1W57A

Structure of the bifunctional ispdf from campylobacter jejuni containing zn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
EMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 106
structure length 368
sequence length 368
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w57A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w57A01
1VGZA 4KC1A 5C48A 1VZUA 2PGYA 4LW3A 1T0AA 2RJ9A 3OH4A 1XHBA 3JUKA 2E3DA 3EE5A 4KQLA 1U40A 3IEQA 3KIAA 2BO4A 3U2UA 2PX7A 2DPWA 1LZ7A 1ZDFA 5CQNX 3IKFA 1WSZA 4XWIA 2BO8A 1SS9A 2VFZA 4FQWA 4C81A 3SX5A 2FYAA 2X5SA 5FYEA 2OI7A 4FCEA 3U0YA 3SXGA 5C36A 5DDTA 3ZGFA 1FO8A 4DDZA 5C8RA 3K2XA 4JISA 4KNRA 2PA4A 4FRBA 1ON8A 1PZTA 3I0HA 2P73A 1O7QA 2VSHA 1VICA 4G3SA 1FG5N 3I0LA 2XMEA 4FREA 1R7YA 1V84A 2WEEA 1H3MA 1IIMA 2YESA 1E5KA 4Y7FA 1H7TA 1ZJ2A 5AJOA 2O1HA 3PKQA 1FGGA 4M28A 3TQDA 4HO2A 2FFUA 2WE9A 2UZHA 3N9WA 4C82A 2XWNA 2Y6PA 4FRMA 4LW6A 3DUVA 3D5NA 1U3PA 1H7FA 3F0EA 2BO6A 3I0DA 3SXDA 1FXOA 3IKEA 1NKHB 2YC5A 3DJ4A 2QH5A 2XMHA 2V0KA 4HO0A 2FY7A 2GZLA 1JV1A 2YCMA 1VZTA 1WVCA 3PKPA 1VM8A 1WT0A 2PMPA 1IV3A 4KT7A 1WT1A 1VGWA 4CJCA 4E1KA 1H7LA 2WGZA 3OC9A 2FYCB 4FRAA 2OEFA 3V0PA 2WVKA 3RE3A 4IRQA 4CVHA 1EZIA 1WT2A 2I5KA 3F6MA 4HO5A 2VS5A 4CJ8A 1G95A 1FGXA 1WT3A 3Q80A 1QGSA 4FRPA 1I52A 4HO8A 1H7EA 5C1GA 4AC3A 1H5SD 5AJPA 2RJ1A 1ZJOA 3D8VA 5EJZA 3I0KA 4M4KA 4D0ZA 2JCOA 1S4OA 1HJJA 1HM8A 2JCJA 4KPXA 1IV2A 4IRPA 4AYLA 3IOIA 2YQCA 3CGXA 3U2WA 1H5RB 1FR9A 4Y7UA 3SXAA 2W0VA 1R82A 1LZ0A 4Y6NA 2VXMA 2RIXA 4B4BA 5I1FA 1VPAA 4HO6A 1TW1A 3I0GA 1ZCUA 1ZDGA 2X65A 1R7XA 4FRDA 5C38A 4EEOA 3OH1A 1GA8A 2RJ0A 1MP4A 2P72A 5AJNA 2MZBA 1HM0A 4ASYA 5J49A 1S4PA 1GQCA 5C1LA 2QKXA 3PNNA 4KNXA 1R81A 3R2WA 3T7OA 4C8GA 4FCUA 2I7BA 4NAKA 1NF5B 2WVLA 1LZJA 3U2TA 3DK5A 5B8FA 4R7PA 4Y62A 3U2XA 4MNDA 2VSIA 1ZJ0A 1ZJ3A 4D11A 3CKJA 4FRQA 2RJ8A 2APCA 1JYLA 3BCVA 2ICXA 5CMGX 2FFVA 4CJBA 3ELCA 3OH0A 4M2AA 2A8WA 4FRLA 4EEAA 3CKNA 1U43A 2Y4KA 1EYRA 2JCLA 3FBAA 3SX8A 1W77A 4Y7TA 2E8BA 1LL3A 4FRHA 5HS2A 1FO9A 1H5SA 5L6VA 1JVGA 1FXJA 2V0JA 2X5ZA 3V91A 2AM4A 2RIZA 2Z87A 5CQOA 3OH2A 4UEGA 3KE1A 1H7QA 4AYJA 2AH9A 1QWJA 4B2WA 3R3IA 2OI6A 4P02A 3I0JA 1VZXA 2BO7A 3ERNA 3V8ZA 1ZCVA 5CQLX 1HJLA 4BQHA 3TZTA 3FPIA 2AE7A 1GX1A 1YP3A 1G1LA 1ZHJA 3CKVA 1VH8A 3IOHA 3F1YA 2O1GA 4FROA 1H5TA 1VGTA 1IV4A 1R80A 3E25A 3EORA 3V0QA 3OGZA 2FYBA 4YS8A 5C4FA 1LL0A 3CKOA 1MP3A 1JY8A 1G23A 3O3PA 4HO9A 5CMJA 1FRWA 2V0HA 4L41C 1JN1A 4G3PA 3QHDA 5FU8A 1R7TA 2AM3A 3P10A 1U3LA 5L6SA 1HV9A 2VS3A 3JTJA 2P6WA 5C4BA 1VH1A 1IV1A 4C8EA 3OH3A 2RITA 3POLA 3K8EA 3V90A 1G0RA 2XWMA 2FYDB 1JVDA 1H5SB 1NMMB 1FWYA 5JQQA 1OQMB 1G3LA 4EE4A 1ZCYA 1ZJPA 2Y4LA 2ZU8A 4HG6A 2YC3A 3BRKX 2Y4MA 2AECA 4B4MA 2I5EA 2A8UA 3U2VA 3JVHA 1G93A 2YQJA 4Y63A 2AM5A 2Q4JA 3V0LA 1MP5A 2D7RA 3Q7UA 4C2SA 4NANA 1ON6A 4HO3A 5FTSA 3HL3A 2D7IA 2QGIA 3IOJA 1GWVA 1FZWA 1GX4A 4KXOA 3F0FA 3P0ZA 3QVBA 3ESJA 3U0XA 4B42A 5CQPA 1OMXA 1KNJA 3ST8A 1R7VA 2WVMA 3F1CA 4Y64A 4HO4A 2Z86A 1GQ9A 1IINA 5C47A 4J18A 4Y7VA 1S4NA 3LW6A 4Y6UA 3GHZA 2JCKA 1KWSA 4HOCA 3Q8HA 2AMTA 1NQIB 3ZF8A 5FTVA 1YROB 1YP2A 1O23B 2AGDA 3RMVA 4ASJA 5IDTA 1TZFA 1H4EA 1Z90A 4B5BA 3F0GA 4NAIA 3IEWA 3JUJA 2XWLA 4EE3A 4D11C 4JD0A 2ICYA 5C3DA 3V8YA 3FOQA 2RJ7A 2Y4JA 1HM9A 2RJ5A 4EEGA 2CU2A 3I0FA 1GX0A 2V0LA 4Y7GA 5BXCA 3I0EA 1H47A 2O1FA 1ZIZA 3SXBA 5C4DA 1O7OA 1QG8A 3K14A 2W0WA 5IDSA 2VD4A 1H48A 5C4CA 3Q4SA 3RSBA 1ZCTA 1VH3A 2YQSA 4AAWA 4B4GA 3OAMA 1G8OA 3T7NA 4KC2A 5CMFX 5C49A 2X60A 5C4EA 1YP4A 5IFYA 1W55A 4C8IA 1H5RA 1QGQA 4KRVA 4B2XA 1H5SC 1H4CA 1INJA 4Y9XA 5FUHA 1LVWA 3MBMA 2ZU7A 1LL2A 3T7MA 4G87A 4KC4A 3SXCA 3ZLLA 2WAWA 1H4DA 2OI5A 1H7HA 3V0MA 2Y7AA 5DDVA 4HCQA 1ZI4A 3D98A 1V83A 3K8DA 3V0NA 1K4VA 4K6RA 1G97A 3USRA 1O0RA 1NHEB 1MC3A 3USQA 3F0DA 1W57A 2AESA 2UX8A 4DECA 4ARWA 2YQHA 3I0CA 4G3QA 5C3AA 4P00A 1NWGB 3OKRA 1INIA 1PZYB 3NGWA 4EEMA 1R7UA 3GUEA 1OMZA 1GWWA 2RIYA 1LZIA 4GBPA 4EE5A 3I0IX 3E26A 5FV9A 1KNKA 3T80A 3SXEA 2GGOA 1XZ6A 1TW5A 2V0IA 5CQMX 2D0JA 3V0OA 5C3BA 3SX3A 1VGUA 3SX7A 1V82A 3RMWA 5EIYA 3CKQA 4ECMA 2VXLA 2ZU9A 4D0TA 3B6NA 3ZLKA 4BMAA 4EVWA 4NALA 4B3UA 2RJ6A 4KPZA 4ZDQA 1YQNA 2PGVA 3FWWA 4MYBA 1ZI5A 1FR8A 1JV3A 5EJ1A 1FOAA 3ZGGA 4D48A 2OEGA 5C1HA 4DE7A 1G9RA 1TVYA 1G2VA 1ZI1A 5FU0A 3CU0A 1VHAA 1JYKA 1ZJ1A 1H7GA 2RJ4A 4M2BA 1H5TB 5CMHA 3SPTA 5CMIA 2GGQA 2VS4A 1ZI3A 2NXVA
chains in the Genus database with same CATH superfamily
