1W57A

Structure of the bifunctional ispdf from campylobacter jejuni containing zn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
EMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
total genus 106
structure length 368
sequence length 368
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w57A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w57A01
1O23B 1FRWA 1GQ9A 3V8YA 1QG8A 1QGQA 5C1LA 1YP3A 2Z87A 4E1KA 1ZI4A 5CMHA 1VM8A 3Q4SA 1H7TA 3D5NA 4FREA 4HO5A 2A8UA 4D0TA 2FFVA 3B6NA 1HM9A 2VS3A 1H7EA 4NAKA 4B5BA 4FRQA 4HCQA 4C8GA 1KWSA 4C81A 2YESA 2BO4A 1LZ7A 4HO0A 3DK5A 5CMFX 1G0RA 2XWMA 1MP5A 4Y6NA 1H7GA 2XWLA 1GWVA 2OEGA 4K6RA 4C8EA 4CVHA 1G3LA 2VXLA 2XMHA 4M28A 4B2XA 5JQQA 4ASJA 1JV1A 2APCA 2Z86A 3OH1A 1ZJ1A 3CU0A 1ZI1A 3I0CA 4NAIA 3U2WA 3GUEA 4EVWA 1G97A 4Y7TA 3EE5A 1U43A 3CKNA 2YCMA 3SXBA 2Y4KA 4KNXA 3I0KA 1KNKA 1T0AA 4FRLA 2RJ9A 3ST8A 1S4PA 2WAWA 2O1FA 3SXDA 1LL0A 2AH9A 2WVLA 2AESA 1O0RA 3CKQA 3IKFA 1R80A 1TZFA 3KIAA 4G3SA 4C2SA 1G93A 3QVBA 3F6MA 2PA4A 1V82A 3OH0A 2VFZA 1TW5A 2D7RA 5CMJA 3OKRA 3EORA 1FGXA 4HO2A 2UZHA 3V0PA 2GGQA 1R7UA 2GGOA 4KQLA 2BO7A 3LW6A 1FOAA 1HV9A 1R7VA 4D0ZA 4Y9XA 1EZIA 3SX3A 4FQWA 3K14A 1G9RA 3SXAA 1WT2A 1ZJ0A 1S4NA 1VZXA 3SX5A 1S4OA 1SS9A 3JVHA 2MZBA 2FFUA 4P02A 2X5SA 2RJ5A 3OH2A 5I1FA 2W0VA 4IRQA 1ZI3A 2VSIA 2RIYA 4JD0A 3KE1A 1MC3A 4FRMA 2JCKA 3ESJA 4HO9A 3F0DA 3E26A 1JY8A 4AC3A 4Y7UA 1R7YA 5CMIA 2WVKA 2YC3A 1IV4A 5C38A 4DECA 5EJ1A 2OEFA 3BRKX 2V0LA 1ZHJA 3CGXA 2RJ6A 1H7FA 1H4EA 2O1HA 2PMPA 1TVYA 3RMWA 1E5KA 1Z90A 5J49A 4D11A 5C4BA 1HJLA 4KRVA 3F0GA 3Q8HA 2ZU7A 1OQMB 2RJ1A 1U3PA 1HM0A 2WVMA 4YS8A 3P0ZA 1U40A 2AM3A 2Y4JA 3FPIA 4EE4A 1W77A 1H5SC 3IEWA 1GQCA 4Y64A 1HJJA 5C36A 4KC1A 1OMXA 2ICYA 1VZTA 3ZGGA 2E3DA 4JISA 1FO8A 1YQNA 1XHBA 1LVWA 1VHAA 3V0QA 4NALA 1NF5B 3RE3A 1FG5N 5CQLX 1LZIA 2FYAA 3K2XA 1R81A 3F1CA 4NANA 5AJNA 4DDZA 2DPWA 1QWJA 1ZCVA 2ZU8A 5C4EA 2QH5A 2WE9A 5IDSA 1VGTA 1H5TB 1GA8A 2I7BA 1NMMB 3CKOA 4EE3A 4M2BA 4HO8A 3OC9A 2BO6A 3USQA 3I0HA 3DUVA 3O3PA 3V0LA 4C8IA 2Y6PA 4KPZA 5CQMX 4BQHA 3F0FA 1NWGB 1ZDFA 1ZJ2A 4HOCA 2YQSA 2I5EA 4B3UA 1FWYA 2P72A 2V0KA 1ZJOA 3I0IX 4G3PA 3P10A 3OGZA 3T7MA 1YP4A 1W55A 1V84A 2Y4MA 2Y4LA 3ZLLA 4Y63A 2QKXA 2FYBA 1ZIZA 1LL3A 4KXOA 5C47A 2Y7AA 1JYLA 1ZJ3A 4FRDA 1H5RA 4ASYA 1LZ0A 1VZUA 2YQJA 3T7OA 4EEGA 1YROB 1G1LA 1ZI5A 3BCVA 2RITA 1VPAA 1TW1A 5C8RA 5BXCA 1JYKA 5C49A 5CMGX 4Y7FA 5HS2A 4KNRA 5C4FA 1U3LA 2QGIA 4MYBA 3OH3A 3NGWA 2A8WA 5C48A 5DDVA 3N9WA 1VH3A 1H5RB 1VICA 2PGVA 1ZDGA 4FROA 1VGUA 2FYDB 5FTSA 