZB A;  4Y9X A;  4B4M A;  4FRL A;  4D0T A;  3SXC A;  1ON6 A;  1NQI B;  1NWG B;  4FCE A;  4HOC A;  3I0F A;  2V0K A;  3U2X A;  3T7O A;  4MYB A;  2BO8 A;  2E8B A;  2ICX A;  2W0V A;  1ZJO A;  2P72 A;  5CMJ A;  4Y63 A;  3SXE A;  1LL3 A;  1R7Y A;  4ASY A;  1HM8 A;  2I5K A;  2OEG A;  3Q7U A;  2RIY A;  4NAI A;  1S4N A;  1R82 A;  1SS9 A;  2OI7 A;  2FFV A;  2FY7 A;  4AYL A;  1FWY A;  3F1C A;  4P00 A;  1PZT A;  1XHB A;  2W0W A;  4FIY A;  5CQN X;  3TQD A;  1NMM B;  4B5B A;  2FFU A;  1JVD A;  1FZW A;  4Y7U A;  4KT7 A;  4Y6N A;  4HO2 A;  1YP4 A;  4MND A;  1WVC A;  1S4O A;  3PKQ A;  3IOJ A;  3CKV A;  4P02 A;  1G2V A;  2Z86 A;  5D91 A;  4D0Z A;  2OEF A;  1VGW A;  4M28 A;  1G1L A;  2X65 A;  1E5K A;  5C4E A;  5FTV A;  1WT1 A;  1ZCY A;  2Z87 A;  3CGX A;  1VPA A;  4HG6 A;  1H5S D;  3U2T A;  2XWN A;  1VZX A;  3SX5 A;  3RSB A;  1R7T A;  2OI6 A;  2WE9 A;  3E26 A;  3SXB A;  5AJN A;  4FRO A;  5C3A A;  3R2W A;  2YQS A;  4LW3 A;  3ZLL A;  2O1G A;  2PA4 A;  1HJL A;  1H5R B;  3K8E A;  2Y4J A;  1GWV A;  1EZI A;  5AJO A;  1H4E A;  1ZI1 A;  4KPX A;  1MC3 A;  1K4V A;  1ZDF A;  2FYA A;  5CMI A;  5C4C A;  5C1G A;  4FRE A;  3POL A;  1YP3 A;  5CMH A;  4R7P A;  1HV9 A;  5C4D A;  2V0J A;  2O1H A;  5FV9 A;  1ZJ2 A;  1G95 A;  1ON8 A;  5D92 A;  4ASJ A;  1WT2 A;  2VK9 A;  2NXV A;  5C1L A;  2QKX A;  4G3S A;  3NGW A;  5C48 A;  3OH2 A;  4Y62 A;  4ECM A;  2PX7 A;  2O1F A;  2CU2 A;  2XWL A;  3RMV A;  1HM0 A;  1IIM A;  3SXA A;  4BMA A;  4K6R A;  5CQM X;  4D48 A;  3DJ4 A;  4M2B A;  3I0G A;  1FR9 A;  1GQ9 A;  4KNX A;  2RJ8 A;  2YC3 A;  3KIA A;  4AAW A;  1TW5 A;  4FRM A;  1Z90 A;  2AE7 A;  5EIY A;  4Y7V A;  1MP3 A;  4KC2 A;  2YES A;  5J49 A;  1H5R A;  5C4B A;  3V90 A;  4B4B A;  4HO6 A; 
#chains in the Genus database with same CATH homology
 1FRW A;  4EVW A;  2RIX A;  2QH5 A;  2XWM A;  3I0J A;  1NF5 B;  5C47 A;  1G0R A;  2ZU8 A;  1ZJ1 A;  1I52 A;  2Y6P A;  3CU0 A;  4CVH A;  4ARW A;  4Y7G A;  4G3P A;  1H5T B;  1QGQ A;  3U2V A;  4M2A A;  4FCU A;  5FU0 A;  2ZU7 A;  2J0A A;  4CJB A;  1VH3 A;  1JV3 A;  2V0H A;  3V0L A;  4EEO A;  4FIX A;  2D0J A;  3FOQ A;  3EE5 A;  3ZLK A;  2JCL A;  3CKO A;  2RJ0 A;  4HO9 A;  3OH0 A;  1NKH B;  2APC A;  5FUH A;  3TZT A;  1H7F A;  3I0I X;  3D8V A;  3ZF8 A;  1JV1 A;  5I1F A;  5EJ1 A;  2YQC A;  4EE3 A;  2RIZ A;  2WVM A;  2WVK A;  4GBP A;  2DPW A;  1WT3 A;  3CKJ A;  1LL0 A;  1O7Q A;  3O3P A;  5L6V A;  1R80 A;  3OH1 A;  3SX7 A;  4KNR