1VGZA 4TV8B 3WXMB 2VK9A 2L26A 4LW3A 4LCKA 2CVLA 3JUKA 2E3DA 3EE5A 3LYBA 1U40A 3KIAA 4I4TB 4ZHQA 4X20A 1X7PA 2DYYA 5CA0B 2BO8A 1SS9A 2VFZA 3CC4F 2K1SA 4C81A 5DDTA 3ZGFA 1FO8A 4KNRA 3HTNA 1E7KA 5EZYB 5CB4B 2P73A 1O7QA 3VCZA 3I0LA 4FREA 3RA6A 3P4EA 5C8YB 2WEEA 1VQLF 1H7TA 4C82A 2XWNA 2HRUA 1TUBA 3I0DA 3SXDA 4HO0A 3CPWF 2FY7A 4YJ3B 2YCMA 1WT0A 2PMPA 1RLUA 2CW4A 2IQQA 1QVFF 1VQVA 5HY4A 3ZOPA 1FNKA 2WALA 1WT1A 4CJCA 4E1KA 4WBNB 2FYCB 3V0PA 2WVKA 3RE3A 4IRQA 2I5KA 5LXTB 4CJ8A 3SIUA 1WT3A 1VQ5F 5C1GA 3K12A 1FFXB 5AJPA 1ZJOA 4O2AB 5LA6B 3WPWA 4O6NA 5AVMA 5BMVA 3CCSF 1HM8A 2CWJA 3JALA 1IV2A 2OHWA 3CGXA 3ZO8A 3SXAA 1FR9A 2W0VA 2HS4A 1W5BA 2BTUA 2RIXA 4HO6A 1TW1A 1Z5VA 5EIBD 1JJ2F 4FRDA 5C38A 4EEOA 3CMAF 1IPAA 2P72A 1HM0A 5C1LA 3JASA 3T7OA 1NF5B 3DK5A 4R7PA 4Y62A 3U2XA 1ZJ3A 2APCA 5LOVB 2A8WA 3NK7A 5MN5A 3E20B 2Y4KA 1NJIH 2JCLA 5KX5B 3FBAA 1W77A 4IIJB 1FO9A 3E22B 4O4IB 2V0JA 2Z87A 3OH2A 1X25A 4UEGA 2AH9A 3CC2F 4B62A 3N2GB 3V3TA 4P02A 3UT5A 2BO7A 3ERNA 5CQLX 3TZTA 1JFFA 2HVYD 4G4WA 1ZHJA 3CKVA 1VH8A 1QU9A 4DXDA 2LCAA 3E25A 3EORA 3CCLF 4TV8A 5FNVA 3J80M 1G23A 5IYZA 5EAZA 5FU8A 1R7TA 2BO1A 3VI6A 1K8AH 2BTOA 3JTJA 3JCMM 5C4BA 5CA0A 3I3FA 2RITA 3POLA 3WJPA 1VQ8F 1JVDA 5EZYA 1H5SB 1FWYA 3WPXA 5CA1A 5CB4A 2HRYA 2Y4MA 2AECA 4B4MA 2I5EA 2YQJA 4Y63A 2D7RA 5C8YA 4NANA 4HO3A 5KMGB 1JD1A 5HXZA 4HNAB 1SZQA 3DC2A 1GWVA 1GX4A 3F0FA 1KNJA 1R7VA 5C47A 4YJ3A 3VIUA 1XV2A 2HS3A 5FTVA 3CYPB 4WBNA 1RA4A 1W59A 1Z90A 5LXTA 4D11C 3I7TA 3VO8A 2RJ5A 4EEGA 1PF5A 3I0FA 4Y7GA 2JNBA 3JARB 2O1FA 1ZIZA 3SXBA 1OFUA 4O2AA 5LA6A 4BT6A 2VD4A 5C4CA 1ZCTA 2ZVYA 3T7NA 5HY0A 3OAMA 4KC2A 1VQKF 5CMFX 5J2UB 5IFYA 2CSLA 4C8IA 1H5SC 1H4CA 1GZ0A 1INJA 3VYTC 1VQ9F 1LL2A 3SXCA 2OI5A 2I6DA 3SIVA 4ZI7B 4HCQA 1V83A 4K6RA 1W2BF 3USQA 3F0DA 1W57A 2IG8A 2W8BC 4DECA 2YQHA 4EI8A 3AGKA 1NWGB 4EB6A 4EEMA 1R7UA 2RIYA 4EE5A 3E26A 3CG6A 4X1YB 3T80A 2GGOA 1XZ6A 5LOVA 3V0OA 3SX3A 1V82A 4X1IB 3V7EA 3LFOA 2ZAUA 2VXLA 4D0TA 1X52A 5KX5A 4NALA 2RJ6A 5EYPA 5IJ0B 3FWWA 2PGVA 4MYBA 5GINC 5EJ1A 3ZGGA 4O4IA 1CK2A 2V9YA 5C1HA 4X1KA 1TVYA 1VHAA 3K0TA 1H5TB 2GGQA 3RYIA 3RYFB 1ZI3A 5C48A 1W5AA 1XHBA 1COMA 1W581 2PX7A 1RLGA 1LZ7A 1UI9A 5CQNX 4BT3A 3CCEF 2GVIA 4O4JB 1Q81H 5FYEA 3RYHB 3U0YA 3SXGA 4DDZA 2HP3A 3N2KB 2PA4A 4FRBA 4O4LB 2ZODA 1NQ3A 3JATB 2VSHA 4B45A 1VICA 1V84A 1H3MA 4ERHA 1E5KA 4Y7FA 5AJOA 4EI7A 2FFUA 2UZHA 2Y6PA 4FRMA 4LW6A 1U3PA 3F0EA 2H6LA 4NQ3A 2Z01A 3IKEA 1VZTA 1KC8H 1IV3A 3MDOA 1VGWA 3OC9A 3M1XA 4FFBA 1WT2A 3F6MA 1VQPF 4HO5A 4FRPA 1I52A 3WGNA 4ZHYB 5FLXM 2JCJA 3S0YA 2YQCA 5IJ9B 2R751 1SA0A 4Y7UA 1LZ0A 2BTQB 1VK3A 3PLAC 3O85A 2X65A 1R7XA 5J2UA 4F6RB 1GA8A 5AJNA 5LYJA 2MZBA 3OBYA 4ASYA 1S4PA 3PNNA 4C8GA 4FCUA 2I7BA 4NAKA 3RYCB 5GAPK 2WVLA 1LZJA 3U2TA 4ZI7A 1ZJ0A 4BVRA 1JYLA 5CMGX 4CJBA 3OH0A 4M2AA 2H8CA 2VGMA 3VOBA 5HY2A 4X1YA 4TUYB 4X1IA 4FRHA 3CB2A 5HS2A 5J2TB 3ZP4A 2CHTA 5L6VA 2R6R1 1FXJA 2AM4A 3HKDB 4AYJA 1QWJA 5IJ0A 2OI6A 5ITZA 5JCOC 3V8ZA 1VZXA 1M1KH 4BQHA 4U3JB 2AE7A 1TVKB 3J7AR 4FROA 1H5TA 3G6EF 1XHOA 2YYEA 3V0QA 4G4XA 2FYBA 5C4FA 1LL0A 3CKOA 1MP3A 3O3PA 3WGMA 3M4SA 2V0HA 1JN1A 1W42A 5D92A 2AM3A 1DBFA 2P6WA 4LNUA 4I50A 3VOAA 4O4JA 4C8EA 4B5CA 4BT2A 3K8EA 3RYHA 2OZBA 3MQWA 1Q82H 3N2KA 1OQMB 4EE4A 2RHHA 1ZJPA 3JATA 4HG6A 2YC3A 2RB9A 3U2VA 3M84A 1G93A 4G4ZA 4E6EA 3V0LA 2AM5A 2FC3A 3HKCA 2P6YA 2QGIA 3IOJA 1FZWA 3KIZA 3P0ZA 3ESJA 3U0XA 1OMXA 5JVDA 2WVMA 1GQ9A 5HP7A 1IINA 4J18A 4NWOB 2JCKA 2GLZA 1NQIB 3ZF8A 1YROB 2UYNB 1YP2A 2AGDA 3I56F 1H4EA 4NAIA 3JUJA 3WGJA 2Y4JA 1HM9A 4M8IA 3DDNA 1ODEA 3HWUA 2V0LA 5JQGA 4RQOA 3K14A 1GO0A 1DT9A 3HKEB 2KTVA 2LBXA 1G8OA 5C49A 2H8EA 3L7QA 2ZU7A 2KGWA 4G87A 3ZLLA 1XBIA 3JAKB 1H4DA 2Y7AA 2Q1XA 5DDVA 4YJ2A 1ZI4A 3K8DA 3V0NA 3USRA 1NHEB 3C8LA 2AESA 2UX8A 4ARWA 2C0NA 4I4TA 2Q1YA 3NGWA 5EIBC 3GUEA 1OMZA 1KD1H 4IHJB 4O4HB 3N4YA 3S0WA 5C3BA 3SX7A 3RMWA 5EIYA 5MN6A 4BMAA 3RA5A 1YQNA 1JV3A 2RHOA 4D48A 4DE7A 3HKDA 5FU0A 2YXZA 1JYKA 3WJRA 2DT4A 3SPTA 1K9MH 5CMIA 3MCQA 1VZUA 3OH4A 5GANK 3IR9A 4KQLA 3JAWB 3U2UA 1VQNF 4BY9D 2DPWA 2ZF8A 2HQSC 1W3EX 4XWIA 4FQWA 3SX5A 1PXWA 2X5SA 2OI7A 4FCEA 1FFXA 1VQ6F 1H7MA 3CMEF 5C8RA 4JISA 5HY1A 1ON8A 1PZTA 4G3SA 1FG5N 2UYPA 1R7YA 1IIMA 4I55B 2O1HA 1FGGA 3TQDA 4HO2A 2HP0B 3N9WA 3HKBB 3DUVA 3D5NA 1H7FA 1FXOA 2YC5A 1QD9A 3VTIC 2XMHA 2V0KA 1WVCA 3PKPA 2OTJF 1RQ2A 4KT7A 4FIXA 1W40A 1H7LA 4Q7CA 4FRAA 4ZHQB 1VQ7F 4X20B 4CVHA 2ZVZA 2VS5A 1G95A 3Q80A 2UYNA 1QGSA 4HO8A 3I55F 2RJ1A 4X3MA 5EJZA 3D8VA 3IMPA 3G4SF 2JCOA 1HJJA 3QTYA 2VXYA 1CLIA 4KPXA 4IIJA 3U2WA 3E22A 3C9UA 1H5RB 1R82A 2VXMA 2VAPA 1YITF 2AIZP 3HKEA 4X3LA 3N2GA 3LWOC 1MP4A 2RJ0A 5J49A 1GQCA 4FIYA 2QKXA 5HWEA 1J7HA 3JAKA 5B8FA 4MNDA 2VSIA 3NK6A 3OW2F 4D11A 3CKJA 4FRQA 2RJ8A 2ICXA 4EEAA 3E1YA 1EYRA 4O4HA 5BMVB 3SX8A 3JALB 5MN4A 3JAMM 2E8BA 5A2QM 1H5SA 4ZHWA 3CCJF 1JVGA 3V91A 5HP8A 2RIZA 3KE1A 1VQMF 1QVGF 4B2WA 3N4ZA 4B46A 5KMGA 4HNAA 3S06A 5GONB 3ON1A 3C9RA 2KTUA 1ZCVA 4BVQA 3FPIA 1GX1A 1G1LA 1M90H 3IOHA 3F1YA 4BW0B 1IV4A 1R80A 3OGZA 1YJNF 3VYSC 3CC7F 4RHAA 1S72F 3CCUF 3JAWA 1FRWA 4L41C 3QHDA 1HV9A 4DRXB 2VS3A 2QI2A 1IV1A 4BT7A 3CD6F 3JARA 3V90A 1G0RA 2FYDB 3NVIB 5JQQA 4O2BB 3CCMF 1G3LA 2Y4LA 2ZU8A 3BRKX 2A8UA 3JVHA 1QAHA 2Q4JA 1MP5A 3Q7UA 2J0BA 2VGNA 4ZOLB 4I55A 5FTSA 4C4WC 3G71F 3UT5B 3HKBA 3HL3A 2D7IA 1JFFB 4B42A 3ST8A 3F1CA 4Y64A 2Z86A 4Y7VA 1S4NA 3CYQA 3LW6A 3GHZA 4HOCA 5FNVB 2AMTA 1FNJA 1W5FA 1O23B 5IYZB 3RMVA 4ZK7A 2NMUA 4ASJA 2N48A 1TZFA 2J0AA 2OTMA 4B5BA 3IEWA 4EE3A 5JH7B 4JD0A 5C3DA 3FOQA 2RJ7A 2CU2A 3CXCF 1GX0A 1H47A 5C4DA 2QA4F 1QG8A 5CA1B 3CCQF 2W0WA 5IDSA 3V7QA 1H48A 2YQSA 4AAWA 4ZHVA 4TZZA 5C4EA 2X60A 2MQEA 1H5RA 4B2XA 1QGQA 4BVSA 