1W57A

Structure of the bifunctional ispdf from campylobacter jejuni containing zn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'EMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
total genus 106
structure length 368
sequence length 368
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w57A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w57A01
3V8ZA 3FOQA 2CU2A 3CKQA 4CVHA 3B6NA 3R2WA 4NAIA 1FRWA 3SXEA 2ZU7A 2PA4A 4Y7VA 3MBMA 3I0LA 1TW1A 1LZ7A 1ZHJA 3ZF8A 2YQSA 3O3PA 4Y9XA 2P6WA 2Z87A 1IINA 2DPWA 2O1HA 2X5SA 3SX5A 4B2XA 3OKRA 2AH9A 2OEFA 1G1LA 1MC3A 1R7UA 3F0EA 1IV4A 1QGQA 1WT0A 3EE5A 4B5BA 2OEGA 4HO6A 1KNJA 2BO4A 2QGIA 4P00A 1TW5A 4KC1A 3CKVA 3I0JA 2YQHA 4HO3A 3FPIA 5FTVA 1GQCA 2O1GA 5C1GA 1OMZA 4AC3A 1HM0A 4Y63A 1E5KA 1MP5A 3ERNA 4BQHA 2YQJA 3CKJA 3IOHA 2D7RA 1G8OA 4C2SA 3OH3A 4Y7TA 2V0LA 3BCVA 1O0RA 4NALA 1ZDGA 2X60A 1FO9A 3R3IA 4Y6NA 2Y4KA 4EEMA 1IV3A 2AMTA 1ON6A 3JUKA 2JCKA 1G2VA 1VGWA 3E26A 2VSIA 4KC2A 1GX0A 2VXMA 4FRPA 5C36A 1VZXA 5C1LA 3Q4SA 2I7BA 2Y4JA 4IRPA 3ST8A 2WVKA 4JISA 3SX3A 1GA8A 5HS2A 3U2XA 3CKNA 3F0GA 1H7GA 1HV9A 1G97A 5FU0A 4G3QA 4FRAA 2YESA 1R7XA 3F1YA 3T7MA 2V0KA 5C3DA 4Y62A 2QKXA 3POLA 2D7IA 1I52A 4M2AA 2A8WA 5CQPA 4EVWA 4FCUA 1G9RA 2FYCB 2Z86A 4CJ8A 2YCMA 2W0VA 4L41C 1H4EA 5EJ1A 2FYBA 2UZHA 3U2UA 3DK5A 1QG8A 3U2VA 2GGQA 4K6RA 1VM8A 5FUHA 2I5KA 1R7TA 4NANA 3CGXA 1HM9A 3V0NA 1KNKA 4E1KA 2RJ4A 4DDZA 5C38A 3LW6A 3I0DA 1H5RA 3TZTA 2GGOA 4KQLA 3PKPA 2RJ7A 5L6VA 1NKHB 3D98A 4B3UA 4B4BA 1QWJA 1VZUA 2XWLA 4FQWA 2AESA 2AM3A 3K2XA 2ICYA 4J18A 1R80A 3Q80A 4YS8A 4HOCA 3I0EA 4G3SA 4C8GA 4G3PA 1S4NA 4ASJA 5CQMX 2FY7A 1ZDFA 1ZI5A 4G87A 4D0TA 3I0HA 1H48A 3ZLLA 1ZI1A 2E3DA 3KE1A 1FGGA 4JD0A 4MYBA 2FYAA 1YQNA 4Y7FA 3QHDA 2AECA 4EEGA 3GHZA 4R7PA 5DDTA 1GX1A 2Y6PA 4BMAA 1GWVA 4KT7A 4KPXA 2VSHA 3USRA 1TVYA 1W77A 2AM4A 2WE9A 2AGDA 4FROA 2RIZA 4C8EA 1ZJOA 3I0IX 5CMFX 1EZIA 5C3AA 4B42A 4KC4A 4FREA 2AE7A 2FFVA 5C8RA 3OH0A 4Y6UA 2WVLA 4B4GA 4B4MA 4FRQA 1R7VA 2WEEA 5DDVA 1W55A 4UEGA 3T7OA 2QH5A 3DJ4A 2PMPA 4Y64A 2OI6A 4FRMA 1ZI3A 3OH1A 1H5SA 1U3LA 1G95A 3PKQA 4XWIA 3U0XA 5CMIA 1G93A 3I0CA 1H7TA 3KIAA 4MNDA 3RMWA 5L6SA 1T0AA 1ZCVA 5CQOA 1K4VA 1HM8A 1VH8A 1PZYB 2XWNA 3SX7A 1U3PA 1QGSA 3OH2A 4KXOA 1ZJ1A 1OMXA 2RITA 3V0OA 3SX8A 1W57A 3USQA 1LL3A 3PNNA 1VGTA 2VXLA 1Z90A 1FR9A 4CJBA 5IDTA 3SPTA 3D8VA 4C8IA 1OQMB 1S4PA 3RSBA 4HO0A 1S4OA 1ZCYA 4EE3A 5C49A 3CU0A 3IKEA 3E25A 1G0RA 1WT1A 2BO6A 3IEWA 1KWSA 3IOJA 1ZCUA 3OC9A 4FRHA 2RJ8A 4HO4A 3V0QA 2P72A 2VS4A 1VH1A 4AYJA 1H5SC 4DECA 1JVGA 5AJPA 3Q8HA 4CJCA 3V91A 4KNXA 2RIXA 1NHEB 2ICXA 1FO8A 1YP3A 2Y4LA 3HL3A 4FCEA 3T7NA 5CMGX 3V90A 2V0IA 3CKOA 5FTSA 1ZCTA 1H7LA 2RJ1A 2VFZA 1H5TA 2VS3A 1JN1A 2VD4A 1FG5N 1U43A 1H5RB 2WAWA 1FWYA 2W0WA 4NAKA 2RIYA 2BO8A 2BO7A 3V0PA 3DUVA 3I0GA 1HJLA 2Y7AA 1XZ6A 3SXGA 3GUEA 1FXOA 1V84A 1H3MA 1VHAA 1ZJ3A 4HG6A 4GBPA 3P10A 3T80A 2I5EA 4ARWA 5B8FA 3JVHA 5C1HA 1LVWA 1ON8A 2NXVA 1INJA 3V0MA 3ESJA 4D48A 1JV1A 3OH4A 4HO2A 4AAWA 2FYDB 5FV9A 4ZDQA 1O23B 4EE4A 1WT2A 1R81A 1VPAA 5C4DA 3F6MA 3P0ZA 2RJ9A 3U2TA 4Y7UA 2X65A 1FXJA 1ZJ2A 4M2BA 1NF5B 1H4CA 1VGUA 5C4EA 4ASYA 2A8UA 1NQIB 2WVMA 3ZGFA 4C82A 5CQNX 5C3BA 4LW6A 2RJ6A 2ZU9A 2MZBA 4M4KA 1LZJA 3K8EA 2AM5A 1INIA 5C4BA 5AJOA 1FOAA 2OI7A 1G3LA 1O7OA 4AYLA 3EORA 1H4DA 1G23A 1VGZA 2GZLA 3FWWA 1H47A 1NMMB 5CMJA 1LZIA 4M28A 5C4CA 2YC5A 1H5SB 1VZTA 4HO8A 1JY8A 1GWWA 2Q4JA 4KNRA 1V83A 1IV2A 1JYLA 1YP2A 1GX4A 4IRQA 4D11A 5EIYA 4EE5A 3D5NA 5JQQA 1PZTA 1V82A 3SXCA 2E8BA 5J49A 2RJ5A 3Q7UA 3TQDA 3ELCA 4HCQA 1ZI4A 2P73A 1H7QA 2PGYA 3N9WA 4D0ZA 1H5SD 3RMVA 5C48A 3I0KA 3JTJA 2V0JA 3OGZA 1H7HA 4B2WA 4KRVA 1LL2A 2APCA 2PGVA 1YP4A 2RJ0A 3K8DA 2VS5A 5I1FA 4HO5A 3IOIA 4FRBA 2O1FA 1HJJA 4ECMA 2X5ZA 1FGXA 2YQCA 3NGWA 3V8YA 1O7QA 4FRLA 5CMHA 1IV1A 5EJZA 4D11C 3IKFA 1XHBA 1NWGB 3ZLKA 1H5TB 1IIMA 3SXBA 1JV3A 5BXCA 1GQ9A 1WSZA 4P02A 2D0JA 1YROB 4FRDA 1JYKA 3BRKX 2XMEA 3U2WA 5AJNA 3V0LA 2OI5A 2ZU8A 3SXDA 1LZ0A 1R7YA 2JCLA 1R82A 4HO9A 3F0DA 1U40A 5FU8A 4EEOA 2XWMA 3RE3A 3ZGGA 1LL0A 1EYRA 4C81A 1H7EA 2Y4MA 3U0YA 3K14A 1WVCA 1SS9A 2FFUA 2PX7A 5IDSA 5FYEA 1FR8A 1MP4A 1VH3A 3I0FA 1ZJPA 1WT3A 3F1CA 5CQLX 2JCJA 3F0FA 5IFYA 1H7FA 1FZWA 2WGZA 2UX8A 4Y7GA 4DE7A 3FBAA 3QVBA 3JUJA 5C47A 1VICA 3OAMA 2V0HA 1TZFA 1ZIZA 3IEQA 3SXAA 4EEAA 1JVDA 1ZJ0A 5C4FA 2JCOA 4KPZA 1MP3A 4LW3A 2YC3A 2XMHA
chains in the Genus database with same CATH superfamily