A;  1GX4 A;  1XZ6 A;  4FRA A;  1HJJ A;  2BO7 A;  4CJC A;  3HL3 A;  5C8R A;  3V0P A;  5C3B A;  2YCM A;  3U2W A;  3OGZ A;  4EEM A;  3LW6 A;  2V0I A;  3IOI A;  3OH3 A;  4B4G A;  4EE4 A;  1GA8 A;  1H5T A;  2Y4K A;  3IOH A;  4UEG A;  2AM4 A;  1EYR A;  4KC1 A;  5C49 A;  1LZ7 A;  1JVG A;  1ZJ0 A;  1ZI5 A;  1INJ A;  1LVW A;  4ZDQ A;  2VS5 A;  4DEC A;  1TVY A;  4HO8 A;  2AEC A;  1ZHJ A;  4D11 A;  5C36 A;  5IFY A;  2X5Z A;  2QGI A;  3BCV A;  1FGG A;  2FYC B;  2XMH A;  4YS8 A;  3Q4S A;  5FU8 A;  1LZ0 A;  4FQW A;  5IDT A;  3E25 A;  1G9R A;  1O7O A;  3PKP A;  1PZY B;  2VFZ A;  5JQQ A;  5CQL X;  4EEA A;  1QG8 A;  3SPT A;  3SXD A;  2RIT A;  3JTJ A;  4IRQ A;  5DDV A;  1ZDG A;  1MP5 A;  2JCK A;  3SX8 A;  1VGT A;  2BO4 A;  4E1K A;  1G93 A;  1GWW A;  2A8W A;  2PGY A;  3R3I A;  4HO5 A;  4BQH A;  4FRD A;  1G8O A;  5AJP A;  4AC3 A;  1FO9 A;  1W57 A;  2VSH A;  4KQL A;  2UX8 A;  1FO8 A;  4FRQ A;  1ZI4 A;  3I0D A;  3K8D A;  3DK5 A;  2I7B A;  2X5S A;  2VSI A;  4O6N A;  1ZCU A;  5IDS A;  1VZU A;  3U0X A;  1V82 A;  4D11 C;  4B2X A;  2ICY A;  2RJ7 A;  1FGX A;  5C3D A;  4NAK A;  5C1H A;  1O0R A;  3FWW A;  1JYL A;  2I5E A;  1W55 A;  2Y4L A;  2WAW A;  1VZT A;  3V8Z A;  2Y4M A;  1ZCV A;  3I0H A;  4DE7 A;  4JIS A;  3RMW A;  4EE5 A;  5C4F A;  3OC9 A;  1ZJ3 A;  2WVL A;  1H7Q A;  1WT0 A;  3SXG A;  1LZI A;  1OMX A;  2AES A;  1G23 A;  1R7V A;  1HM9 A;  3OKR A;  3QVB A;  2JCJ A;  3V8Y A;  2RJ5 A;  3V91 A;  4LW6 A;  2J0B A;  2P73 A;  4IRP A;  4EEG A;  5HS2 A;  2Q4J A;  1R7X A;  4G87 A;  1G3L A;  3I0L A;  1V84 A;  1LZJ A;  2C0N A;  2E3D A;  2V0L A;  1VM8 A;  2VXL A;  1OMZ A;  4KRV A;  4M4K A;  3U0Y A;  4Y64 A;  2AH9 A;  1KWS A;  2VS4 A;  3GUE A;  2X60 A;  3OH4 A;  3N9W A;  5DDT A;  5CQO A;  1ZI3 A;  2VXM A;  1FXJ A;  2VS3 A;  4Y7F A;  1YP2 A;  3T7N A;  4C2S A;  2YQH A;  5CMF X;  5CMG X;  1TZF A;  1VIC A;  2YC5 A;  1G97 A;  1MP4 A;  1VGZ A;  1LL2 A;  1H5S A;  2D7I A;  4J18 A;  2OI5 A;  2AGD A;  4HO4 A;  3U2U A;  1JYK A;  4HCQ A;  4XWI A;  2Y7A A;  2WGZ A;  4HO3 A;  4FRP A;  4Q7C A;  3ZGF A;  2A8U A;  1S4P A;  2JCO A;  3F1Y A;  1R81 A;  3CKQ A;  4FRH A;  1QWJ A;  1H7H A;  1ZJP A;  4L41 C;  3V0M A;  2RJ1 A;  1WSZ A;  1VH1 A;  2AM5 A;  3T7M A;  4KC4 A;  3DUV A;  1IIN A;  2AM3 A;  1H7E A;  4B42 A;  3V0N A;  4DDZ A;  4FRB A;  3D5N A;  2ZU9 A;  1FOA A;  1W77 A;  2FYB A;  5FTS A;  1FR8 A;  4NAL A;  1ZIZ A;  4B2W A;  4NAN A;  1GX0 A;  1QGS A;  4JD0 A;  