3MBMA 5G4VC 3T7MA 1YHQF 2WAWA 1H7HA 3V0MA 1N8RH 4TV9B 3RYFA 1K4VA 2F9ZC 3D54A 1PZYB 1GWWA 1LZIA 4GBPA 4XCQA 5FV9A 1TW5A 2V0IA 3TD4A 2D0JA 1UFYA 1GO1A 3D01A 3GYQA 3S02A 4O4LA 4O6MA 4EVWA 3LMEA 4B3UA 2UYKA 4ZDQA 5D91A 1G2VA 1ZI1A 3VMFB 3WGKA 5CMHA 4MIXA 2NXVA 3GTZA 4KC1A 2IAFA 5GONA 2PGYA 1T0AA 2RJ9A 5LP6B 3FD6A 3IEQA 2BO4A 3FFMA 1FSZA 4EB6B 3TD3A 1ZDFA 1Q86H 3IKFA 2EWCA 1WSZA 4PWTA 2FYAA 5C36A 2AIFA 5HXUA 3K2XA 2FGYA 4DRXA 4NUTA 3I0HA 2XMEA 5EYPB 3LWVC 2YESA 4R40B 5IJ9A 1ZJ2A 5JCOA 3C9SA 3PKQA 4M28A 2WE9A 1YIJF 1OAPA 4O2BA 3S0HA 4U39A 4X1KB 3R0PA 1YJ9F 2BO6A 2UYJA 1NKHB 3DJ4A 2QH5A 2GZLA 1JV1A 4F6RA 4G4VA 4ZOLA 1VM8A 3RYIB 3RYCA 2WGZA 3D00A 2OEFA 2Z1UA 1EZIA 3KJJA 1FGXA 3U0OA 5LP6C 3HAXD 1H7EA 4AC3A 1H5SD 1K73H 2LBTA 3I0KA 4M4KA 4D0ZA 1S4OA 5JH7A 1VQOF 2KG4A 4IRPA 4AYLA 4TUYA 3IOIA 3OBWA 5J2TA 1CN7A 5G4UC 4Y6NA 4BVTA 4B4BA 5I1FA 1VPAA 2RHLA 3I0GA 1ZCUA 5EB0A 1ZDGA 5DCVA 3OH1A 1KQSF 4U3JA 1T0KB 4KNXA 1R81A 3R2WA 2QEXF 1TVKA 1X7OA 4TV9A 1RQ7A 3VYUC 4FFBB 2CZWA 4G4YA 3BCVA 2FFVA 3ELCA 3V4DA 4FRLA 1NMUB 2VAWA 1ONIA 3CKNA 1U43A 3CCRF 3FD5A 4Y7TA 1LL3A 3J81M 1SA0B 1W5EA 3LDTA 1VQ4F 2X5ZA 5CQOA 3LWRC 1H7QA 3R3IA 5LYJB 3S03A 3I0JA 1HJLA 2QTPA 1YGYA 1YP3A 2O1GA 1VGTA 3TD5A 3LWPC 2RHJA 4YS8A 1JY8A 1YI2F 4HO9A 5CMJA 5LP6A 4G3PA 3P10A 1U3LA 5L6SA 2OTLF 2ALEA 1VH1A 3OH3A 5EWRA 4BT4A 1SDSA 3ZP7A 2XWMA 3WGLA 1NMMB 1ZCYA 1YJWF 4G88A 1TUBB 1XRGA 3NVKE 1R1MA 4C2SA 1ON6A 5IT9M 1ZWZA 5ITZB 3HJWC 2PHNA 4KXOA 3QVBA 3QUWA 5CQPA 3OONA 5GIOC 2G9IA 4HO4A 3CCVF 5FJ4C 3WJQA 4Y6UA 1KWSA 3Q8HA 2Z1EA 3KJKA 3BYQA 5IDTA 3CPQA 4IHJA 3F0GA 4LNUB 4EI9A 2XWLA 4I50B 2LBWA 1W41A 2ICYA 3V8YA 5BXCA 3I0EA 2I6RA 2B33A 1O7OA 5EB1B 3NMUC 5GIPC 3Q4SA 3RSBA 1VH3A 3PAFA 4B4GA 1Z5WA 2VAMA 1YP4A 3HKCB 1W55A 2Z1TA 4KRVA 3JASB 4Y9XA 5FUHA 1LVWA 2HS0A 4KC4A 5EO3A 5JVDB 3D98A 1G97A 1O0RA 1MC3A 3I0CA 4G3QA 5C3AA 4P00A 3OKRA 1INIA 1Q7YH 4BT5A 3C9TA 3LWQC 3I0IX 3MCAB 1KNKA 3SXEA 5CQMX 2ZOVA 1VGUA 3CKQA 4ECMA 5JQGB 2ZU9A 3B6NA 3ZLKA 1Q8RA 2Z1FA 4KPZA 3KHNA 1ZI5A 1FR8A 2HP0A 2HX0A 1FOAA 4KWEA 2CHSA 2OEGA 1G9RA 3CU0A 1ZJ1A 1H7GA 2RJ4A 4M2BA 4YJ2B 2VS4A
chains in the Genus database with same CATH topology
1VGZA 4KC1A 5C48A 2VK9A 1VZUA 2PGYA 4LW3A 1T0AA 2RJ9A 3OH4A 1XHBA 3JUKA 2E3DA 3EE5A 4KQLA 1U40A 3IEQA 3KIAA 2BO4A 3U2UA 2PX7A 2DPWA 1LZ7A 1ZDFA 5CQNX 3IKFA 1WSZA 4XWIA 2BO8A 1SS9A 2VFZA 4FQWA 4C81A 3SX5A 2FYAA 2X5SA 5FYEA 2OI7A 4FCEA 3U0YA 3SXGA 5C36A 5DDTA 3ZGFA 1FO8A 4DDZA 5C8RA 3K2XA 4JISA 4KNRA 2PA4A 4FRBA 1ON8A 1PZTA 3I0HA 2P73A 1O7QA 2VSHA 1VICA 4G3SA 1FG5N 3I0LA 2XMEA 4FREA 1R7YA 1V84A 2WEEA 1H3MA 1IIMA 2YESA 1E5KA 4Y7FA 1H7TA 1ZJ2A 5AJOA 2O1HA 3PKQA 1FGGA 4M28A 3TQDA 4HO2A 2FFUA 2WE9A 2UZHA 3N9WA 4C82A 2XWNA 2Y6PA 4FRMA 4LW6A 3DUVA 3D5NA 1U3PA 1H7FA 3F0EA 2BO6A 3I0DA 3SXDA 1FXOA 3IKEA 1NKHB 2YC5A 3DJ4A 2QH5A 2XMHA 2V0KA 4HO0A 2FY7A 2GZLA 1JV1A 2YCMA 1VZTA 1WVCA 3PKPA 1VM8A 1WT0A 2PMPA 1IV3A 4KT7A 4FIXA 1WT1A 1VGWA 4CJCA 4E1KA 1H7LA 2WGZA 3OC9A 2FYCB 4FRAA 4Q7CA 2OEFA 3V0PA 2WVKA 3RE3A 4IRQA 4CVHA 1EZIA 1WT2A 2I5KA 3F6MA 4HO5A 2VS5A 4CJ8A 1G95A 1FGXA 1WT3A 3Q80A 1QGSA 4FRPA 1I52A 4HO8A 1H7EA 5C1GA 4AC3A 1H5SD 5AJPA 2RJ1A 1ZJOA 3D8VA 5EJZA 3I0KA 4M4KA 4D0ZA 2JCOA 1S4OA 1HJJA 4O6NA 1HM8A 2JCJA 4KPXA 1IV2A 4IRPA 4AYLA 3IOIA 2YQCA 3CGXA 3U2WA 1H5RB 1FR9A 4Y7UA 3SXAA 2W0VA 1R82A 1LZ0A 4Y6NA 2VXMA 2RIXA 4B4BA 5I1FA 1VPAA 4HO6A 1TW1A 3I0GA 1ZCUA 1ZDGA 2X65A 1R7XA 4FRDA 5C38A 4EEOA 3OH1A 1GA8A 2RJ0A 1MP4A 2P72A 5AJNA 2MZBA 1HM0A 4ASYA 5J49A 1S4PA 1GQCA 4FIYA 5C1LA 2QKXA 3PNNA 4KNXA 1R81A 3R2WA 3T7OA 4C8GA 4FCUA 2I7BA 4NAKA 1NF5B 2WVLA 1LZJA 3U2TA 3DK5A 5B8FA 4R7PA 4Y62A 3U2XA 4MNDA 2VSIA 1ZJ0A 1ZJ3A 4D11A 3CKJA 4FRQA 2RJ8A 2APCA 1JYLA 3BCVA 2ICXA 5CMGX 2FFVA 4CJBA 3ELCA 3OH0A 4M2AA 2A8WA 4FRLA 4EEAA 3CKNA 1U43A 2Y4KA 1EYRA 2JCLA 3FBAA 3SX8A 1W77A 4Y7TA 2E8BA 1LL3A 4FRHA 5HS2A 1FO9A 1H5SA 5L6VA 1JVGA 1FXJA 2V0JA 2X5ZA 3V91A 2AM4A 2RIZA 2Z87A 5CQOA 3OH2A 4UEGA 3KE1A 1H7QA 4AYJA 2AH9A 1QWJA 4B2WA 3R3IA 2OI6A 4P02A 3I0JA 1VZXA 2BO7A 3ERNA 3V8ZA 1ZCVA 5CQLX 1HJLA 4BQHA 3TZTA 3FPIA 2AE7A 1GX1A 1YP3A 1G1LA 1ZHJA 3CKVA 1VH8A 3IOHA 3F1YA 2O1GA 4FROA 1H5TA 1VGTA 1IV4A 1R80A 3E25A 3EORA 3V0QA 3OGZA 2FYBA 4YS8A 5C4FA 1LL0A 3CKOA 1MP3A 1JY8A 1G23A 3O3PA 4HO9A 5CMJA 1FRWA 2V0HA 4L41C 1JN1A 4G3PA 3QHDA 5D92A 5FU8A 1R7TA 2AM3A 3P10A 1U3LA 5L6SA 1HV9A 2VS3A 3JTJA 2P6WA 5C4BA 1VH1A 1IV1A 4C8EA 3OH3A 2RITA 3POLA 3K8EA 3V90A 1G0RA 2XWMA 2FYDB 1JVDA 1H5SB 1NMMB 1FWYA 5JQQA 1OQMB 1G3LA 4EE4A 1ZCYA 1ZJPA 2Y4LA 2ZU8A 4HG6A 2YC3A 3BRKX 2Y4MA 2AECA 4B4MA 2I5EA 2A8UA 3U2VA 3JVHA 1G93A 2YQJA 4Y63A 2AM5A 2Q4JA 3V0LA 1MP5A 2D7RA 3Q7UA 4C2SA 2J0BA 4NANA 1ON6A 4HO3A 5FTSA 3HL3A 2D7IA 2QGIA 3IOJA 1GWVA 1FZWA 1GX4A 4KXOA 3F0FA 3P0ZA 3QVBA 3ESJA 3U0XA 4B42A 5CQPA 1OMXA 1KNJA 3ST8A 1R7VA 2WVMA 3F1CA 4Y64A 4HO4A 2Z86A 1GQ9A 1IINA 5C47A 4J18A 4Y7VA 1S4NA 3LW6A 4Y6UA 3GHZA 2JCKA 1KWSA 4HOCA 3Q8HA 2AMTA 1NQIB 3ZF8A 5FTVA 1YROB 1YP2A 1O23B 2AGDA 3RMVA 4ASJA 5IDTA 1TZFA 1H4EA 1Z90A 2J0AA 4B5BA 