1K9MH 1VQOF 1YJNF 2QA4F 1SA0B 1FRWA 2V9YA 2CVLA 1TW1A 1LZ7A 3ZF8A 4Y9XA 2P6WA 2X5SA 3OKRA 2OEFA 2Z01A 2ALEA 4BT6A 2BO4A 1TW5A 3VYSC 3LWQC 3CKVA 2Z1FA 3ERNA 2YQJA 3CKJA 3IOHA 4RHAA 1TUBA 3P4EA 5EO3A 1UFYA 1O0RA 2YXZA 3R3IA 1M90H 1IV3A 4O4HB 2JCKA 4X1KB 3GTZA 4FRPA 1VZXA 3Q4SA 1W42A 4IRPA 3SX3A 5LOVA 5FU0A 3V3TA 5GANK 3F1YA 3T7MA 4Y62A 2QKXA 5EWRA 4YJ2A 3NVIB 3VOBA 2W0VA 4L41C 5DCVA 1W41A 3DDNA 3DK5A 1W40A 2AIFA 2I5KA 4NANA 3CGXA 4F6RB 4I50B 2RJ4A 3TZTA 5BMVA 4G4YA 2LCAA 3K2XA 2ICYA 4YS8A 1R80A 3OBWA 3I0EA 1YGYA 4ASJA 2FGYA 5CQMX 1H48A 2KTVA 4JD0A 1YQNA 4Y7FA 4R7PA 3CCUF 4KPXA 4FROA 2WE9A 5EZYB 1X52A 1EZIA 3K0TA 2W8BC 3E20B 3KHNA 4BT2A 5C8RA 4ZOLB 3RA6A 4ZK7A 3T7OA 4BT7A 3DJ4A 2OI6A 4FRMA 3OH1A 3PKQA 1GO1A 3JAWB 3WGMA 3CCEF 5L6SA 1K4VA 1HM8A 3RYFA 3OH2A 1ZJ1A 3V0OA 3USQA 2EWCA 5HY0A 4EI9A 1CK2A 3TD4A 1JFFB 1FR9A 3D8VA 4HO0A 1S4OA 5CA0B 1VQ6F 1KWSA 4HO4A 4FRHA 1KQSF 2RJ8A 1H5SC 2BTUA 4NQ3A 4KNXA 4TZZA 2RIXA 1J7HA 4FCEA 3RYHB 2KG4A 3T7NA 5CMGX 3CKOA 1YHQF 2DYYA 4PWTA 1H7LA 2VFZA 1H5TA 1U43A 1H5RB 4LNUB 2ZAUA 3V0PA 4ZHVA 3SXGA 1FXOA 3P10A 3E22B 3JVHA 3V0MA 3ESJA 2OZBA 2CWJA 1XRGA 2FYDB 1VQVA 5FV9A 1M1KH 4EE4A 1WT2A 5C4DA 3SIVA 2RJ9A 4Y7UA 2ZOVA 1TVKA 2HX0A 4BVSA 5C4EA 3KIZA 1Q82H 1ONIA 2WALA 5JVDA 1XHOA 2RJ6A 2ZU9A 5AJOA 1SA0A 2ZVZA 1FOAA 4YJ3B 2OI7A 3NVKE 1G23A 3FWWA 3CG6A 1H47A 5CMJA 5C4CA 1H5SB 4Q7CA 1V83A 3BYQA 3ZP4A 3N2GB 3RYIB 4D11A 3HKBB 3WPWA 3G71F 4HCQA 1ZI4A 2P73A 3U0OA 1H7QA 3CD6F 2MQEA 3LMEA 2V0JA 2BO1A 4B2WA 4KRVA 1LL2A 2APCA 5HY4A 5LXTB 1YIJF 4O4HA 4X1KA 3NGWA 1Z5WA 1O7QA 3MCAB 4FRLA 4BT3A 5GONB 1CLIA 3ZLKA 2HQSC 1IIMA 5BXCA 2QTPA 4P02A 1NQ3A 2HS3A 5HXZA 2D0JA 3BRKX 5EIBC 2ZU8A 1LZ0A 1R82A 4ZI7B 4HO9A 3V7QA 1K8AH 5D91A 4E6EA 3U0YA 3K14A 4NUTA 2PX7A 5IDSA 1ZJPA 5CQLX 3F0FA 5IFYA 4F6RA 4I50A 3QVBA 1VICA 2AIZP 1X7PA 2HS0A 1JVDA 1ZJ0A 4DRXB 5C4FA 4KPZA 2YC3A 3CKQA 3B6NA 3R2WA 2PA4A 3MBMA 3VYTC 2Z87A 2DPWA 5A2QM 1G1LA 1MC3A 1W3EX 3NMUC 4HO6A 2Z1EA 5EZYA 3WGNA 1VQNF 4P00A 1SZQA 2YQHA 1W5AA 1VQ9F 2O1GA 5C1GA 1HM0A 4Y63A 2QEXF 2OTMA 1G8OA 4C2SA 3OH3A 4Y7TA 3BCVA 4NALA 2X60A 2B33A 3JAWA 1OFUA 1QVGF 4EEMA 2AMTA 3I55F 1VGWA 3HWUA 2VSIA 3CC7F 2RHOA 3OW2F 3ST8A 2WVKA 3WJPA 1GA8A 3PLAC 1JFFA 1H7GA 1HV9A 2YESA 1R7XA 1W5FA 5C3DA 3VOAA 5CA0A 1W2BF 4M2AA 2A8WA 3CCMF 2YCMA 5HXUA 1XV2A 3N2KB 2UZHA 3S0HA 2H8CA 3U2VA 2GGQA 4K6RA 3RYHA 1R7TA 4E1KA 4BT5A 1H5RA 2GGOA 3VMFB 3DC2A 2RJ7A 4LNUA 5L6VA 5GIOC 3D98A 4B3UA 1VZUA 2Q1XA 2AESA 3Q80A 1X25A 4G3PA 1YITF 1S4NA 3E22A 2FY7A 1ZDFA 3ZLLA 4X3LA 1FGGA 1W5EA 3CCLF 4G4VA 3HAXD 2IG8A 4G4WA 2ZVYA 1T0KB 1GX1A 1DT9A 2VSHA 4O4LB 3WJRA 3NK7A 1W77A 2I6RA 3ON1A 4C8EA 4BVQA 5C3AA 4KC4A 4FREA 2FFVA 3I7TA 2OTJF 1ZWZA 3LWOC 1KC8H 3OH0A 4Y6UA 2WVLA 4YJ3A 5DDVA 1W55A 2RB9A 1FNJA 3TD5A 1VQLF 4Y64A 3M84A 1ZI3A 1H5SA 3U0XA 3FD6A 2HS4A 2Z1TA 5CMIA 1H7TA 2Q1YA 3KIAA 1FFXB 3QTYA 1T0AA 5GINC 1PZYB 3N2GA 2XWNA 3RYIA 1QGSA 1W57A 5IJ9B 3HKBA 1LL3A 3PNNA 3S0WA 5HP8A 2NMUA 3SPTA 4U3JB 1OQMB 1S4PA 4DXDA 4EE3A 3V7EA 3I56F 3IEWA 3V0QA 2P72A 2J0AA 4B62A 1VH1A 5LXTA 4DECA 4RQOA 4CJCA 2L26A 1NHEB 1GO0A 2Y4LA 3HL3A 2V0IA 5GONA 5FTSA 5J2TB 2VS3A 2VD4A 5MN6A 2HRYA 5MN5A 3I0GA 1HJLA 2Y7AA 4ZI7A 2VAMA 1V84A 4ZHWA 5EYPB 3T80A 5B8FA 5C1HA 3LYBA 4AAWA 3OH4A 4HO2A 2RHLA 5EB0A 4ZDQA 3ZO8A 3U2TA 3LFOA 2CHTA 4M2BA 2UYJA 1H4CA 1VGUA 3E1YA 4XCQA 3CXCF 1RA4A 3ZGFA 4DRXA 2MZBA 1LZJA 3CCSF 4AYLA 3EORA 2GZLA 2IQQA 1NMMB 1LZIA 4M28A 3AGKA 4HO8A 2PHNA 1QU9A 1IV2A 3KJJA 1JYLA 1YP2A 4U39A 1GX4A 3JASB 3VIUA 5J49A 3HKEB 3ZOPA 3ELCA 4D0ZA 2PGYA 5C48A 3I0KA 3JTJA 3OGZA 4M8IA 1JD1A 2RJ0A 5GIPC 3IOIA 4G88A 2RHJA 4ECMA 1FGXA 3D01A 4ZHYB 4BVTA 3NK6A 2IAFA 1NWGB 1ODEA 2XMEA 3U2WA 3V0LA 2OI5A 3SXDA 4X1YB 1S72F 5IYZB 4EEOA 2JNBA 2F9ZC 3CYQA 2FC3A 2VAPA 3N2KA 1SS9A 2VGMA 5FYEA 4O2BB 2JCJA 3JAKB 1FZWA 4Y7GA 1CN7A 3CPQA 3S02A 3PAFA 3JUJA 3WJQA 1TZFA 2P6YA 1VK3A 4R40B 3MCQA 3MQWA 5ITZB 5GAPK 2XMHA 3V8ZA 4NAIA 3SXEA 2I6DA 2ZU7A 2HP0B 4B45A 4Y7VA 4TV8B 2HVYD 1ZHJA 2YQSA 2VXYA 3SX5A 5IT9M 3N4ZA 4X1IB 1KD1H 4O4LA 3CPWF 2OEGA 1Z5VA 1W581 4KC1A 3I0JA 5JQGB 3FPIA 1GQCA 1OMZA 4AC3A 1E5KA 2D7RA 2V0LA 3RYCB 2GVIA 4Y6NA 5LA6B 1FFXA 3G6EF 1G2VA 5FNVB 3E26A 4KC2A 3FD5A 3O85A 5IJ9A 4JISA 5HS2A 3CKNA 3F0GA 3CCQF 4U3JA 4FRAA 2V0KA 3WPXA 3POLA 1I52A 5CB4B 5FLXM 4EVWA 4FCUA 3M4SA 2UYPA 2Z86A 5HY2A 2UYNB 3RA5A 1PF5A 1H4EA 5EJ1A 2FYBA 1GZ0A 1W59A 3CCVF 1QG8A 4FIXA 1QVFF 1VM8A 3V0NA 1KNKA 5J2TA 2CSLA 5C38A 3LW6A 3I0DA 3PKPA 4BW0B 4BT4A 1NKHB 4FQWA 4J18A 4I4TB 1SDSA 4HOCA 5EYPA 4G3SA 4C8GA 1NMUB 1COMA 4D0TA 3I0HA 1DBFA 2E3DA 3KE1A 5KX5B 3QHDA 3GHZA 4BMAA 1GWVA 4KT7A 2AM4A 3WGLA 2RIZA 3I3FA 1ZJOA 3C9UA 3I0IX 5CMFX 4B42A 4B4MA 1R7VA 3V4DA 2WEEA 3HKDB 2QH5A 2PMPA 1U3LA 2R6R1 4O4IB 3CC2F 1G95A 4XWIA 3I0CA 3RMWA 5CQOA 1VH8A 1IPAA 3SX7A 3JASA 1VQMF 4KXOA 3WGJA 3SX8A 3C9RA 5G4VC 3HKEA 2UYKA 3ZP7A 1VGTA 3FFMA 2VXLA 5KMGB 4CJBA 5IDTA 4C8IA 1ZCYA 3HTNA 5C49A 3D54A 2OHWA 1G0RA 1WT1A 2BO6A 3IOJA 1ZCUA 2VS4A 1JVGA 5AJPA 1Q7YH 3Q8HA 3WXMB 5IJ0B 2ICXA 5J2UB 5LP6B 1FO8A 1YP3A 1YJWF 1ZCTA 1FG5N 2WAWA 2LBTA 1FWYA 2W0WA 4NAKA 1RQ2A 2RIYA 2BO8A 4X1YA 3S06A 4EI7A 3KJKA 5CA1B 5IYZA 1VHAA 3CCRF 1ZJ3A 4FIYA 4GBPA 1VQ7F 4ZHQB 2I5EA 1LVWA 1ON8A 2NXVA 4D48A 1JV1A 4EB6B 1O23B 3K12A 1VPAA 4O2BA 3JAKA 1NF5B 4IHJB 5D92A 1NQIB 1K73H 1X7OA 5ITZA 4LW6A 4M4KA 5LYJB 3K8EA 3IR9A 1INIA 3CYPB 4WBNB 1G3LA 1VGZA 2HP0A 4TV8A 3VTIC 3JATB 4X1IA 1VZTA 1JY8A 2BTOA 1GWWA 1JJ2F 5JCOC 4KNRA 1VQPF 4O6MA 4IRQA 5JQQA 1PZTA 1V82A 1E7KA 5JQGA 3TQDA 2HRUA 3VYUC 3J81M 1VQ5F 1FNKA 3N9WA 4KWEA 4HNAB 3K8DA 3HKCB 3RYCA 4HO5A 2O1FA 1HJJA 5LA6A 1Q8RA 3C9TA 1NJIH 5FNVA 4FFBB 2YQCA 5EIBD 