2VD4 A;  1H3M A;  3SX3 A;  3ZGG A;  2D7R A;  1R7U A;  5FYE A;  3PNN A;  3CKN A;  4MIX A;  3V0O A;  5CQP A;  4HO0 A;  3Q80 A;  1H5S C;  3I0C A;  1H7T A;  4O6M A;  1H7L A;  3I0K A;  2GGO A;  4Y6U A;  1H4C A;  5C38 A;  2GGQ A;  3USQ A;  2BO6 A;  1H4D A;  2FYD B;  3JUK A;  1ZCT A;  4Y7T A;  3I0E A;  3V0Q A;  4KPZ A;  1H7G A;  4AYJ A;  1V83 A;  4B3U A;  5EJZ A;  3BRK X;  4G3Q A;  1TW1 A;  1FG5 N;  2PGV A;  2RJ9 A;  1VGU A;  4CJ8 A;  2WEE A;  1YRO B;  2XME A;  1OQM B;  1INI A;  2P6W A;  3JUJ A;  1H5S B;  3OAM A;  5L6S A;  1FXO A;  3ST8 A;  3D98 A;  5BXC A;  4KXO A;  2YQJ A;  1NHE B;  3USR A;  1O23 B;  2RJ6 A;  2RJ4 A;  1GQC A;  2MZB A;  4Y9X A;  4B4M A;  4FRL A;  4D0T A;  3SXC A;  1ON6 A;  1NQI B;  1NWG B;  4FCE A;  4HOC A;  3I0F A;  2V0K A;  3U2X A;  3T7O A;  4MYB A;  2BO8 A;  2E8B A;  2ICX A;  2W0V A;  1ZJO A;  2P72 A;  5CMJ A;  4Y63 A;  3SXE A;  1LL3 A;  1R7Y A;  4ASY A;  1HM8 A;  2I5K A;  2OEG A;  3Q7U A;  2RIY A;  4NAI A;  1S4N A;  1R82 A;  1SS9 A;  2OI7 A;  2FFV A;  2FY7 A;  4AYL A;  1FWY A;  3F1C A;  4P00 A;  1PZT A;  1XHB A;  2W0W A;  4FIY A;  5CQN X;  3TQD A;  1NMM B;  4B5B A;  2FFU A;  1JVD A;  1FZW A;  4Y7U A;  4KT7 A;  4Y6N A;  4HO2 A;  1YP4 A;  4MND A;  1WVC A;  1S4O A;  3PKQ A;  3IOJ A;  3CKV A;  4P02 A;  1G2V A;  2Z86 A;  5D91 A;  4D0Z A;  2OEF A;  1VGW A;  4M28 A;  1G1L A;  2X65 A;  1E5K A;  5C4E A;  5FTV A;  1WT1 A;  1ZCY A;  2Z87 A;  3CGX A;  1VPA A;  4HG6 A;  1H5S D;  3U2T A;  2XWN A;  1VZX A;  3SX5 A;  3RSB A;  1R7T A;  2OI6 A;  2WE9 A;  3E26 A;  3SXB A;  5AJN A;  4FRO A;  5C3A A;  3R2W A;  2YQS A;  4LW3 A;  3ZLL A;  2O1G A;  2PA4 A;  1HJL A;  1H5R B;  3K8E A;  2Y4J A;  1GWV A;  1EZI A;  5AJO A;  1H4E A;  1ZI1 A;  4KPX A;  1MC3 A;  1K4V A;  1ZDF A;  2FYA A;  5CMI A;  5C4C A;  5C1G A;  4FRE A;  3POL A;  1YP3 A;  5CMH A;  4R7P A;  1HV9 A;  5C4D A;  2V0J A;  2O1H A;  5FV9 A;  1ZJ2 A;  1G95 A;  1ON8 A;  5D92 A;  4ASJ A;  1WT2 A;  2VK9 A;  2NXV A;  5C1L A;  2QKX A;  4G3S A;  3NGW A;  5C48 A;  3OH2 A;  4Y62 A;  4ECM A;  2PX7 A;  2O1F A;  2CU2 A;  2XWL A;  3RMV A;  1HM0 A;  1IIM A;  3SXA A;  4BMA A;  4K6R A;  5CQM X;  4D48 A;  3DJ4 A;  4M2B A;  3I0G A;  1FR9 A;  1GQ9 A;  4KNX A;  2RJ8 A;  2YC3 A;  3KIA A;  4AAW A;  1TW5 A;  4FRM A;  1Z90 A;  2AE7 A;  5EIY A;  4Y7V A;  1MP3 A;  4KC2 A;  2YES A;  5J49 A;  1H5R A;  5C4B A;  3V90 A;  4B4B A;  4HO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...