3F0GA 4NAIA 3IEWA 3JUJA 2XWLA 4EE3A 4D11C 4JD0A 2ICYA 5C3DA 3V8YA 3FOQA 2RJ7A 2Y4JA 1HM9A 2RJ5A 4EEGA 2CU2A 3I0FA 1GX0A 2V0LA 4Y7GA 5BXCA 3I0EA 1H47A 2O1FA 1ZIZA 3SXBA 5C4DA 1O7OA 1QG8A 3K14A 2W0WA 5IDSA 2VD4A 1H48A 5C4CA 3Q4SA 3RSBA 1ZCTA 1VH3A 2YQSA 4AAWA 4B4GA 3OAMA 1G8OA 3T7NA 4KC2A 5CMFX 5C49A 2X60A 5C4EA 1YP4A 5IFYA 1W55A 4C8IA 1H5RA 1QGQA 4KRVA 4B2XA 1H5SC 1H4CA 1INJA 4Y9XA 5FUHA 1LVWA 3MBMA 2ZU7A 1LL2A 3T7MA 4G87A 4KC4A 3SXCA 3ZLLA 2WAWA 1H4DA 2OI5A 1H7HA 3V0MA 2Y7AA 5DDVA 4HCQA 1ZI4A 3D98A 1V83A 3K8DA 3V0NA 1K4VA 4K6RA 1G97A 3USRA 1O0RA 1NHEB 1MC3A 3USQA 3F0DA 1W57A 2AESA 2UX8A 4DECA 4ARWA 2C0NA 2YQHA 3I0CA 4G3QA 5C3AA 4P00A 1NWGB 3OKRA 1INIA 1PZYB 3NGWA 4EEMA 1R7UA 3GUEA 1OMZA 1GWWA 2RIYA 1LZIA 4GBPA 4EE5A 3I0IX 3E26A 5FV9A 1KNKA 3T80A 3SXEA 2GGOA 1XZ6A 1TW5A 2V0IA 5CQMX 2D0JA 3V0OA 5C3BA 3SX3A 1VGUA 3SX7A 1V82A 3RMWA 5EIYA 3CKQA 4ECMA 2VXLA 2ZU9A 4D0TA 3B6NA 4O6MA 3ZLKA 4BMAA 4EVWA 4NALA 4B3UA 2RJ6A 4KPZA 4ZDQA 1YQNA 2PGVA 3FWWA 4MYBA 1ZI5A 1FR8A 1JV3A 5EJ1A 1FOAA 3ZGGA 4D48A 2OEGA 5D91A 5C1HA 4DE7A 1G9RA 1TVYA 1G2VA 1ZI1A 5FU0A 3CU0A 1VHAA 1JYKA 1ZJ1A 1H7GA 2RJ4A 4M2BA 1H5TB 5CMHA 3SPTA 4MIXA 5CMIA 2GGQA 2VS4A 1ZI3A 2NXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VGZ A;  4KC1 A;  5C48 A;  1VZU A;  2PGY A;  4LW3 A;  1T0A A;  2RJ9 A;  3OH4 A;  1XHB A;  3JUK A;  2E3D A;  3EE5 A;  4KQL A;  1U40 A;  3IEQ A;  3KIA A;  2BO4 A;  3U2U A;  2PX7 A;  2DPW A;  1LZ7 A;  1ZDF A;  5CQN X;  3IKF A;  1WSZ A;  4XWI A;  2BO8 A;  1SS9 A;  2VFZ A;  4FQW A;  4C81 A;  3SX5 A;  2FYA A;  2X5S A;  5FYE A;  2OI7 A;  4FCE A;  3U0Y A;  3SXG A;  5C36 A;  5DDT A;  3ZGF A;  1FO8 A;  4DDZ A;  5C8R A;  3K2X A;  4JIS A;  4KNR A;  2PA4 A;  4FRB A;  1ON8 A;  1PZT A;  3I0H A;  2P73 A;  1O7Q A;  2VSH A;  1VIC A;  4G3S A;  1FG5 N;  3I0L A;  2XME A;  4FRE A;  1R7Y A;  1V84 A;  2WEE A;  1H3M A;  1IIM A;  2YES A;  1E5K A;  4Y7F A;  1H7T A;  1ZJ2 A;  5AJO A;  2O1H A;  3PKQ A;  1FGG A;  4M28 A;  3TQD A;  4HO2 A;  2FFU A;  2WE9 A;  2UZH A;  3N9W A;  4C82 A;  2XWN A;  2Y6P A;  4FRM A;  4LW6 A;  3DUV A;  3D5N A;  1U3P A;  1H7F A;  3F0E A;  2BO6 A;  3I0D A;  3SXD A;  1FXO A;  3IKE A;  1NKH B;  2YC5 A;  3DJ4 A;  2QH5 A;  2XMH A;  2V0K A;  4HO0 A;  2FY7 A;  2GZL A;  1JV1 A;  2YCM A;  1VZT A;  1WVC A;  3PKP A;  1VM8 A;  1WT0 A;  2PMP A;  1IV3 A;  4KT7 A;  1WT1 A;  1VGW A;  4CJC A;  4E1K A;  1H7L A;  2WGZ A;  3OC9 A;  2FYC B;  4FRA A;  2OEF A;  3V0P A;  2WVK A;  3RE3 A;  4IRQ A;  4CVH A;  1EZI A;  1WT2 A;  2I5K A;  3F6M A;  4HO5 A;  2VS5 A;  4CJ8 A;  1G95 A;  1FGX A;  1WT3 A;  3Q80 A;  1QGS A;  4FRP A;  1I52 A;  4HO8 A;  1H7E A;  5C1G A;  4AC3 A;  1H5S D;  5AJP A;  2RJ1 A;  1ZJO A;  3D8V A;  5EJZ A;  3I0K A;  4M4K A;  4D0Z A;  2JCO A;  1S4O A;  1HJJ A;  1HM8 A;  2JCJ A;  4KPX A;  1IV2 A;  4IRP A;  4AYL A;  3IOI A;  2YQC A;  3CGX A;  3U2W A;  1H5R B;  1FR9 A;  4Y7U A;  3SXA A;  2W0V A;  1R82 A;  1LZ0 A;  4Y6N A;  2VXM A;  2RIX A;  4B4B A;  5I1F A;  1VPA A;  4HO6 A;  1TW1 A;  3I0G A;  1ZCU A;  1ZDG A;  2X65 A;  1R7X A;  4FRD A;  5C38 A;  4EEO A;  3OH1 A;  1GA8 A;  2RJ0 A;  1MP4 A;  2P72 A;  5AJN A;  2MZB A;  1HM0 A;  4ASY A;  5J49 A;  1S4P A;  1GQC A;  5C1L A;  2QKX A;  3PNN A;  4KNX A;  1R81 A;  3R2W A;  3T7O A;  4C8G A;  4FCU A;  2I7B A;  4NAK A;  1NF5 B;  2WVL A;  1LZJ A;  3U2T A;  3DK5 A;  5B8F A;  4R7P A;  4Y62 A;  3U2X A;  4MND A;  2VSI A;  1ZJ0 A;  1ZJ3 A;  4D11 A;  3CKJ A;  4FRQ A;  2RJ8 A;  2APC A;  1JYL A;  3BCV A;  2ICX A;  5CMG X;  2FFV A;  4CJB A;  3ELC A;  3OH0 A;  4M2A A;  2A8W A;  4FRL A;  4EEA A;  3CKN A;  1U43 A;  2Y4K A;  1EYR A;  2JCL A;  3FBA A;  3SX8 A;  1W77 A;  4Y7T A;  2E8B A;  1LL3 A;  4FRH A;  5HS2 A;  1FO9 A;  1H5S A;  5L6V A;  1JVG A;  1FXJ A;  2V0J A;  2X5Z A;  3V91 A;  2AM4 A;  2RIZ A;  2Z87 A;  5CQO A;  3OH2 A;  4UEG A;  3KE1 A;  1H7Q A;  4AYJ A;  2AH9 A;  1QWJ A;  4B2W A;  3R3I A;  2OI6 A;  4P02 A;  3I0J A;  1VZX A;  2BO7 A;  3ERN A;  3V8Z A;  1ZCV A;  5CQL X;  1HJL A;  4BQH A;  3TZT A;  3FPI A;  2AE7 A;  1GX1 A;  1YP3 A;  1G1L A;  1ZHJ A;  3CKV A;  1VH8 A;  3IOH A;  3F1Y A;  2O1G A;  4FRO A;  1H5T A;  1VGT A;  1IV4 A;  1R80 A;  3E25 A;  3EOR A;  3V0Q A;  3OGZ A;  2FYB A;  4YS8 A;  5C4F A;  1LL0 A;  3CKO A;  1MP3 A;  1JY8 A;  1G23 A;  3O3P A;  4HO9 A;  5CMJ A;  1FRW A;  2V0H A;  4L41 C;  1JN1 A;  4G3P A;  3QHD A;  5FU8 A;  1R7T A;  2AM3 A;  3P10 A;  1U3L A;  5L6S A;  1HV9 A;  2VS3 A;  3JTJ A;  2P6W A;  5C4B A;  1VH1 A;  1IV1 A;  4C8E A;  3OH3 A;  2RIT A;  3POL A;  3K8E A;  3V90 A;  1G0R A;  2XWM A;  2FYD B;  1JVD A;  1H5S B;  1NMM B;  1FWY A;  5JQQ A;  1OQM B;  1G3L A;  4EE4 A;  1ZCY A;  1ZJP A;  2Y4L A;  2ZU8 A;  4HG6 A;  2YC3 A;  3BRK X;  2Y4M A;  2AEC A;  4B4M A;  2I5E A;  2A8U A;  3U2V A;  3JVH A;  1G93 A;  2YQJ A;  4Y63 A;  2AM5 A;  2Q4J A;  3V0L A;  1MP5 A;  2D7R A;  3Q7U A;  4C2S A;  4NAN A;  1ON6 A;  4HO3 A;  5FTS A;  3HL3 A;  2D7I A;  2QGI A;  3IOJ A;  1GWV A;  1FZW A;  1GX4 A;  4KXO A;  