3QUWA 5CMHA 1UI9A 1IV1A 2GLZA 3CMEF 1GQ9A 2LBXA 3S0YA 1YROB 5AJNA 1RQ7A 1QD9A 2QI2A 1R7YA 5CB4A 2ZF8A 3F0DA 4TUYB 2UYNA 2XWMA 3ZGGA 4G4ZA 3TD3A 1H7MA 4O4JB 1H7EA 1FR8A 1MP4A 1VH3A 1WT3A 3JALB 1H7FA 2WGZA 4DE7A 3FBAA 1VQKF 2RHHA 2V0HA 1ZIZA 3IEQA 4I4TA 4EEAA 2JCOA 4LW3A 3J7AR 3FOQA 2CU2A 3S03A 4CVHA 3I0LA 2H8EA 3CMAF 3O3PA 5KX5A 1IINA 2O1HA 4B2XA 2AH9A 1R7UA 1OAPA 1IV4A 3F0EA 1QGQA 1WT0A 3EE5A 4B5BA 1KNJA 2QGIA 2CHSA 3J80M 5C8YB 4HO3A 5JH7B 5FTVA 3C9SA 1MP5A 4BQHA 3HKDA 3CCJF 4O4IA 1ZDGA 1FO9A 4X3MA 2Y4KA 4BY9D 1ON6A 3JUKA 1GX0A 2VXMA 2KTUA 3LWRC 5C36A 5C1LA 2I7BA 2Y4JA 2K1SA 2HP3A 5KMGA 3U2XA 1G97A 4G3QA 4O2AB 1RLUA 2D7IA 4I55B 2OTLF 5CQPA 4TV9B 1G9RA 2FYCB 4CJ8A 3JARB 5IJ0A 5J2UA 3OBYA 5LP6A 3U2UA 3VCZA 3R0PA 5FUHA 4X20B 2VGNA 1HM9A 4DDZA 3UT5B 4KQLA 4G4XA 4B4BA 1QWJA 2XWLA 2AM3A 5CA1A 3N4YA 4IIJB 4ZHQA 3LDTA 4MIXA 1ZI5A 2BTQB 4G87A 4EB6A 1RLGA 1ZI1A 2CZWA 3WGKA 4C4WC 3L7QA 1N8RH 4MYBA 2FYAA 2J0BA 2AECA 4EEGA 5DDTA 2Y6PA 3USRA 4IHJA 1TVYA 2AGDA 1W5BA 4BVRA 3C8LA 2AE7A 5LYJA 3G4SF 1Q81H 2KGWA 4WBNA 4B4GA 4FRQA 5MN4A 4UEGA 4EI8A 1TUBB 3JATA 1QAHA 1G93A 4MNDA 1ZCVA 1U3PA 1OMXA 2RITA 2CW4A 1Z90A 5LOVB 3RSBA 3CU0A 3IKEA 3E25A 4YJ2B 4HNAA 2C0NA 3OC9A 3HKCA 3LWVC 4AYJA 3V91A 3VO8A 4FFBA 3OONA 3V90A 5HP7A 2RJ1A 1JN1A 1YJ9F 5EB1B 5BMVB 2BO7A 3DUVA 1XZ6A 3GUEA 1H3MA 4TUYA 4HG6A 3HJWC 4ARWA 2LBWA 1INJA 4O4JA 3IMPA 5AVMA 1VQ8F 1R81A 3F6MA 3P0ZA 5LP6C 4O6NA 2X65A 3JALA 1FXJA 1ZJ2A 1Q86H 5JCOA 5HY1A 5EAZA 5FJ4C 3CB2A 4ASYA 2A8UA 4NWOB 2WVMA 4C82A 5CQNX 5C3BA 2G9IA 1FSZA 2YYEA 2AM5A 5C4BA 1O7OA 1H4DA 3JAMM 2N48A 3M1XA 2YC5A 4LCKA 2Q4JA 1YI2F 3RYFB 5EIYA 4EE5A 3D5NA 4ZOLA 3SXCA 2E8BA 5C8YA 2RJ5A 3Q7UA 5JH7A 1H5SD 3RMVA 1H7HA 2PGVA 1YP4A 2H6LA 5HWEA 2VS5A 5I1FA 3MDOA 4FRBA 2DT4A 2X5ZA 2Z1UA 3V8YA 5EJZA 4D11C 3IKFA 1XHBA 1H5TB 3SXBA 1JV3A 1WSZA 4FRDA 1JYKA 4O2AA 1PXWA 4I55A 2JCLA 4TV9A 1U40A 3LWPC 5FU8A 3RE3A 1LL0A 4B5CA 3JARA 4B46A 1EYRA 4C81A 2Y4MA 3GYQA 1WVCA 2FFUA 2VK9A 1R1MA 3I0FA 4X20A 2ZODA 3F1CA 5G4UC 3JCMM 3D00A 2UX8A 1XBIA 3UT5A 1TVKB 3SIUA 3CC4F 1VQ4F 5C47A 3OAMA 3VI6A 3SXAA 5JVDB 4ERHA 4IIJA 1MP3A 2R751 2VAWA
chains in the Genus database with same CATH topology
3V8ZA 3FOQA 2CU2A 3CKQA 4CVHA 3B6NA 3R2WA 4NAIA 1FRWA 3SXEA 2ZU7A 2PA4A 4Y7VA 3MBMA 3I0LA 1TW1A 1LZ7A 1ZHJA 3ZF8A 2YQSA 3O3PA 4Y9XA 2P6WA 2Z87A 1IINA 2DPWA 2O1HA 2X5SA 3SX5A 4B2XA 3OKRA 2AH9A 2OEFA 1G1LA 1MC3A 1R7UA 3F0EA 1IV4A 1QGQA 1WT0A 3EE5A 4B5BA 2OEGA 4HO6A 1KNJA 2BO4A 2QGIA 4P00A 1TW5A 4KC1A 3CKVA 3I0JA 2YQHA 4HO3A 3FPIA 5FTVA 1GQCA 2O1GA 5C1GA 1OMZA 4AC3A 1HM0A 4Y63A 1E5KA 1MP5A 3ERNA 4BQHA 2YQJA 3CKJA 3IOHA 2D7RA 1G8OA 4C2SA 3OH3A 4Y7TA 2V0LA 3BCVA 1O0RA 4NALA 1ZDGA 2X60A 1FO9A 3R3IA 4Y6NA 2Y4KA 4EEMA 1IV3A 2AMTA 1ON6A 3JUKA 2JCKA 1G2VA 1VGWA 3E26A 2VSIA 4KC2A 1GX0A 2VXMA 4FRPA 5C36A 1VZXA 5C1LA 3Q4SA 2I7BA 2Y4JA 4IRPA 3ST8A 2WVKA 4JISA 3SX3A 1GA8A 5HS2A 3U2XA 3CKNA 3F0GA 1H7GA 1HV9A 1G97A 5FU0A 4G3QA 4FRAA 2YESA 1R7XA 3F1YA 3T7MA 2V0KA 5C3DA 4Y62A 2QKXA 3POLA 2D7IA 1I52A 4M2AA 2A8WA 5CQPA 4EVWA 4FCUA 1G9RA 2FYCB 2Z86A 4CJ8A 2YCMA 2W0VA 4L41C 1H4EA 5EJ1A 2FYBA 2UZHA 3U2UA 3DK5A 1QG8A 4FIXA 3U2VA 2GGQA 4K6RA 1VM8A 5FUHA 2I5KA 1R7TA 4NANA 3CGXA 1HM9A 3V0NA 1KNKA 4E1KA 2RJ4A 4DDZA 5C38A 3LW6A 3I0DA 1H5RA 3TZTA 2GGOA 4KQLA 3PKPA 2RJ7A 5L6VA 1NKHB 3D98A 4B3UA 4B4BA 1QWJA 1VZUA 2XWLA 4FQWA 2AESA 2AM3A 3K2XA 2ICYA 4J18A 1R80A 3Q80A 4YS8A 4HOCA 3I0EA 4G3SA 4C8GA 4G3PA 1S4NA 4ASJA 5CQMX 2FY7A 4MIXA 1ZDFA 1ZI5A 4G87A 4D0TA 3I0HA 1H48A 3ZLLA 1ZI1A 2E3DA 3KE1A 1FGGA 4JD0A 4MYBA 2FYAA 1YQNA 2J0BA 4Y7FA 3QHDA 2AECA 4EEGA 3GHZA 4R7PA 5DDTA 1GX1A 2Y6PA 4BMAA 1GWVA 4KT7A 4KPXA 2VSHA 3USRA 1TVYA 1W77A 2AM4A 2WE9A 2AGDA 4FROA 2RIZA 4C8EA 1ZJOA 3I0IX 5CMFX 1EZIA 5C3AA 4B42A 4KC4A 4FREA 2AE7A 2FFVA 5C8RA 3OH0A 4Y6UA 2WVLA 4B4GA 4B4MA 4FRQA 1R7VA 2WEEA 5DDVA 1W55A 4UEGA 3T7OA 2QH5A 3DJ4A 2PMPA 4Y64A 2OI6A 4FRMA 1ZI3A 3OH1A 1H5SA 1U3LA 1G95A 3PKQA 4XWIA 3U0XA 5CMIA 1G93A 3I0CA 1H7TA 3KIAA 4MNDA 3RMWA 5L6SA 1T0AA 1ZCVA 5CQOA 1K4VA 1HM8A 1VH8A 1PZYB 2XWNA 3SX7A 1U3PA 1QGSA 3OH2A 4KXOA 1ZJ1A 1OMXA 2RITA 3V0OA 3SX8A 1W57A 3USQA 1LL3A 3PNNA 1VGTA 2VXLA 1Z90A 1FR9A 4CJBA 5IDTA 3SPTA 3D8VA 4C8IA 1OQMB 1S4PA 3RSBA 4HO0A 1S4OA 1ZCYA 4EE3A 5C49A 3CU0A 3IKEA 3E25A 2C0NA 1G0RA 1WT1A 2BO6A 3IEWA 1KWSA 3IOJA 1ZCUA 3OC9A 4FRHA 2RJ8A 4HO4A 3V0QA 2P72A 2VS4A 2J0AA 1VH1A 4AYJA 1H5SC 4DECA 1JVGA 5AJPA 3Q8HA 4CJCA 3V91A 4KNXA 2RIXA 1NHEB 2ICXA 1FO8A 1YP3A 2Y4LA 3HL3A 4FCEA 3T7NA 5CMGX 3V90A 2V0IA 3CKOA 5FTSA 1ZCTA 1H7LA 2RJ1A 2VFZA 1H5TA 2VS3A 1JN1A 2VD4A 1FG5N 1U43A 1H5RB 2WAWA 1FWYA 2W0WA 4NAKA 2RIYA 2BO8A 2BO7A 3V0PA 3DUVA 3I0GA 1HJLA 2Y7AA 1XZ6A 3SXGA 3GUEA 1FXOA 1V84A 1H3MA 1VHAA 1ZJ3A 4FIYA 4HG6A 4GBPA 3P10A 3T80A 2I5EA 4ARWA 5B8FA 3JVHA 5C1HA 1LVWA 1ON8A 2NXVA 1INJA 3V0MA 3ESJA 4D48A 1JV1A 3OH4A 4HO2A 4AAWA 2FYDB 5FV9A 4ZDQA 1O23B 4EE4A 1WT2A 1R81A 1VPAA 5C4DA 3F6MA 3P0ZA 2RJ9A 3U2TA 4O6NA 2X65A 4Y7UA 1FXJA 1ZJ2A 4M2BA 1NF5B 1H4CA 1VGUA 5C4EA 4ASYA 5D92A 2A8UA 1NQIB 2WVMA 