3F0F A;  3P0Z A;  3QVB A;  3ESJ A;  3U0X A;  4B42 A;  5CQP A;  1OMX A;  1KNJ A;  3ST8 A;  1R7V A;  2WVM A;  3F1C A;  4Y64 A;  4HO4 A;  2Z86 A;  1GQ9 A;  1IIN A;  5C47 A;  4J18 A;  4Y7V A;  1S4N A;  3LW6 A;  4Y6U A;  3GHZ A;  2JCK A;  1KWS A;  4HOC A;  3Q8H A;  2AMT A;  1NQI B;  3ZF8 A;  5FTV A;  1YRO B;  1YP2 A;  1O23 B;  2AGD A;  3RMV A;  4ASJ A;  5IDT A;  1TZF A;  1H4E A;  1Z90 A;  4B5B A;  3F0G A;  4NAI A;  3IEW A;  3JUJ A;  2XWL A;  4EE3 A;  4D11 C;  4JD0 A;  2ICY A;  5C3D A;  3V8Y A;  3FOQ A;  2RJ7 A;  2Y4J A;  1HM9 A;  2RJ5 A;  4EEG A;  2CU2 A;  3I0F A;  1GX0 A;  2V0L A;  4Y7G A;  5BXC A;  3I0E A;  1H47 A;  2O1F A;  1ZIZ A;  3SXB A;  5C4D A;  1O7O A;  1QG8 A;  3K14 A;  2W0W A;  5IDS A;  2VD4 A;  1H48 A;  5C4C A;  3Q4S A;  3RSB A;  1ZCT A;  1VH3 A;  2YQS A;  4AAW A;  4B4G A;  3OAM A;  1G8O A;  3T7N A;  4KC2 A;  5CMF X;  5C49 A;  2X60 A;  5C4E A;  1YP4 A;  5IFY A;  1W55 A;  4C8I A;  1H5R A;  1QGQ A;  4KRV A;  4B2X A;  1H5S C;  1H4C A;  1INJ A;  4Y9X A;  5FUH A;  1LVW A;  3MBM A;  2ZU7 A;  1LL2 A;  3T7M A;  4G87 A;  4KC4 A;  3SXC A;  3ZLL A;  2WAW A;  1H4D A;  2OI5 A;  1H7H A;  3V0M A;  2Y7A A;  5DDV A;  4HCQ A;  1ZI4 A;  3D98 A;  1V83 A;  3K8D A;  3V0N A;  1K4V A;  4K6R A;  1G97 A;  3USR A;  1O0R A;  1NHE B;  1MC3 A;  3USQ A;  3F0D A;  1W57 A;  2AES A;  2UX8 A;  4DEC A;  4ARW A;  2YQH A;  3I0C A;  4G3Q A;  5C3A A;  4P00 A;  1NWG B;  3OKR A;  1INI A;  1PZY B;  3NGW A;  4EEM A;  1R7U A;  3GUE A;  1OMZ A;  1GWW A;  2RIY A;  1LZI A;  4GBP A;  4EE5 A;  3I0I X;  3E26 A;  5FV9 A;  1KNK A;  3T80 A;  3SXE A;  2GGO A;  1XZ6 A;  1TW5 A;  2V0I A;  5CQM X;  2D0J A;  3V0O A;  5C3B A;  3SX3 A;  1VGU A;  3SX7 A;  1V82 A;  3RMW A;  5EIY A;  3CKQ A;  4ECM A;  2VXL A;  2ZU9 A;  4D0T A;  3B6N A;  3ZLK A;  4BMA A;  4EVW A;  4NAL A;  4B3U A;  2RJ6 A;  4KPZ A;  4ZDQ A;  1YQN A;  2PGV A;  3FWW A;  4MYB A;  1ZI5 A;  1FR8 A;  1JV3 A;  5EJ1 A;  1FOA A;  3ZGG A;  4D48 A;  2OEG A;  5C1H A;  4DE7 A;  1G9R A;  1TVY A;  1G2V A;  1ZI1 A;  5FU0 A;  3CU0 A;  1VHA A;  1JYK A;  1ZJ1 A;  1H7G A;  2RJ4 A;  4M2B A;  1H5T B;  5CMH A;  3SPT A;  5CMI A;  2GGQ A;  2VS4 A;  1ZI3 A;  2NXV A; 
#chains in the Genus database with same CATH topology
 1VGZ A;  4TV8 B;  3WXM B;  2VK9 A;  2L26 A;  4LW3 A;  4LCK A;  2CVL A;  3JUK A;  2E3D A;  3EE5 A;  3LYB A;  1U40 A;  3KIA A;  4I4T B;  4ZHQ A;  4X20 A;  1X7P A;  2DYY A;  5CA0 B;  2BO8 A;  1SS9 A;  2VFZ A;  3CC4 F;  2K1S A;  4C81 A;  5DDT A;  3ZGF A;  1FO8 A;  4KNR A;  3HTN A;  1E7K A;  5EZY B;  5CB4 B;  2P73 A;  1O7Q A;  3VCZ A;  3I0L A;  4FRE A;  3RA6 A;  3P4E A;  5C8Y B;  2WEE A;  1VQL F;  1H7T A;  4C82 A;  2XWN A;  2HRU A;  1TUB A;  3I0D A;  3SXD A;  4HO0 A;  3CPW F;  2FY7 A;  4YJ3 B;  2YCM A;  1WT0 A;  2PMP A;  1RLU A;  2CW4 A;  2IQQ A;  1QVF F;  1VQV A;  5HY4 A;  3ZOP A;  1FNK A;  2WAL A;  1WT1 A;  4CJC A;  4E1K A;  4WBN B;  2FYC B;  3V0P A;  2WVK A;  3RE3 A;  4IRQ A;  2I5K A;  5LXT B;  4CJ8 A;  3SIU A;  1WT3 A;  1VQ5 F;  5C1G A;  3K12 A;  1FFX B;  5AJP A;  1ZJO A;  4O2A B;  5LA6 B;  3WPW A;  4O6N A;  5AVM A;  5BMV A;  3CCS F;  1HM8 A;  2CWJ A;  3JAL A;  1IV2 A;  2OHW A;  3CGX A;  3ZO8 A;  3SXA A;  1FR9 A;  2W0V A;  2HS4 A;  1W5B A;  2BTU A;  2RIX A;  4HO6 A;  1TW1 A;  1Z5V A;  5EIB D;  1JJ2 F;  4FRD A;  5C38 A;  4EEO A;  3CMA F;  1IPA A;  2P72 A;  1HM0 A;  5C1L A;  3JAS A;  3T7O A;  1NF5 B;  3DK5 A;  4R7P A;  4Y62 A;  3U2X A;  1ZJ3 A;  2APC A;  5LOV B;  2A8W A;  3NK7 A;  5MN5 A;  3E20 B;  2Y4K A;  1NJI H;  2JCL A;  5KX5 B;  3FBA A;  1W77 A;  4IIJ B;  1FO9 A;  3E22 B;  4O4I B;  2V0J A;  2Z87 A;  3OH2 A;  1X25 A;  4UEG A;  2AH9 A;  3CC2 F;  4B62 A;  3N2G B;  3V3T A;  4P02 A;  3UT5 A;  2BO7 A;  3ERN A;  5CQL X;  3TZT A;  1JFF A;  2HVY D;  4G4W A;  1ZHJ A;  3CKV A;  1VH8 A;  1QU9 A;  4DXD A;  2LCA A;  3E25 A;  3EOR A;  3CCL F;  4TV8 A;  5FNV A;  3J80 M;  1G23 A;  5IYZ A;  5EAZ A;  5FU8 A;  1R7T A;  2BO1 A;  3VI6 A;  1K8A H;  2BTO A;  3JTJ A;  3JCM M;  5C4B A;  5CA0 A;  3I3F A;  2RIT A;  3POL A;  3WJP A;  1VQ8 F;  1JVD A;  5EZY A;  1H5S B;  1FWY A;  3WPX A;  5CA1 A;  5CB4 A;  2HRY A;  2Y4M A;  2AEC A;  4B4M A;  2I5E A;  2YQJ A;  4Y63 A;  2D7R A;  5C8Y A;  4NAN A;  4HO3 A;  5KMG B;  1JD1 A;  5HXZ A;  4HNA B;  1SZQ A;  3DC2 A;  1GWV A;  1GX4 A;  3F0F A;  1KNJ A;  1R7V A;  5C47 A;  4YJ3 A;  3VIU A;  1XV2 A;  2HS3 A;  5FTV A;  3CYP B;  4WBN A;  1RA4 A;  1W59 A;  1Z90 A;  5LXT A;  4D11 C;  3I7T A;  3VO8 A;  2RJ5 A;  4EEG A;  1PF5 A;  3I0F A;  4Y7G A;  2JNB A;  3JAR B;  2O1F A;  1ZIZ A;  3SXB A;  1OFU A;  4O2A A;  5LA6 A;  4BT6 A;  2VD4 A;  5C4C A;  1ZCT A;  2ZVY A;  3T7N A;  5HY0 A;  3OAM A;  4KC2 A;  1VQK F;  5CMF X;  5J2U B;  5IFY A;  2CSL A;  4C8I A;  1H5S C;  1H4C A;  1GZ0 A;  1INJ A;  3VYT C;  1VQ9 F;  1LL2 A;  3SXC A;  2OI5 A;  2I6D A;  3SIV A;  4ZI7 B;  4HCQ A;  1V83 A;  4K6R A;  1W2B F;  3USQ A;  3F0D A;  1W57 A;  2IG8 A;  2W8B C;  4DEC A;  2YQH A;  4EI8 A;  3AGK A;  1NWG B;  4EB6 A;  4EEM A;  1R7U A;  2RIY A;  4EE5 A;  3E26 A;  3CG6 A;  4X1Y B;  3T80 A;  2GGO A;  1XZ6 A;  5LOV A;  3V0O A;  3SX3 A;  1V82 A;  4X1I B;  3V7E A;  3LFO A;  2ZAU A;  2VXL A;  4D0T A;  1X52 A;  5KX5 A;  4NAL A;  2RJ6 A;  5EYP A;  5IJ0 B;  3FWW A;  2PGV A;  4MYB A;  5GIN C;  5EJ1 A;  3ZGG A;  4O4I A;  1CK2 A;  2V9Y A;  5C1H A;  4X1K A;  1TVY A;  1VHA A;  3K0T A;  1H5T B;  2GGQ A;  3RYI A;  3RYF B;  1ZI3 A;  5C48 A;  1W5A A;  1XHB A;  1COM A;  1W58 1;  2PX7 A;  1RLG A;  1LZ7 A;  1UI9 A;  5CQN X;  4BT3 A;  3CCE F;  2GVI A;  4O4J B;  1Q81 H;  5FYE A;  3RYH B;  3U0Y A;  3SXG A;  4DDZ A;  2HP3 A;  3N2K B;  2PA4 A;  4FRB A;  4O4L B;  2ZOD A;  1NQ3 A;  3JAT B;  2VSH A;  4B45 A;  1VIC A;  1V84 A;  1H3M A;  4ERH A;  1E5K A;  4Y7F A;  5AJO A;  4EI7 A;  2FFU A;  2UZH A;  2Y6P A;  4FRM A;  4LW6 A;  1U3P A;  3F0E A;  2H6L A;  4NQ3 A;  2Z01 A;  3IKE A;  1VZT A;  1KC8 H;  1IV3 A;  3MDO A;  1VGW A;  3OC9 A;  3M1X A;  4FFB A;  1WT2 A;  3F6M A;  1VQP F;  4HO5 A;  4FRP A;  1I52 A;  3WGN A;  4ZHY B;  5FLX M;  2JCJ A;  3S0Y A;  2YQC A;  5IJ9 B;  2R75 1;  1SA0 A;  4Y7U A;  1LZ0 A;  2BTQ B;  1VK3 A;  3PLA C;  3O85 A;  2X65 A;  1R7X A;  5J2U A;  4F6R B;  1GA8 A;  5AJN A;  5LYJ A;  2MZB A;  3OBY A;  4ASY A;  1S4P A;  3PNN A;  4C8G A;  4FCU A;  2I7B A;  4NAK A;  3RYC B;  5GAP K;  2WVL A;  1LZJ A;  3U2T A;  4ZI7 A;  1ZJ0 A;  4BVR A;  1JYL A;  5CMG X;  4CJB A;  3OH0 A;  4M2A A;  2H8C A;  2VGM A;  3VOB A;  5HY2 A;  4X1Y A;  4TUY B;  4X1I A;  4FRH A;  3CB2 A;  5HS2 A;  5J2T B;  3ZP4 A;  2CHT A;  5L6V A;  2R6R 1;  1FXJ A;  2AM4 A;  3HKD B;  4AYJ A;  1QWJ A;  5IJ0 A;  2OI6 A;  5ITZ A;  5JCO C;  3V8Z A;  1VZX A;  1M1K H;  4BQH A;  4U3J B;  2AE7 A;  1TVK B;  3J7A R;  4FRO A;  1H5T A;  3G6E F;  1XHO A;  2YYE A;  3V0Q A;  4G4X A;  2FYB A;  5C4F A;  1LL0 A;  3CKO A;  1MP3 A;  3O3P A;  3WGM A;  3M4S A;  2V0H A;  1JN1 A;  1W42 A;  5D92 A;  2AM3 A;  1DBF A;  2P6W A;  4LNU A;  4I50 A;  3VOA A;  4O4J A;  4C8E A;  4B5C A;  4BT2 A;  3K8E A;  3RYH A;  2OZB A;  3MQW A;  1Q82 H;  3N2K A;  1OQM B;  4EE4 A;  2RHH A;  1ZJP A;  3JAT A;  4HG6 A;  2YC3 A;  2RB9 A;  3U2V A;  3M84 A;  1G93 A;  4G4Z A;  4E6E A;  3V0L A;  2AM5 A;  2FC3 A;  3HKC A;  2P6Y A;  2QGI A;  3IOJ A;  1FZW A;  3KIZ A;  3P0Z A;  3ESJ A;  3U0X A;  1OMX A;  5JVD A;  2WVM A;  1GQ9 A;  5HP7 A;  1IIN A;  4J18 A;  4NWO B;  2JCK A;  2GLZ A;  1NQI B;  3ZF8 A;  1YRO B;  2UYN B;  1YP2 A;  2AGD A;  3I56 F;  1H4E A;  4NAI A;  3JUJ A;  3WGJ A;  2Y4J A;  1HM9 A;  4M8I A;  3DDN A;  1ODE A;  3HWU A;  2V0L A;  5JQG A;  4RQO A;  3K14 A;  1GO0 A;  1DT9 A;  3HKE B;  2KTV A;  2LBX A;  1G8O A;  5C49 A;  2H8E A;  3L7Q A;  2ZU7 A;  2KGW A;  4G87 A;  3ZLL A;  1XBI A;  3JAK B;  1H4D A;  2Y7A A;  2Q1X A;  5DDV A;  4YJ2 A;  1ZI4 A;  3K8D A;  3V0N A;  3USR A;  1NHE B;  3C8L A;  2AES A;  2UX8 A;  4ARW A;  2C0N A;  4I4T A;  2Q1Y A;  3NGW A;  5EIB C;  3GUE A;  1OMZ A;  1KD1 H;  4IHJ B;  4O4H B;  3N4Y A;  3S0W A;  5C3B A;  3SX7 A;  3RMW A;  5EIY A;  5MN6 A;  4BMA A;  3RA5 A;  1YQN A;  1JV3 A;  2RHO A;  4D48 A;  4DE7 A;  3HKD A;  5FU0 A;  2YXZ A;  1JYK A;  3WJR A;  2DT4 A;  3SPT A;  1K9M H;  5CMI A;  3MCQ A;  1VZU A;  3OH4 A;  5GAN K;  3IR9 A;  4KQL A;  3JAW B;  3U2U A;  1VQN F;  4BY9 D;  2DPW A;  2ZF8 A;  2HQS C;  1W3E X;  4XWI A;  4FQW A;  3SX5 A;  1PXW A;  2X5S A;  2OI7 A;  4FCE A;  1FFX A;  1VQ6 F;  1H7M A;  3CME F;  5C8R A;  4JIS A;  5HY1 A;  1ON8 A;  1PZT A;  4G3S A;  1FG5 N;  2UYP A;  1R7Y A;  1IIM A;  4I55 B;  2O1H A;  1FGG A;  3TQD A;  4HO2 A;  2HP0 B;  3N9W A;  3HKB B;  3DUV A;  3D5N A;  1H7F A;  1FXO A;  2YC5 A;  1QD9 A;  3VTI C;  2XMH A;  2V0K A;  1WVC A;  3PKP A;  2OTJ F;  1RQ2 A;  4KT7 A;  4FIX A;  1W40 A;  1H7L A;  4Q7C A;  4FRA A;  4ZHQ B;  1VQ7 F;  4X20 B;  4CVH A;  2ZVZ A;  2VS5 A;  1G95 A;  3Q80 A;  2UYN A;  1QGS A;  4HO8 A;  3I55 F;  2RJ1 A;  4X3M A;  5EJZ A;  3D8V A;  3IMP A;  3G4S F;  2JCO A;  1HJJ A;  3QTY A;  2VXY A;  1CLI A;  4KPX A;  4IIJ A;  3U2W A;  3E22 A;  3C9U A;  1H5R B;  1R82 A;  2VXM A;  2VAP A;  1YIT F;  2AIZ P;  3HKE A;  4X3L A;  3N2G A;  3LWO C;  1MP4 A;  2RJ0 A;  5J49 A;  1GQC A;  4FIY A;  2QKX A;  5HWE A;  1J7H A;  3JAK A;  5B8F A;  4MND A;  2VSI A;  3NK6 A;  3OW2 F;  4D11 A;  3CKJ A;  4FRQ A;  2RJ8 A;  2ICX A;  4EEA A;  3E1Y A;  1EYR A;  4O4H A;  5BMV B;  3SX8 A;  3JAL B;  5MN4 A;  3JAM M;  2E8B A;  5A2Q M;  1H5S A;  4ZHW A;  3CCJ F;  1JVG A;  3V91 A;  5HP8 A;  2RIZ A;  3KE1 A;  1VQM F;  1QVG F;  4B2W A;  3N4Z A;  4B46 A;  5KMG A;  4HNA A;  3S06 A;  5GON B;  3ON1 A;  3C9R A;  2KTU A;  1ZCV A;  4BVQ A;  3FPI A;  1GX1 A;  1G1L A;  1M90 H;  3IOH A;  3F1Y A;  4BW0 B;  1IV4 A;  1R80 A;  3OGZ A;  1YJN F;  3VYS C;  3CC7 F;  4RHA A;  1S72 F;  3CCU F;  3JAW A;  1FRW A;  4L41 C;  3QHD A;  1HV9 A;  4DRX B;  2VS3 A;  2QI2 A;  1IV1 A;  4BT7 A;  3CD6 F;  3JAR A;  3V90 A;  1G0R A;  2FYD B;  3NVI B;  5JQQ A;  4O2B B;  3CCM F;  1G3L A;  2Y4L A;  2ZU8 A;  3BRK X;  2A8U A;  3JVH A;  1QAH A;  2Q4J A;  