3ZGFA 4C82A 5CQNX 5C3BA 4LW6A 2RJ6A 2ZU9A 2MZBA 4M4KA 1LZJA 3K8EA 2AM5A 1INIA 5C4BA 5AJOA 1FOAA 2OI7A 1G3LA 1O7OA 4AYLA 3EORA 1H4DA 1G23A 1VGZA 2GZLA 3FWWA 1H47A 1NMMB 5CMJA 1LZIA 4M28A 5C4CA 2YC5A 1H5SB 1VZTA 4HO8A 1JY8A 1GWWA 2Q4JA 4Q7CA 4KNRA 1V83A 1IV2A 4O6MA 1JYLA 1YP2A 1GX4A 4IRQA 4D11A 5EIYA 4EE5A 3D5NA 5JQQA 1PZTA 1V82A 3SXCA 2E8BA 5J49A 2RJ5A 3Q7UA 3TQDA 3ELCA 4HCQA 1ZI4A 2P73A 1H7QA 2PGYA 3N9WA 4D0ZA 1H5SD 3RMVA 5C48A 3I0KA 3JTJA 2V0JA 3OGZA 1H7HA 4B2WA 4KRVA 1LL2A 2APCA 2PGVA 1YP4A 2RJ0A 3K8DA 2VS5A 5I1FA 4HO5A 3IOIA 4FRBA 2O1FA 1HJJA 4ECMA 2X5ZA 1FGXA 2YQCA 3NGWA 3V8YA 1O7QA 4FRLA 5CMHA 1IV1A 5EJZA 4D11C 3IKFA 1XHBA 1NWGB 3ZLKA 1H5TB 1IIMA 3SXBA 1JV3A 5BXCA 1GQ9A 1WSZA 4P02A 2D0JA 1YROB 4FRDA 1JYKA 3BRKX 2XMEA 3U2WA 5AJNA 3V0LA 2OI5A 2ZU8A 3SXDA 1LZ0A 1R7YA 2JCLA 1R82A 4HO9A 3F0DA 1U40A 5FU8A 4EEOA 2XWMA 3RE3A 3ZGGA 1LL0A 5D91A 1EYRA 4C81A 1H7EA 2Y4MA 3U0YA 3K14A 1WVCA 1SS9A 2FFUA 2PX7A 2VK9A 5IDSA 5FYEA 1FR8A 1MP4A 1VH3A 3I0FA 1ZJPA 1WT3A 3F1CA 5CQLX 2JCJA 3F0FA 5IFYA 1H7FA 1FZWA 2WGZA 2UX8A 4Y7GA 4DE7A 3FBAA 3QVBA 3JUJA 5C47A 1VICA 3OAMA 2V0HA 1TZFA 1ZIZA 3IEQA 3SXAA 4EEAA 1JVDA 1ZJ0A 5C4FA 2JCOA 4KPZA 1MP3A 4LW3A 2YC3A 2XMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8Z A;  3FOQ A;  2CU2 A;  3CKQ A;  4CVH A;  3B6N A;  3R2W A;  4NAI A;  1FRW A;  3SXE A;  2ZU7 A;  2PA4 A;  4Y7V A;  3MBM A;  3I0L A;  1TW1 A;  1LZ7 A;  1ZHJ A;  3ZF8 A;  2YQS A;  3O3P A;  4Y9X A;  2P6W A;  2Z87 A;  1IIN A;  2DPW A;  2O1H A;  2X5S A;  3SX5 A;  4B2X A;  3OKR A;  2AH9 A;  2OEF A;  1G1L A;  1MC3 A;  1R7U A;  3F0E A;  1IV4 A;  1QGQ A;  1WT0 A;  3EE5 A;  4B5B A;  2OEG A;  4HO6 A;  1KNJ A;  2BO4 A;  2QGI A;  4P00 A;  1TW5 A;  4KC1 A;  3CKV A;  3I0J A;  2YQH A;  4HO3 A;  3FPI A;  5FTV A;  1GQC A;  2O1G A;  5C1G A;  1OMZ A;  4AC3 A;  1HM0 A;  4Y63 A;  1E5K A;  1MP5 A;  3ERN A;  4BQH A;  2YQJ A;  3CKJ A;  3IOH A;  2D7R A;  1G8O A;  4C2S A;  3OH3 A;  4Y7T A;  2V0L A;  3BCV A;  1O0R A;  4NAL A;  1ZDG A;  2X60 A;  1FO9 A;  3R3I A;  4Y6N A;  2Y4K A;  4EEM A;  1IV3 A;  2AMT A;  1ON6 A;  3JUK A;  2JCK A;  1G2V A;  1VGW A;  3E26 A;  2VSI A;  4KC2 A;  1GX0 A;  2VXM A;  4FRP A;  5C36 A;  1VZX A;  5C1L A;  3Q4S A;  2I7B A;  2Y4J A;  4IRP A;  3ST8 A;  2WVK A;  4JIS A;  3SX3 A;  1GA8 A;  5HS2 A;  3U2X A;  3CKN A;  3F0G A;  1H7G A;  1HV9 A;  1G97 A;  5FU0 A;  4G3Q A;  4FRA A;  2YES A;  1R7X A;  3F1Y A;  3T7M A;  2V0K A;  5C3D A;  4Y62 A;  2QKX A;  3POL A;  2D7I A;  1I52 A;  4M2A A;  2A8W A;  5CQP A;  4EVW A;  4FCU A;  1G9R A;  2FYC B;  2Z86 A;  4CJ8 A;  2YCM A;  2W0V A;  4L41 C;  1H4E A;  5EJ1 A;  2FYB A;  2UZH A;  3U2U A;  3DK5 A;  1QG8 A;  3U2V A;  2GGQ A;  4K6R A;  1VM8 A;  5FUH A;  2I5K A;  1R7T A;  4NAN A;  3CGX A;  1HM9 A;  3V0N A;  1KNK A;  4E1K A;  2RJ4 A;  4DDZ A;  5C38 A;  3LW6 A;  3I0D A;  1H5R A;  3TZT A;  2GGO A;  4KQL A;  3PKP A;  2RJ7 A;  5L6V A;  1NKH B;  3D98 A;  4B3U A;  4B4B A;  1QWJ A;  1VZU A;  2XWL A;  4FQW A;  2AES A;  2AM3 A;  3K2X A;  2ICY A;  4J18 A;  1R80 A;  3Q80 A;  4YS8 A;  4HOC A;  3I0E A;  4G3S A;  4C8G A;  4G3P A;  1S4N A;  4ASJ A;  5CQM X;  2FY7 A;  1ZDF A;  1ZI5 A;  4G87 A;  4D0T A;  3I0H A;  1H48 A;  3ZLL A;  1ZI1 A;  2E3D A;  3KE1 A;  1FGG A;  4JD0 A;  4MYB A;  2FYA A;  1YQN A;  4Y7F A;  3QHD A;  2AEC A;  4EEG A;  3GHZ A;  4R7P A;  5DDT A;  1GX1 A;  2Y6P A;  4BMA A;  1GWV A;  4KT7 A;  4KPX A;  2VSH A;  3USR A;  1TVY A;  1W77 A;  2AM4 A;  2WE9 A;  2AGD A;  4FRO A;  2RIZ A;  4C8E A;  1ZJO A;  3I0I X;  5CMF X;  1EZI A;  5C3A A;  4B42 A;  4KC4 A;  4FRE A;  2AE7 A;  2FFV A;  5C8R A;  3OH0 A;  4Y6U A;  2WVL A;  4B4G A;  4B4M A;  4FRQ A;  1R7V A;  2WEE A;  5DDV A;  1W55 A;  4UEG A;  3T7O A;  2QH5 A;  3DJ4 A;  2PMP A;  4Y64 A;  2OI6 A;  4FRM A;  1ZI3 A;  3OH1 A;  1H5S A;  1U3L A;  1G95 A;  3PKQ A;  4XWI A;  3U0X A;  5CMI A;  1G93 A;  3I0C A;  1H7T A;  3KIA A;  4MND A;  3RMW A;  5L6S A;  1T0A A;  1ZCV A;  5CQO A;  1K4V A;  1HM8 A;  1VH8 A;  1PZY B;  2XWN A;  3SX7 A;  1U3P A;  1QGS A;  3OH2 A;  4KXO A;  1ZJ1 A;  1OMX A;  2RIT A;  3V0O A;  3SX8 A;  1W57 A;  3USQ A;  1LL3 A;  3PNN A;  1VGT A;  2VXL A;  1Z90 A;  1FR9 A;  4CJB A;  5IDT A;  3SPT A;  3D8V A;  4C8I A;  1OQM B;  1S4P A;  3RSB A;  4HO0 A;  1S4O A;  1ZCY A;  4EE3 A;  5C49 A;  3CU0 A;  3IKE A;  3E25 A;  1G0R A;  1WT1 A;  2BO6 A;  3IEW A;  1KWS A;  3IOJ A;  1ZCU A;  3OC9 A;  4FRH A;  2RJ8 A;  4HO4 A;  3V0Q A;  2P72 A;  2VS4 A;  1VH1 A;  4AYJ A;  1H5S C;  4DEC A;  1JVG A;  5AJP A;  3Q8H A;  4CJC A;  3V91 A;  4KNX A;  2RIX A;  1NHE B;  2ICX A;  1FO8 A;  1YP3 A;  2Y4L A;  3HL3 A;  4FCE A;  3T7N A;  5CMG X;  3V90 A;  2V0I A;  3CKO A;  5FTS A;  1ZCT A;  1H7L A;  2RJ1 A;  2VFZ A;  1H5T A;  2VS3 A;  1JN1 A;  2VD4 A;  1FG5 N;  1U43 A;  1H5R B;  2WAW A;  1FWY A;  2W0W A;  4NAK A;  2RIY A;  2BO8 A;  2BO7 A;  3V0P A;  3DUV A;  3I0G A;  1HJL A;  2Y7A A;  1XZ6 A;  3SXG A;  3GUE A;  1FXO A;  1V84 A;  1H3M A;  1VHA A;  1ZJ3 A;  4HG6 A;  4GBP A;  3P10 A;  3T80 A;  2I5E A;  4ARW A;  5B8F A;  3JVH A;  5C1H A;  1LVW A;  1ON8 A;  2NXV A;  1INJ A;  3V0M A;  3ESJ A;  4D48 A;  1JV1 A;  3OH4 A;  4HO2 A;  4AAW A;  2FYD B;  5FV9 A;  4ZDQ A;  1O23 B;  4EE4 A;  1WT2 A;  1R81 A;  1VPA A;  5C4D A;  3F6M A;  3P0Z A;  2RJ9 A;  3U2T A;  4Y7U A;  2X65 A;  1FXJ A;  1ZJ2 A;  4M2B A;  1NF5 B;  1H4C A;  1VGU A;  5C4E A;  4ASY A;  2A8U A;  1NQI B;  2WVM A;  3ZGF A;  4C82 A;  5CQN X;  5C3B A;  4LW6 A;  2RJ6 A;  2ZU9 A;  2MZB A;  4M4K A;  1LZJ A;  3K8E A;  2AM5 A;  1INI A;  5C4B A;  5AJO A;  1FOA A;  2OI7 A;  1G3L A;  1O7O A;  4AYL A;  3EOR A;  1H4D A;  1G23 A;  1VGZ A;  2GZL A;  3FWW A;  1H47 A;  1NMM B;  5CMJ A;  1LZI A;  4M28 A;  5C4C A;  2YC5 A;  1H5S B;  1VZT A;  4HO8 A;  1JY8 A;  1GWW A;  2Q4J A;  4KNR A;  1V83 A;  1IV2 A;  1JYL A;  1YP2 A;  1GX4 A;  4IRQ A;  4D11 A;  5EIY A;  4EE5 A;  3D5N A;  5JQQ A;  1PZT A;  1V82 A;  3SXC A;  2E8B A;  5J49 A;  2RJ5 A;  3Q7U A;  3TQD A;  3ELC A;  4HCQ A;  1ZI4 A;  2P73 A;  1H7Q A;  2PGY A;  3N9W A;  4D0Z A;  1H5S D;  3RMV A;  5C48 A;  3I0K A;  3JTJ A;  2V0J A;  3OGZ A;  1H7H A;  4B2W A;  4KRV A;  1LL2 A;  2APC A;  2PGV A;  1YP4 A;  2RJ0 A;  3K8D A;  2VS5 A;  5I1F A;  4HO5 A;  3IOI A;  4FRB A;  2O1F A;  1HJJ A;  4ECM A;  2X5Z A;  1FGX A;  2YQC A;  3NGW A;  3V8Y A;  1O7Q A;  4FRL A;  5CMH A;  1IV1 A;  5EJZ A;  4D11 C;  3IKF A;  1XHB A;  1NWG B;  3ZLK A;  1H5T B;  1IIM A;  3SXB A;  1JV3 A;  5BXC A;  1GQ9 A;  1WSZ A;  4P02 A;  2D0J A;  1YRO B;  4FRD A;  1JYK A;  3BRK X;  2XME A;  3U2W A;  5AJN A;  3V0L A;  2OI5 A;  2ZU8 A;  3SXD A;  1LZ0 A;  1R7Y A;  2JCL A;  1R82 A;  4HO9 A;  3F0D A;  1U40 A;  5FU8 A;  4EEO A;  2XWM A;  3RE3 A;  3ZGG A;  1LL0 A;  1EYR A;  4C81 A;  1H7E A;  2Y4M A;  3U0Y A;  3K14 A;  1WVC A;  1SS9 A;  2FFU A;  2PX7 A;  5IDS A;  5FYE A;  1FR8 A;  1MP4 A;  1VH3 A;  3I0F A;  1ZJP A;  1WT3 A;  3F1C A;  5CQL X;  2JCJ A;  3F0F A;  5IFY A;  1H7F A;  1FZW A;  2WGZ A;  2UX8 A;  4Y7G A;  4DE7 A;  3FBA A;  3QVB A;  3JUJ A;  5C47 A;  1VIC A;  3OAM A;  2V0H A;  1TZF A;  1ZIZ A;  3IEQ A;  3SXA A;  4EEA A;  1JVD A;  1ZJ0 A;  5C4F A;  2JCO A;  4KPZ A;  1MP3 A;  4LW3 A;  2YC3 A;  2XMH A; 
#chains in the Genus database with same CATH topology
 1K9M H;  1VQO F;  1YJN F;  2QA4 F;  1SA0 B;  1FRW A;  2V9Y A;  2CVL A;  1TW1 A;  1LZ7 A;  3ZF8 A;  4Y9X A;  2P6W A;  2X5S A;  3OKR A;  2OEF A;  2Z01 A;  2ALE A;  4BT6 A;  2BO4 A;  1TW5 A;  3VYS C;  3LWQ C;  3CKV A;  2Z1F A;  3ERN A;  2YQJ A;  3CKJ A;  3IOH A;  4RHA A;  1TUB A;  3P4E A;  5EO3 A;  1UFY A;  1O0R A;  2YXZ A;  3R3I A;  1M90 H;  1IV3 A;  4O4H B;  2JCK A;  4X1K B;  3GTZ A;  4FRP A;  1VZX A;  3Q4S A;  1W42 A;  4IRP A;  3SX3 A;  5LOV A;  5FU0 A;  3V3T A;  5GAN K;  3F1Y A;  3T7M A;  4Y62 A;  2QKX A;  5EWR A;  4YJ2 A;  3NVI B;  3VOB A;  2W0V A;  4L41 C;  5DCV A;  1W41 A;  3DDN A;  3DK5 A;  1W40 A;  2AIF A;  2I5K A;  4NAN A;  3CGX A;  4F6R B;  4I50 B;  2RJ4 A;  3TZT A;  5BMV A;  4G4Y A;  2LCA A;  3K2X A;  2ICY A;  4YS8 A;  1R80 A;  3OBW A;  3I0E A;  1YGY A;  4ASJ A;  2FGY A;  5CQM X;  1H48 A;  2KTV A;  4JD0 A;  1YQN A;  4Y7F A;  4R7P A;  3CCU F;  4KPX A;  4FRO A;  2WE9 A;  5EZY B;  1X52 A;  1EZI A;  3K0T A;  2W8B C;  3E20 B;  3KHN A;  4BT2 A;  5C8R A;  4ZOL B;  3RA6 A;  4ZK7 A;  3T7O A;  4BT7 A;  3DJ4 A;  2OI6 A;  4FRM A;  3OH1 A;  3PKQ A;  1GO1 A;  3JAW B;  3WGM A;  3CCE F;  5L6S A;  1K4V A;  1HM8 A;  3RYF A;  3OH2 A;  1ZJ1 A;  3V0O A;  3USQ A;  2EWC A;  5HY0 A;  4EI9 A;  1CK2 A;  3TD4 A;  1JFF B;  1FR9 A;  3D8V A;  4HO0 A;  1S4O A;  5CA0 B;  1VQ6 F;  1KWS A;  4HO4 A;  4FRH A;  1KQS F;  2RJ8 A;  1H5S C;  2BTU A;  4NQ3 A;  4KNX A;  4TZZ A;  2RIX A;  1J7H A;  4FCE A;  3RYH B;  2KG4 A;  3T7N A;  5CMG X;  3CKO A;  1YHQ F;  2DYY A;  4PWT A;  1H7L A;  2VFZ A;  1H5T A;  1U43 A;  1H5R B;  4LNU B;  2ZAU A;  3V0P A;  4ZHV A;  3SXG A;  1FXO A;  3P10 A;  3E22 B;  3JVH A;  3V0M A;  3ESJ A;  2OZB A;  2CWJ A;  1XRG A;  2FYD B;  1VQV A;  5FV9 A;  1M1K H;  4EE4 A;  1WT2 A;  5C4D A;  3SIV A;  2RJ9 A;  4Y7U A;  2ZOV A;  1TVK A;  2HX0 A;  4BVS A;  5C4E A;  3KIZ A;  1Q82 H;  1ONI A;  2WAL A;  5JVD A;  1XHO A;  2RJ6 A;  2ZU9 A;  5AJO A;  1SA0 A;  2ZVZ A;  1FOA A;  4YJ3 B;  2OI7 A;  3NVK E;  1G23 A;  3FWW A;  3CG6 A;  1H47 A;  5CMJ A;  5C4C A;  1H5S B;  4Q7C A;  1V83 A;  3BYQ A;  3ZP4 A;  3N2G B;  3RYI B;  4D11 A;  3HKB B;  3WPW A;  3G71 F;  4HCQ A;  1ZI4 A;  2P73 A;  3U0O A;  1H7Q A;  3CD6 F;  2MQE A;  3LME A;  2V0J A;  2BO1 A;  4B2W A;  4KRV A;  1LL2 A;  2APC A;  5HY4 A;  5LXT B;  1YIJ F;  4O4H A;  4X1K A;  3NGW A;  1Z5W A;  1O7Q A;  3MCA B;  4FRL A;  4BT3 A;  5GON B;  1CLI A;  3ZLK A;  2HQS C;  1IIM A;  5BXC A;  2QTP A;  4P02 A;  1NQ3 A;  2HS3 A;  5HXZ A;  2D0J A;  3BRK X;  5EIB C;  2ZU8 A;  1LZ0 A;  1R82 A;  4ZI7 B;  4HO9 A;  3V7Q A;  1K8A H;  5D91 A;  4E6E A;  3U0Y A;  3K14 A;  4NUT A;  2PX7 A;  5IDS A;  1ZJP A;  5CQL X;  3F0F A;  5IFY A;  4F6R A;  4I50 A;  3QVB A;  1VIC A;  2AIZ P;  1X7P A;  2HS0 A;  