1MP5 A;  3Q7U A;  2J0B A;  2VGN A;  4ZOL B;  4I55 A;  5FTS A;  4C4W C;  3G71 F;  3UT5 B;  3HKB A;  3HL3 A;  2D7I A;  1JFF B;  4B42 A;  3ST8 A;  3F1C A;  4Y64 A;  2Z86 A;  4Y7V A;  1S4N A;  3CYQ A;  3LW6 A;  3GHZ A;  4HOC A;  5FNV B;  2AMT A;  1FNJ A;  1W5F A;  1O23 B;  5IYZ B;  3RMV A;  4ZK7 A;  2NMU A;  4ASJ A;  2N48 A;  1TZF A;  2J0A A;  2OTM A;  4B5B A;  3IEW A;  4EE3 A;  5JH7 B;  4JD0 A;  5C3D A;  3FOQ A;  2RJ7 A;  2CU2 A;  3CXC F;  1GX0 A;  1H47 A;  5C4D A;  2QA4 F;  1QG8 A;  5CA1 B;  3CCQ F;  2W0W A;  5IDS A;  3V7Q A;  1H48 A;  2YQS A;  4AAW A;  4ZHV A;  4TZZ A;  5C4E A;  2X60 A;  2MQE A;  1H5R A;  4B2X A;  1QGQ A;  4BVS A;  3MBM A;  5G4V C;  3T7M A;  1YHQ F;  2WAW A;  1H7H A;  3V0M A;  1N8R H;  4TV9 B;  3RYF A;  1K4V A;  2F9Z C;  3D54 A;  1PZY B;  1GWW A;  1LZI A;  4GBP A;  4XCQ A;  5FV9 A;  1TW5 A;  2V0I A;  3TD4 A;  2D0J A;  1UFY A;  1GO1 A;  3D01 A;  3GYQ A;  3S02 A;  4O4L A;  4O6M A;  4EVW A;  3LME A;  4B3U A;  2UYK A;  4ZDQ A;  5D91 A;  1G2V A;  1ZI1 A;  3VMF B;  3WGK A;  5CMH A;  4MIX A;  2NXV A;  3GTZ A;  4KC1 A;  2IAF A;  5GON A;  2PGY A;  1T0A A;  2RJ9 A;  5LP6 B;  3FD6 A;  3IEQ A;  2BO4 A;  3FFM A;  1FSZ A;  4EB6 B;  3TD3 A;  1ZDF A;  1Q86 H;  3IKF A;  2EWC A;  1WSZ A;  4PWT A;  2FYA A;  5C36 A;  2AIF A;  5HXU A;  3K2X A;  2FGY A;  4DRX A;  4NUT A;  3I0H A;  2XME A;  5EYP B;  3LWV C;  2YES A;  4R40 B;  5IJ9 A;  1ZJ2 A;  5JCO A;  3C9S A;  3PKQ A;  4M28 A;  2WE9 A;  1YIJ F;  1OAP A;  4O2B A;  3S0H A;  4U39 A;  4X1K B;  3R0P A;  1YJ9 F;  2BO6 A;  2UYJ A;  1NKH B;  3DJ4 A;  2QH5 A;  2GZL A;  1JV1 A;  4F6R A;  4G4V A;  4ZOL A;  1VM8 A;  3RYI B;  3RYC A;  2WGZ A;  3D00 A;  2OEF A;  2Z1U A;  1EZI A;  3KJJ A;  1FGX A;  3U0O A;  5LP6 C;  3HAX D;  1H7E A;  4AC3 A;  1H5S D;  1K73 H;  2LBT A;  3I0K A;  4M4K A;  4D0Z A;  1S4O A;  5JH7 A;  1VQO F;  2KG4 A;  4IRP A;  4AYL A;  4TUY A;  3IOI A;  3OBW A;  5J2T A;  1CN7 A;  5G4U C;  4Y6N A;  4BVT A;  4B4B A;  5I1F A;  1VPA A;  2RHL A;  3I0G A;  1ZCU A;  5EB0 A;  1ZDG A;  5DCV A;  3OH1 A;  1KQS F;  4U3J A;  1T0K B;  4KNX A;  1R81 A;  3R2W A;  2QEX F;  1TVK A;  1X7O A;  4TV9 A;  1RQ7 A;  3VYU C;  4FFB B;  2CZW A;  4G4Y A;  3BCV A;  2FFV A;  3ELC A;  3V4D A;  4FRL A;  1NMU B;  2VAW A;  1ONI A;  3CKN A;  1U43 A;  3CCR F;  3FD5 A;  4Y7T A;  1LL3 A;  3J81 M;  1SA0 B;  1W5E A;  3LDT A;  1VQ4 F;  2X5Z A;  5CQO A;  3LWR C;  1H7Q A;  3R3I A;  5LYJ B;  3S03 A;  3I0J A;  1HJL A;  2QTP A;  1YGY A;  1YP3 A;  2O1G A;  1VGT A;  3TD5 A;  3LWP C;  2RHJ A;  4YS8 A;  1JY8 A;  1YI2 F;  4HO9 A;  5CMJ A;  5LP6 A;  4G3P A;  3P10 A;  1U3L A;  5L6S A;  2OTL F;  2ALE A;  1VH1 A;  3OH3 A;  5EWR A;  4BT4 A;  1SDS A;  3ZP7 A;  2XWM A;  3WGL A;  1NMM B;  1ZCY A;  1YJW F;  4G88 A;  1TUB B;  1XRG A;  3NVK E;  1R1M A;  4C2S A;  1ON6 A;  5IT9 M;  1ZWZ A;  5ITZ B;  3HJW C;  2PHN A;  4KXO A;  3QVB A;  3QUW A;  5CQP A;  3OON A;  5GIO C;  2G9I A;  4HO4 A;  3CCV F;  5FJ4 C;  3WJQ A;  4Y6U A;  1KWS A;  3Q8H A;  2Z1E A;  3KJK A;  3BYQ A;  5IDT A;  3CPQ A;  4IHJ A;  3F0G A;  4LNU B;  4EI9 A;  2XWL A;  4I50 B;  2LBW A;  1W41 A;  2ICY A;  3V8Y A;  5BXC A;  3I0E A;  2I6R A;  2B33 A;  1O7O A;  5EB1 B;  3NMU C;  5GIP C;  3Q4S A;  3RSB A;  1VH3 A;  3PAF A;  4B4G A;  1Z5W A;  2VAM A;  1YP4 A;  3HKC B;  1W55 A;  2Z1T A;  4KRV A;  3JAS B;  4Y9X A;  5FUH A;  1LVW A;  2HS0 A;  4KC4 A;  5EO3 A;  5JVD B;  3D98 A;  1G97 A;  1O0R A;  1MC3 A;  3I0C A;  4G3Q A;  5C3A A;  4P00 A;  3OKR A;  1INI A;  1Q7Y H;  4BT5 A;  3C9T A;  3LWQ C;  3I0I X;  3MCA B;  1KNK A;  3SXE A;  5CQM X;  2ZOV A;  1VGU A;  3CKQ A;  4ECM A;  5JQG B;  2ZU9 A;  3B6N A;  3ZLK A;  1Q8R A;  2Z1F A;  4KPZ A;  3KHN A;  1ZI5 A;  1FR8 A;  2HP0 A;  2HX0 A;  1FOA A;  4KWE A;  2CHS A;  2OEG A;  1G9R A;  3CU0 A;  1ZJ1 A;  1H7G A;  2RJ4 A;  4M2B A;  4YJ2 B;  2VS4 A; 
#chains in the Genus database with same CATH homology
 1VGZ A;  4KC1 A;  5C48 A;  2VK9 A;  1VZU A;  2PGY A;  4LW3 A;  1T0A A;  2RJ9 A;  3OH4 A;  1XHB A;  3JUK A;  2E3D A;  3EE5 A;  4KQL A;  1U40 A;  3IEQ A;  3KIA A;  2BO4 A;  3U2U A;  2PX7 A;  2DPW A;  1LZ7 A;  1ZDF A;  5CQN X;  3IKF A;  1WSZ A;  4XWI A;  2BO8 A;  1SS9 A;  2VFZ A;  4FQW A;  4C81 A;  3SX5 A;  2FYA A;  2X5S A;  5FYE A;  2OI7 A;  4FCE A;  3U0Y A;  3SXG A;  5C36 A;  5DDT A;  3ZGF A;  1FO8 A;  4DDZ A;  5C8R A;  3K2X A;  4JIS A;  4KNR A;  2PA4 A;  4FRB A;  1ON8 A;  1PZT A;  3I0H A;  2P73 A;  1O7Q A;  2VSH A;  1VIC A;  4G3S A;  1FG5 N;  3I0L A;  2XME A;  4FRE A;  1R7Y A;  1V84 A;  2WEE A;  1H3M A;  1IIM A;  2YES A;  1E5K A;  4Y7F A;  1H7T A;  1ZJ2 A;  5AJO A;  2O1H A;  3PKQ A;  1FGG A;  4M28 A;  3TQD A;  4HO2 A;  2FFU A;  2WE9 A;  2UZH A;  3N9W A;  4C82 A;  2XWN A;  2Y6P A;  4FRM A;  4LW6 A;  3DUV A;  3D5N A;  1U3P A;  1H7F A;  3F0E A;  2BO6 A;  3I0D A;  3SXD A;  1FXO A;  3IKE A;  1NKH B;  2YC5 A;  3DJ4 A;  2QH5 A;  2XMH A;  2V0K A;  4HO0 A;  2FY7 A;  2GZL A;  1JV1 A;  2YCM A;  1VZT A;  1WVC A;  3PKP A;  1VM8 A;  1WT0 A;  