1JVD A;  1ZJ0 A;  4DRX B;  5C4F A;  4KPZ A;  2YC3 A;  3CKQ A;  3B6N A;  3R2W A;  2PA4 A;  3MBM A;  3VYT C;  2Z87 A;  2DPW A;  5A2Q M;  1G1L A;  1MC3 A;  1W3E X;  3NMU C;  4HO6 A;  2Z1E A;  5EZY A;  3WGN A;  1VQN F;  4P00 A;  1SZQ A;  2YQH A;  1W5A A;  1VQ9 F;  2O1G A;  5C1G A;  1HM0 A;  4Y63 A;  2QEX F;  2OTM A;  1G8O A;  4C2S A;  3OH3 A;  4Y7T A;  3BCV A;  4NAL A;  2X60 A;  2B33 A;  3JAW A;  1OFU A;  1QVG F;  4EEM A;  2AMT A;  3I55 F;  1VGW A;  3HWU A;  2VSI A;  3CC7 F;  2RHO A;  3OW2 F;  3ST8 A;  2WVK A;  3WJP A;  1GA8 A;  3PLA C;  1JFF A;  1H7G A;  1HV9 A;  2YES A;  1R7X A;  1W5F A;  5C3D A;  3VOA A;  5CA0 A;  1W2B F;  4M2A A;  2A8W A;  3CCM F;  2YCM A;  5HXU A;  1XV2 A;  3N2K B;  2UZH A;  3S0H A;  2H8C A;  3U2V A;  2GGQ A;  4K6R A;  3RYH A;  1R7T A;  4E1K A;  4BT5 A;  1H5R A;  2GGO A;  3VMF B;  3DC2 A;  2RJ7 A;  4LNU A;  5L6V A;  5GIO C;  3D98 A;  4B3U A;  1VZU A;  2Q1X A;  2AES A;  3Q80 A;  1X25 A;  4G3P A;  1YIT F;  1S4N A;  3E22 A;  2FY7 A;  1ZDF A;  3ZLL A;  4X3L A;  1FGG A;  1W5E A;  3CCL F;  4G4V A;  3HAX D;  2IG8 A;  4G4W A;  2ZVY A;  1T0K B;  1GX1 A;  1DT9 A;  2VSH A;  4O4L B;  3WJR A;  3NK7 A;  1W77 A;  2I6R A;  3ON1 A;  4C8E A;  4BVQ A;  5C3A A;  4KC4 A;  4FRE A;  2FFV A;  3I7T A;  2OTJ F;  1ZWZ A;  3LWO C;  1KC8 H;  3OH0 A;  4Y6U A;  2WVL A;  4YJ3 A;  5DDV A;  1W55 A;  2RB9 A;  1FNJ A;  3TD5 A;  1VQL F;  4Y64 A;  3M84 A;  1ZI3 A;  1H5S A;  3U0X A;  3FD6 A;  2HS4 A;  2Z1T A;  5CMI A;  1H7T A;  2Q1Y A;  3KIA A;  1FFX B;  3QTY A;  1T0A A;  5GIN C;  1PZY B;  3N2G A;  2XWN A;  3RYI A;  1QGS A;  1W57 A;  5IJ9 B;  3HKB A;  1LL3 A;  3PNN A;  3S0W A;  5HP8 A;  2NMU A;  3SPT A;  4U3J B;  1OQM B;  1S4P A;  4DXD A;  4EE3 A;  3V7E A;  3I56 F;  3IEW A;  3V0Q A;  2P72 A;  2J0A A;  4B62 A;  1VH1 A;  5LXT A;  4DEC A;  4RQO A;  4CJC A;  2L26 A;  1NHE B;  1GO0 A;  2Y4L A;  3HL3 A;  2V0I A;  5GON A;  5FTS A;  5J2T B;  2VS3 A;  2VD4 A;  5MN6 A;  2HRY A;  5MN5 A;  3I0G A;  1HJL A;  2Y7A A;  4ZI7 A;  2VAM A;  1V84 A;  4ZHW A;  5EYP B;  3T80 A;  5B8F A;  5C1H A;  3LYB A;  4AAW A;  3OH4 A;  4HO2 A;  2RHL A;  5EB0 A;  4ZDQ A;  3ZO8 A;  3U2T A;  3LFO A;  2CHT A;  4M2B A;  2UYJ A;  1H4C A;  1VGU A;  3E1Y A;  4XCQ A;  3CXC F;  1RA4 A;  3ZGF A;  4DRX A;  2MZB A;  1LZJ A;  3CCS F;  4AYL A;  3EOR A;  2GZL A;  2IQQ A;  1NMM B;  1LZI A;  4M28 A;  3AGK A;  4HO8 A;  2PHN A;  1QU9 A;  1IV2 A;  3KJJ A;  1JYL A;  1YP2 A;  4U39 A;  1GX4 A;  3JAS B;  3VIU A;  5J49 A;  3HKE B;  3ZOP A;  3ELC A;  4D0Z A;  2PGY A;  5C48 A;  3I0K A;  3JTJ A;  3OGZ A;  4M8I A;  1JD1 A;  2RJ0 A;  5GIP C;  3IOI A;  4G88 A;  2RHJ A;  4ECM A;  1FGX A;  3D01 A;  4ZHY B;  4BVT A;  3NK6 A;  2IAF A;  1NWG B;  1ODE A;  2XME A;  3U2W A;  3V0L A;  2OI5 A;  3SXD A;  4X1Y B;  1S72 F;  5IYZ B;  4EEO A;  2JNB A;  2F9Z C;  3CYQ A;  2FC3 A;  2VAP A;  3N2K A;  1SS9 A;  2VGM A;  5FYE A;  4O2B B;  2JCJ A;  3JAK B;  1FZW A;  4Y7G A;  1CN7 A;  3CPQ A;  3S02 A;  3PAF A;  3JUJ A;  3WJQ A;  1TZF A;  2P6Y A;  1VK3 A;  4R40 B;  3MCQ A;  3MQW A;  5ITZ B;  5GAP K;  2XMH A;  3V8Z A;  4NAI A;  3SXE A;  2I6D A;  2ZU7 A;  2HP0 B;  4B45 A;  4Y7V A;  4TV8 B;  2HVY D;  1ZHJ A;  2YQS A;  2VXY A;  3SX5 A;  5IT9 M;  3N4Z A;  4X1I B;  1KD1 H;  4O4L A;  3CPW F;  2OEG A;  1Z5V A;  1W58 1;  4KC1 A;  3I0J A;  5JQG B;  3FPI A;  1GQC A;  1OMZ A;  4AC3 A;  1E5K A;  2D7R A;  2V0L A;  3RYC B;  2GVI A;  4Y6N A;  5LA6 B;  1FFX A;  3G6E F;  1G2V A;  5FNV B;  3E26 A;  4KC2 A;  3FD5 A;  3O85 A;  5IJ9 A;  4JIS A;  5HS2 A;  3CKN A;  3F0G A;  3CCQ F;  4U3J A;  4FRA A;  2V0K A;  3WPX A;  3POL A;  1I52 A;  5CB4 B;  5FLX M;  4EVW A;  4FCU A;  3M4S A;  2UYP A;  2Z86 A;  5HY2 A;  2UYN B;  3RA5 A;  1PF5 A;  1H4E A;  5EJ1 A;  2FYB A;  1GZ0 A;  1W59 A;  3CCV F;  1QG8 A;  4FIX A;  1QVF F;  1VM8 A;  3V0N A;  1KNK A;  5J2T A;  2CSL A;  5C38 A;  3LW6 A;  3I0D A;  3PKP A;  4BW0 B;  4BT4 A;  1NKH B;  4FQW A;  4J18 A;  4I4T B;  1SDS A;  4HOC A;  5EYP A;  4G3S A;  4C8G A;  1NMU B;  1COM A;  4D0T A;  3I0H A;  1DBF A;  2E3D A;  3KE1 A;  5KX5 B;  3QHD A;  3GHZ A;  4BMA A;  1GWV A;  4KT7 A;  2AM4 A;  3WGL A;  2RIZ A;  3I3F A;  1ZJO A;  3C9U A;  3I0I X;  5CMF X;  4B42 A;  4B4M A;  1R7V A;  3V4D A;  2WEE A;  3HKD B;  2QH5 A;  2PMP A;  1U3L A;  2R6R 1;  4O4I B;  3CC2 F;  1G95 A;  4XWI A;  3I0C A;  3RMW A;  5CQO A;  1VH8 A;  1IPA A;  3SX7 A;  3JAS A;  1VQM F;  4KXO A;  3WGJ A;  3SX8 A;  3C9R A;  5G4V C;  3HKE A;  2UYK A;  3ZP7 A;  1VGT A;  3FFM A;  2VXL A;  5KMG B;  4CJB A;  5IDT A;  4C8I A;  1ZCY A;  3HTN A;  5C49 A;  3D54 A;  2OHW A;  1G0R A;  1WT1 A;  2BO6 A;  3IOJ A;  1ZCU A;  2VS4 A;  1JVG A;  5AJP A;  1Q7Y H;  3Q8H A;  3WXM B;  5IJ0 B;  2ICX A;  5J2U B;  5LP6 B;  1FO8 A;  1YP3 A;  1YJW F;  1ZCT A;  1FG5 N;  2WAW A;  2LBT A;  1FWY A;  2W0W A;  4NAK A;  1RQ2 A;  2RIY A;  2BO8 A;  4X1Y A;  3S06 A;  4EI7 A;  3KJK A;  5CA1 B;  5IYZ A;  1VHA A;  3CCR F;  1ZJ3 A;  4FIY A;  4GBP A;  1VQ7 F;  4ZHQ B;  2I5E A;  1LVW A;  1ON8 A;  2NXV A;  4D48 A;  1JV1 A;  4EB6 B;  1O23 B;  3K12 A;  1VPA A;  4O2B A;  3JAK A;  1NF5 B;  4IHJ B;  5D92 A;  1NQI B;  1K73 H;  1X7O A;  5ITZ A;  4LW6 A;  4M4K A;  5LYJ B;  3K8E A;  3IR9 A;  1INI A;  3CYP B;  4WBN B;  1G3L A;  1VGZ A;  2HP0 A;  4TV8 A;  3VTI C;  3JAT B;  4X1I A;  1VZT A;  1JY8 A;  2BTO A;  1GWW A;  1JJ2 F;  5JCO C;  4KNR A;  1VQP F;  4O6M A;  4IRQ A;  5JQQ A;  1PZT A;  1V82 A;  1E7K A;  5JQG A;  3TQD A;  2HRU A;  3VYU C;  3J81 M;  1VQ5 F;  1FNK A;  3N9W A;  4KWE A;  4HNA B;  3K8D A;  3HKC B;  3RYC A;  4HO5 A;  2O1F A;  1HJJ A;  5LA6 A;  1Q8R A;  3C9T A;  1NJI H;  5FNV A;  4FFB B;  2YQC A;  5EIB D;  3QUW A;  5CMH A;  1UI9 A;  1IV1 A;  2GLZ A;  3CME F;  1GQ9 A;  2LBX A;  3S0Y A;  1YRO B;  5AJN A;  1RQ7 A;  1QD9 A;  2QI2 A;  1R7Y A;  5CB4 A;  2ZF8 A;  3F0D A;  4TUY B;  2UYN A;  2XWM A;  3ZGG A;  4G4Z A;  3TD3 A;  1H7M A;  4O4J B;  1H7E A;  1FR8 A;  1MP4 A;  1VH3 A;  1WT3 A;  3JAL B;  1H7F A;  2WGZ A;  4DE7 A;  3FBA A;  1VQK F;  2RHH A;  2V0H A;  1ZIZ A;  3IEQ A;  4I4T A;  4EEA A;  2JCO A;  4LW3 A;  3J7A R;  3FOQ A;  2CU2 A;  3S03 A;  4CVH A;  3I0L A;  2H8E A;  3CMA F;  3O3P A;  5KX5 A;  1IIN A;  2O1H A;  4B2X A;  2AH9 A;  1R7U A;  1OAP A;  1IV4 A;  3F0E A;  1QGQ A;  1WT0 A;  3EE5 A;  4B5B A;  1KNJ A;  2QGI A;  2CHS A;  3J80 M;  5C8Y B;  4HO3 A;  5JH7 B;  5FTV A;  3C9S A;  1MP5 A;  4BQH A;  3HKD A;  3CCJ F;  4O4I A;  1ZDG A;  1FO9 A;  4X3M A;  2Y4K A;  4BY9 D;  1ON6 A;  3JUK A;  1GX0 A;  2VXM A;  2KTU A;  3LWR C;  5C36 A;  5C1L A;  2I7B A;  2Y4J A;  2K1S A;  2HP3 A;  5KMG A;  3U2X A;  1G97 A;  4G3Q A;  4O2A B;  1RLU A;  2D7I A;  4I55 B;  2OTL F;  5CQP A;  4TV9 B;  1G9R A;  2FYC B;  4CJ8 A;  3JAR B;  5IJ0 A;  5J2U A;  3OBY A;  5LP6 A;  3U2U A;  3VCZ A;  3R0P A;  5FUH A;  4X20 B;  2VGN A;  1HM9 A;  4DDZ A;  3UT5 B;  4KQL A;  4G4X A;  4B4B A;  1QWJ A;  2XWL A;  2AM3 A;  5CA1 A;  3N4Y A;  4IIJ B;  4ZHQ A;  3LDT A;  4MIX A;  1ZI5 A;  2BTQ B;  4G87 A;  4EB6 A;  1RLG A;  1ZI1 A;  2CZW A;  3WGK A;  4C4W C;  3L7Q A;  1N8R H;  4MYB A;  2FYA A;  2J0B A;  2AEC A;  4EEG A;  5DDT A;  2Y6P A;  3USR A;  4IHJ A;  1TVY A;  2AGD A;  1W5B A;  4BVR A;  3C8L A;  2AE7 A;  5LYJ A;  3G4S F;  1Q81 H;  2KGW A;  4WBN A;  4B4G A;  4FRQ A;  5MN4 A;  4UEG A;  4EI8 A;  1TUB B;  3JAT A;  1QAH A;  1G93 A;  4MND A;  1ZCV A;  1U3P A;  1OMX A;  2RIT A;  2CW4 A;  1Z90 A;  5LOV B;  3RSB A;  3CU0 A;  3IKE A;  3E25 A;  4YJ2 B;  4HNA A;  2C0N A;  3OC9 A;  3HKC A;  3LWV C;  4AYJ A;  3V91 A;  3VO8 A;  4FFB A;  3OON A;  3V90 A;  5HP7 A;  2RJ1 A;  1JN1 A;  1YJ9 F;  5EB1 B;  5BMV B;  2BO7 A;  3DUV A;  1XZ6 A;  3GUE A;  1H3M A;  4TUY A;  4HG6 A;  3HJW C;  4ARW A;  2LBW A;  1INJ A;  4O4J A;  3IMP A;  5AVM A;  1VQ8 F;  1R81 A;  3F6M A;  3P0Z A;  5LP6 C;  4O6N A;  2X65 A;  3JAL A;  1FXJ A;  1ZJ2 A;  1Q86 H;  5JCO A;  5HY1 A;  5EAZ A;  5FJ4 C;  3CB2 A;  4ASY A;  2A8U A;  4NWO B;  2WVM A;  4C82 A;  5CQN X;  5C3B A;  2G9I A;  1FSZ A;  2YYE A;  2AM5 A;  5C4B A;  1O7O A;  1H4D A;  3JAM M;  2N48 A;  3M1X A;  2YC5 A;  4LCK A;  2Q4J A;  1YI2 F;  3RYF B;  5EIY A;  4EE5 A;  3D5N A;  4ZOL A;  3SXC A;  2E8B A;  5C8Y A;  2RJ5 A;  3Q7U A;  5JH7 A;  1H5S D;  3RMV A;  1H7H A;  2PGV A;  1YP4 A;  2H6L A;  5HWE A;  2VS5 A;  5I1F A;  3MDO A;  4FRB A;  2DT4 A;  2X5Z A;  2Z1U A;  3V8Y A;  5EJZ A;  4D11 C;  3IKF A;  1XHB A;  1H5T B;  3SXB A;  1JV3 A;  1WSZ A;  4FRD A;  1JYK A;  4O2A A;  1PXW A;  4I55 A;  2JCL A;  4TV9 A;  1U40 A;  3LWP C;  5FU8 A;  3RE3 A;  1LL0 A;  4B5C A;  3JAR A;  4B46 A;  1EYR A;  4C81 A;  2Y4M A;  3GYQ A;  1WVC A;  2FFU A;  2VK9 A;  1R1M A;  3I0F A;  4X20 A;  2ZOD A;  3F1C A;  5G4U C;  3JCM M;  3D00 A;  2UX8 A;  1XBI A;  3UT5 A;  1TVK B;  3SIU A;  3CC4 F;  1VQ4 F;  5C47 A;  3OAM A;  3VI6 A;  3SXA A;  5JVD B;  4ERH A;  4IIJ A;  1MP3 A;  2R75 1;  2VAW A; 
#chains in the Genus database with same CATH homology
 3V8Z A;  3FOQ A;  2CU2 A;  3CKQ A;  4CVH A;  3B6N A;  3R2W A;  4NAI A;  1FRW A;  3SXE A;  2ZU7 A;  2PA4 A;  4Y7V A;  3MBM A;  3I0L A;  1TW1 A;  1LZ7 A;  1ZHJ A;  3ZF8 A;  2YQS A;  3O3P A;  4Y9X A;  2P6W A;  2Z87 A;  1IIN A;  2DPW A;  2O1H A;  2X5S A;  3SX5 A;  4B2X A;  3OKR A;  2AH9 A;  2OEF A;  1G1L A;  1MC3 A;  1R7U A;  3F0E A;  1IV4 A;  1QGQ A;  1WT0 A;  3EE5 A;  4B5B A;  2OEG A;  4HO6 A;  1KNJ A;  2BO4 A;  2QGI A;  4P00 A;  1TW5 A;  4KC1 A;  3CKV A;  3I0J A;  2YQH A;  4HO3 A;  3FPI A;  5FTV A;  1GQC A;  2O1G A;  5C1G A;  1OMZ A;  4AC3 A;  1HM0 A;  4Y63 A;  1E5K A;  1MP5 A;  3ERN A;  4BQH A;  2YQJ A;  3CKJ A;  3IOH A;  2D7R A;  1G8O A;  4C2S A;  3OH3 A;  4Y7T A;  2V0L A;  3BCV A;  1O0R A;  4NAL A;  1ZDG A;  2X60 A;  1FO9 A;  3R3I A;  4Y6N A;  2Y4K A;  4EEM A;  1IV3 A;  2AMT A;  1ON6 A;  3JUK A;  2JCK A;  1G2V A;  1VGW A;  3E26 A;  2VSI A;  4KC2 A;  1GX0 A;  2VXM A;  4FRP A;  5C36 A;  1VZX A;  5C1L A;  3Q4S A;  2I7B A;  2Y4J A;  4IRP A;  3ST8 A;  2WVK A;  4JIS A;  3SX3 A;  1GA8 A;  5HS2 A;  3U2X A;  3CKN A;  3F0G A;  1H7G A;  