2PMP A;  1IV3 A;  4KT7 A;  4FIX A;  1WT1 A;  1VGW A;  4CJC A;  4E1K A;  1H7L A;  2WGZ A;  3OC9 A;  2FYC B;  4FRA A;  4Q7C A;  2OEF A;  3V0P A;  2WVK A;  3RE3 A;  4IRQ A;  4CVH A;  1EZI A;  1WT2 A;  2I5K A;  3F6M A;  4HO5 A;  2VS5 A;  4CJ8 A;  1G95 A;  1FGX A;  1WT3 A;  3Q80 A;  1QGS A;  4FRP A;  1I52 A;  4HO8 A;  1H7E A;  5C1G A;  4AC3 A;  1H5S D;  5AJP A;  2RJ1 A;  1ZJO A;  3D8V A;  5EJZ A;  3I0K A;  4M4K A;  4D0Z A;  2JCO A;  1S4O A;  1HJJ A;  4O6N A;  1HM8 A;  2JCJ A;  4KPX A;  1IV2 A;  4IRP A;  4AYL A;  3IOI A;  2YQC A;  3CGX A;  3U2W A;  1H5R B;  1FR9 A;  4Y7U A;  3SXA A;  2W0V A;  1R82 A;  1LZ0 A;  4Y6N A;  2VXM A;  2RIX A;  4B4B A;  5I1F A;  1VPA A;  4HO6 A;  1TW1 A;  3I0G A;  1ZCU A;  1ZDG A;  2X65 A;  1R7X A;  4FRD A;  5C38 A;  4EEO A;  3OH1 A;  1GA8 A;  2RJ0 A;  1MP4 A;  2P72 A;  5AJN A;  2MZB A;  1HM0 A;  4ASY A;  5J49 A;  1S4P A;  1GQC A;  4FIY A;  5C1L A;  2QKX A;  3PNN A;  4KNX A;  1R81 A;  3R2W A;  3T7O A;  4C8G A;  4FCU A;  2I7B A;  4NAK A;  1NF5 B;  2WVL A;  1LZJ A;  3U2T A;  3DK5 A;  5B8F A;  4R7P A;  4Y62 A;  3U2X A;  4MND A;  2VSI A;  1ZJ0 A;  1ZJ3 A;  4D11 A;  3CKJ A;  4FRQ A;  2RJ8 A;  2APC A;  1JYL A;  3BCV A;  2ICX A;  5CMG X;  2FFV A;  4CJB A;  3ELC A;  3OH0 A;  4M2A A;  2A8W A;  4FRL A;  4EEA A;  3CKN A;  1U43 A;  2Y4K A;  1EYR A;  2JCL A;  3FBA A;  3SX8 A;  1W77 A;  4Y7T A;  2E8B A;  1LL3 A;  4FRH A;  5HS2 A;  1FO9 A;  1H5S A;  5L6V A;  1JVG A;  1FXJ A;  2V0J A;  2X5Z A;  3V91 A;  2AM4 A;  2RIZ A;  2Z87 A;  5CQO A;  3OH2 A;  4UEG A;  3KE1 A;  1H7Q A;  4AYJ A;  2AH9 A;  1QWJ A;  4B2W A;  3R3I A;  2OI6 A;  4P02 A;  3I0J A;  1VZX A;  2BO7 A;  3ERN A;  3V8Z A;  1ZCV A;  5CQL X;  1HJL A;  4BQH A;  3TZT A;  3FPI A;  2AE7 A;  1GX1 A;  1YP3 A;  1G1L A;  1ZHJ A;  3CKV A;  1VH8 A;  3IOH A;  3F1Y A;  2O1G A;  4FRO A;  1H5T A;  1VGT A;  1IV4 A;  1R80 A;  3E25 A;  3EOR A;  3V0Q A;  3OGZ A;  2FYB A;  4YS8 A;  5C4F A;  1LL0 A;  3CKO A;  1MP3 A;  1JY8 A;  1G23 A;  3O3P A;  4HO9 A;  5CMJ A;  1FRW A;  2V0H A;  4L41 C;  1JN1 A;  4G3P A;  3QHD A;  5D92 A;  5FU8 A;  1R7T A;  2AM3 A;  3P10 A;  1U3L A;  5L6S A;  1HV9 A;  2VS3 A;  3JTJ A;  2P6W A;  5C4B A;  1VH1 A;  1IV1 A;  4C8E A;  3OH3 A;  2RIT A;  3POL A;  3K8E A;  3V90 A;  1G0R A;  2XWM A;  2FYD B;  1JVD A;  1H5S B;  1NMM B;  1FWY A;  5JQQ A;  1OQM B;  1G3L A;  4EE4 A;  1ZCY A;  1ZJP A;  2Y4L A;  2ZU8 A;  4HG6 A;  2YC3 A;  3BRK X;  2Y4M A;  2AEC A;  4B4M A;  2I5E A;  2A8U A;  3U2V A;  3JVH A;  1G93 A;  2YQJ A;  4Y63 A;  2AM5 A;  2Q4J A;  3V0L A;  1MP5 A;  2D7R A;  3Q7U A;  4C2S A;  2J0B A;  4NAN A;  1ON6 A;  4HO3 A;  5FTS A;  3HL3 A;  2D7I A;  2QGI A;  3IOJ A;  1GWV A;  1FZW A;  1GX4 A;  4KXO A;  3F0F A;  3P0Z A;  3QVB A;  3ESJ A;  3U0X A;  4B42 A;  5CQP A;  1OMX A;  1KNJ A;  3ST8 A;  1R7V A;  2WVM A;  3F1C A;  4Y64 A;  4HO4 A;  2Z86 A;  1GQ9 A;  1IIN A;  5C47 A;  4J18 A;  4Y7V A;  1S4N A;  3LW6 A;  4Y6U A;  3GHZ A;  2JCK A;  1KWS A;  4HOC A;  3Q8H A;  2AMT A;  1NQI B;  3ZF8 A;  5FTV A;  1YRO B;  1YP2 A;  1O23 B;  2AGD A;  3RMV A;  4ASJ A;  5IDT A;  1TZF A;  1H4E A;  1Z90 A;  2J0A A;  4B5B A;  3F0G A;  4NAI A;  3IEW A;  3JUJ A;  2XWL A;  4EE3 A;  4D11 C;  4JD0 A;  2ICY A;  5C3D A;  3V8Y A;  3FOQ A;  2RJ7 A;  2Y4J A;  1HM9 A;  2RJ5 A;  4EEG A;  2CU2 A;  3I0F A;  1GX0 A;  2V0L A;  4Y7G A;  5BXC A;  3I0E A;  1H47 A;  2O1F A;  1ZIZ A;  3SXB A;  5C4D A;  1O7O A;  1QG8 A;  3K14 A;  2W0W A;  5IDS A;  2VD4 A;  1H48 A;  5C4C A;  3Q4S A;  3RSB A;  1ZCT A;  1VH3 A;  2YQS A;  4AAW A;  4B4G A;  3OAM A;  1G8O A;  3T7N A;  4KC2 A;  5CMF X;  5C49 A;  2X60 A;  5C4E A;  1YP4 A;  5IFY A;  1W55 A;  4C8I A;  1H5R A;  1QGQ A;  4KRV A;  4B2X A;  1H5S C;  1H4C A;  1INJ A;  4Y9X A;  5FUH A;  1LVW A;  3MBM A;  2ZU7 A;  1LL2 A;  3T7M A;  4G87 A;  4KC4 A;  3SXC A;  3ZLL A;  2WAW A;  1H4D A;  2OI5 A;  1H7H A;  3V0M A;  2Y7A A;  5DDV A;  4HCQ A;  1ZI4 A;  3D98 A;  1V83 A;  3K8D A;  3V0N A;  1K4V A;  4K6R A;  1G97 A;  3USR A;  1O0R A;  1NHE B;  1MC3 A;  3USQ A;  3F0D A;  1W57 A;  2AES A;  2UX8 A;  4DEC A;  4ARW A;  2C0N A;  2YQH A;  3I0C A;  4G3Q A;  5C3A A;  4P00 A;  1NWG B;  3OKR A;  1INI A;  1PZY B;  3NGW A;  4EEM A;  1R7U A;  3GUE A;  1OMZ A;  1GWW A;  2RIY A;  1LZI A;  4GBP A;  4EE5 A;  3I0I X;  3E26 A;  5FV9 A;  1KNK A;  3T80 A;  3SXE A;  2GGO A;  1XZ6 A;  1TW5 A;  2V0I A;  5CQM X;  2D0J A;  3V0O A;  5C3B A;  3SX3 A;  1VGU A;  3SX7 A;  1V82 A;  3RMW A;  5EIY A;  3CKQ A;  4ECM A;  2VXL A;  2ZU9 A;  4D0T A;  3B6N A;  4O6M A;  3ZLK A;  4BMA A;  4EVW A;  4NAL A;  4B3U A;  2RJ6 A;  4KPZ A;  4ZDQ A;  1YQN A;  2PGV A;  3FWW A;  4MYB A;  1ZI5 A;  1FR8 A;  1JV3 A;  5EJ1 A;  1FOA A;  3ZGG A;  4D48 A;  2OEG A;  5D91 A;  5C1H A;  4DE7 A;  1G9R A;  1TVY A;  1G2V A;  1ZI1 A;  5FU0 A;  3CU0 A;  1VHA A;  1JYK A;  1ZJ1 A;  1H7G A;  2RJ4 A;  4M2B A;  1H5T B;  5CMH A;  3SPT A;  4MIX A;  5CMI A;  2GGQ A;  2VS4 A;  1ZI3 A;  2NXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...