1HV9 A;  1G97 A;  5FU0 A;  4G3Q A;  4FRA A;  2YES A;  1R7X A;  3F1Y A;  3T7M A;  2V0K A;  5C3D A;  4Y62 A;  2QKX A;  3POL A;  2D7I A;  1I52 A;  4M2A A;  2A8W A;  5CQP A;  4EVW A;  4FCU A;  1G9R A;  2FYC B;  2Z86 A;  4CJ8 A;  2YCM A;  2W0V A;  4L41 C;  1H4E A;  5EJ1 A;  2FYB A;  2UZH A;  3U2U A;  3DK5 A;  1QG8 A;  4FIX A;  3U2V A;  2GGQ A;  4K6R A;  1VM8 A;  5FUH A;  2I5K A;  1R7T A;  4NAN A;  3CGX A;  1HM9 A;  3V0N A;  1KNK A;  4E1K A;  2RJ4 A;  4DDZ A;  5C38 A;  3LW6 A;  3I0D A;  1H5R A;  3TZT A;  2GGO A;  4KQL A;  3PKP A;  2RJ7 A;  5L6V A;  1NKH B;  3D98 A;  4B3U A;  4B4B A;  1QWJ A;  1VZU A;  2XWL A;  4FQW A;  2AES A;  2AM3 A;  3K2X A;  2ICY A;  4J18 A;  1R80 A;  3Q80 A;  4YS8 A;  4HOC A;  3I0E A;  4G3S A;  4C8G A;  4G3P A;  1S4N A;  4ASJ A;  5CQM X;  2FY7 A;  4MIX A;  1ZDF A;  1ZI5 A;  4G87 A;  4D0T A;  3I0H A;  1H48 A;  3ZLL A;  1ZI1 A;  2E3D A;  3KE1 A;  1FGG A;  4JD0 A;  4MYB A;  2FYA A;  1YQN A;  2J0B A;  4Y7F A;  3QHD A;  2AEC A;  4EEG A;  3GHZ A;  4R7P A;  5DDT A;  1GX1 A;  2Y6P A;  4BMA A;  1GWV A;  4KT7 A;  4KPX A;  2VSH A;  3USR A;  1TVY A;  1W77 A;  2AM4 A;  2WE9 A;  2AGD A;  4FRO A;  2RIZ A;  4C8E A;  1ZJO A;  3I0I X;  5CMF X;  1EZI A;  5C3A A;  4B42 A;  4KC4 A;  4FRE A;  2AE7 A;  2FFV A;  5C8R A;  3OH0 A;  4Y6U A;  2WVL A;  4B4G A;  4B4M A;  4FRQ A;  1R7V A;  2WEE A;  5DDV A;  1W55 A;  4UEG A;  3T7O A;  2QH5 A;  3DJ4 A;  2PMP A;  4Y64 A;  2OI6 A;  4FRM A;  1ZI3 A;  3OH1 A;  1H5S A;  1U3L A;  1G95 A;  3PKQ A;  4XWI A;  3U0X A;  5CMI A;  1G93 A;  3I0C A;  1H7T A;  3KIA A;  4MND A;  3RMW A;  5L6S A;  1T0A A;  1ZCV A;  5CQO A;  1K4V A;  1HM8 A;  1VH8 A;  1PZY B;  2XWN A;  3SX7 A;  1U3P A;  1QGS A;  3OH2 A;  4KXO A;  1ZJ1 A;  1OMX A;  2RIT A;  3V0O A;  3SX8 A;  1W57 A;  3USQ A;  1LL3 A;  3PNN A;  1VGT A;  2VXL A;  1Z90 A;  1FR9 A;  4CJB A;  5IDT A;  3SPT A;  3D8V A;  4C8I A;  1OQM B;  1S4P A;  3RSB A;  4HO0 A;  1S4O A;  1ZCY A;  4EE3 A;  5C49 A;  3CU0 A;  3IKE A;  3E25 A;  2C0N A;  1G0R A;  1WT1 A;  2BO6 A;  3IEW A;  1KWS A;  3IOJ A;  1ZCU A;  3OC9 A;  4FRH A;  2RJ8 A;  4HO4 A;  3V0Q A;  2P72 A;  2VS4 A;  2J0A A;  1VH1 A;  4AYJ A;  1H5S C;  4DEC A;  1JVG A;  5AJP A;  3Q8H A;  4CJC A;  3V91 A;  4KNX A;  2RIX A;  1NHE B;  2ICX A;  1FO8 A;  1YP3 A;  2Y4L A;  3HL3 A;  4FCE A;  3T7N A;  5CMG X;  3V90 A;  2V0I A;  3CKO A;  5FTS A;  1ZCT A;  1H7L A;  2RJ1 A;  2VFZ A;  1H5T A;  2VS3 A;  1JN1 A;  2VD4 A;  1FG5 N;  1U43 A;  1H5R B;  2WAW A;  1FWY A;  2W0W A;  4NAK A;  2RIY A;  2BO8 A;  2BO7 A;  3V0P A;  3DUV A;  3I0G A;  1HJL A;  2Y7A A;  1XZ6 A;  3SXG A;  3GUE A;  1FXO A;  1V84 A;  1H3M A;  1VHA A;  1ZJ3 A;  4FIY A;  4HG6 A;  4GBP A;  3P10 A;  3T80 A;  2I5E A;  4ARW A;  5B8F A;  3JVH A;  5C1H A;  1LVW A;  1ON8 A;  2NXV A;  1INJ A;  3V0M A;  3ESJ A;  4D48 A;  1JV1 A;  3OH4 A;  4HO2 A;  4AAW A;  2FYD B;  5FV9 A;  4ZDQ A;  1O23 B;  4EE4 A;  1WT2 A;  1R81 A;  1VPA A;  5C4D A;  3F6M A;  3P0Z A;  2RJ9 A;  3U2T A;  4O6N A;  2X65 A;  4Y7U A;  1FXJ A;  1ZJ2 A;  4M2B A;  1NF5 B;  1H4C A;  1VGU A;  5C4E A;  4ASY A;  5D92 A;  2A8U A;  1NQI B;  2WVM A;  3ZGF A;  4C82 A;  5CQN X;  5C3B A;  4LW6 A;  2RJ6 A;  2ZU9 A;  2MZB A;  4M4K A;  1LZJ A;  3K8E A;  2AM5 A;  1INI A;  5C4B A;  5AJO A;  1FOA A;  2OI7 A;  1G3L A;  1O7O A;  4AYL A;  3EOR A;  1H4D A;  1G23 A;  1VGZ A;  2GZL A;  3FWW A;  1H47 A;  1NMM B;  5CMJ A;  1LZI A;  4M28 A;  5C4C A;  2YC5 A;  1H5S B;  1VZT A;  4HO8 A;  1JY8 A;  1GWW A;  2Q4J A;  4Q7C A;  4KNR A;  1V83 A;  1IV2 A;  4O6M A;  1JYL A;  1YP2 A;  1GX4 A;  4IRQ A;  4D11 A;  5EIY A;  4EE5 A;  3D5N A;  5JQQ A;  1PZT A;  1V82 A;  3SXC A;  2E8B A;  5J49 A;  2RJ5 A;  3Q7U A;  3TQD A;  3ELC A;  4HCQ A;  1ZI4 A;  2P73 A;  1H7Q A;  2PGY A;  3N9W A;  4D0Z A;  1H5S D;  3RMV A;  5C48 A;  3I0K A;  3JTJ A;  2V0J A;  3OGZ A;  1H7H A;  4B2W A;  4KRV A;  1LL2 A;  2APC A;  2PGV A;  1YP4 A;  2RJ0 A;  3K8D A;  2VS5 A;  5I1F A;  4HO5 A;  3IOI A;  4FRB A;  2O1F A;  1HJJ A;  4ECM A;  2X5Z A;  1FGX A;  2YQC A;  3NGW A;  3V8Y A;  1O7Q A;  4FRL A;  5CMH A;  1IV1 A;  5EJZ A;  4D11 C;  3IKF A;  1XHB A;  1NWG B;  3ZLK A;  1H5T B;  1IIM A;  3SXB A;  1JV3 A;  5BXC A;  1GQ9 A;  1WSZ A;  4P02 A;  2D0J A;  1YRO B;  4FRD A;  1JYK A;  3BRK X;  2XME A;  3U2W A;  5AJN A;  3V0L A;  2OI5 A;  2ZU8 A;  3SXD A;  1LZ0 A;  1R7Y A;  2JCL A;  1R82 A;  4HO9 A;  3F0D A;  1U40 A;  5FU8 A;  4EEO A;  2XWM A;  3RE3 A;  3ZGG A;  1LL0 A;  5D91 A;  1EYR A;  4C81 A;  1H7E A;  2Y4M A;  3U0Y A;  3K14 A;  1WVC A;  1SS9 A;  2FFU A;  2PX7 A;  2VK9 A;  5IDS A;  5FYE A;  1FR8 A;  1MP4 A;  1VH3 A;  3I0F A;  1ZJP A;  1WT3 A;  3F1C A;  5CQL X;  2JCJ A;  3F0F A;  5IFY A;  1H7F A;  1FZW A;  2WGZ A;  2UX8 A;  4Y7G A;  4DE7 A;  3FBA A;  3QVB A;  3JUJ A;  5C47 A;  1VIC A;  3OAM A;  2V0H A;  1TZF A;  1ZIZ A;  3IEQ A;  3SXA A;  4EEA A;  1JVD A;  1ZJ0 A;  5C4F A;  2JCO A;  4KPZ A;  1MP3 A;  4LW3 A;  2YC3 A;  2XMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...