1JVDA 3ZF8A 3IEQA 1V83A 3T7NA 2ICXA 4B2WA 1FXOA 2W0WA 1ZCUA 1NHEB 3SXGA 3T80A 3TZTA 3OH4A 4J18A 4G3QA 4CJBA 5C3BA 3V91A 4ARWA 1FZWA 2YQHA 2RJ7A 2FYCB 3HL3A 2VD4A 4BMAA 4CJ8A 5FTVA 2ZU9A 3V90A 4M2AA 3Q80A 4AYJA 4HO4A 3U2TA 2OI5A 1H4DA 3I0GA 2AM5A 3RMVA 5EIYA 1H5TA 1YP2A 3JUKA 1FGGA 5CQNX 3D98A 5C1GA 3PKQA 5C3AA 3ZLKA 4D11C 5C3DA 2AE7A 5AJOA 3E25A 3QHDA 2O1GA 4KC2A 2JCOA 3U2UA 5C4CA 1FR9A 1I52A 2I5KA 5FUHA 1O7QA 4D48A 1VGZA 3V0MA 2AMTA 1EYRA 1LZJA 3U2VA 1H7QA 1H3MA 4AYLA 1MP4A 3F1YA 2V0JA 2GZLA 1GX0A 1ON6A 1FR8A 2YQCA 1NQIB 3I0EA 2UX8A 4B42A 1WT1A 1KNJA 5FYEA 1MP3A 2RJ4A 2P6WA 1WT0A 3ERNA 3V0OA 1PZYB 3SX8A 1G95A 3FBAA 5AJPA 1ZCYA 3OAMA 4MNDA 3POLA 3CKJA 3I0DA 1IV2A 3I0LA 5L6SA 1H5SA 3PKPA 2VSHA 1ZCTA 2RJ0A 2PX7A 4FRHA 4HG6A 5C1HA 3JTJA 3SPTA 3USRA 3R3IA 2P73A 3U0XA 1INIA 1GX4A 2JCJA 2NXVA 2X65A 4IRPA 3R2WA 3I0JA 4FRPA 4FRBA 1R7TA 1JVGA 4Y7VA 3Q7UA 2V0IA 4Y62A 2VS4A 1HM8A 1O7OA 5CQOA 5C4DA 5L6VA 2XWNA 4XWIA 4Y6UA 2CU2A 3D8VA 3DJ4A 1IINA 4B4MA 2AM4A 2AGDA 1R7XA 3JUJA 4LW3A 2JCLA 4EEAA 2BO8A 1LL2A 1ZJPA 3SXCA 3IOHA 3GHZA 3IOJA 1XZ6A 5EJZA 1H4CA 2YC5A 1W57A 2VS5A 3FOQA 3SXEA 1WSZA 4L41C 2X60A 4UEGA 1K4VA 3TQDA 1IV1A 1VGWA 4FCUA 4KC4A 1IIMA 4KPXA 5FU0A 2OI6A 3IOIA 1GWWA 4G87A 4AAWA 3IKEA 4FRAA 3SX7A 3ZGFA 5CQPA 2D0JA 4P00A 3ELCA 4C82A 4DE7A 1NKHB 1H5SB 1WVCA 1IV3A 4LW6A 2RIXA 4HO6A 4HO3A 4EEOA 2D7IA 3PNNA 1G23A 2XMEA 4EEMA 3CKVA 1OMZA 3U2XA 4Y7GA 4B4BA 3U0YA 2RJ8A 1H7HA 1PZTA 1H7LA 2X5ZA 1VH1A 2E8BA 3V8ZA 1H5SD 4EE5A 1R82A 2WGZA 5FU8A 1ON8A 2V0HA 3K8EA 1VH8A 2RIZA 4M4KA 4FCEA 3RSBA 5FV9A 5IFYA 2VXMA 1WT3A 4B4GA 1H48A 1FXJA 3MBMA 2AECA 3F0EA 4CJCA 1G2VA 4ECMA 5DDTA 4KT7A 4ZDQA 4GBPA 3V0NA 1G8OA 1H47A 1FO9A 2PGYA 3K8DA 2OI7A 2FY7A 5IDTA 3FWWA 5B8FA 1JV3A 2Q4JA 3I0FA 1GX1A 2WEEA 1INJA 1JN1A 1QGSA 4R7PA
chains in the Genus database with same CATH superfamily
5MN6A 1FRWA 1GQ9A 1O23B 3TD4A 1QG8A 5J2TA 3V8YA 1QGQA 3CCMF 2HS0A 5C1LA 1VQMF 5JH7A 1YP3A 3RA6A 2Z87A 2H8CA 5LXTA 1ZI4A 1VM8A 5CMHA 3Q4SA 1H7TA 3D5NA 4FREA 2ALEA 1QAHA 4TV8B 3KJKA 3VYSC 5A2QM 2A8UA 1JFFA 1COMA 2FFVA 3B6NA 1HM9A 2VS3A 4RQOA 1H7EA 3AGKA 4I55A 4YJ3A 5LA6B 4NAKA 4FRQA 4HCQA 4C8GA 4B5BA 4BVSA 1KWSA 2EWCA 1VQ7F 5C3DA 3TD5A 4C81A 3I7TA 3CCSF 1LZ7A 2BO4A 2YESA 3K0TA 2BO1A 3DK5A 4HO0A 1YITF 5CMFX 1G0RA 2XWMA 1MP5A 4Y6NA 1H7GA 2XWLA 1GWVA 4ZHQA 2OEGA 5D91A 1DT9A 4K6RA 3N2GB 3HKBA 4C8EA 4CVHA 1G3LA 2VXLA 4G4XA 2XMHA 4M28A 4B2XA 3CB2A 3ZOPA 4G4YA 4EB6A 4ASJA 1JV1A 2APCA 2Z86A 3S0HA 3OH1A 1X7PA 5J2TB 1ZJ1A 4BW0B 5LP6C 5BMVA 4FFBA 5EO3A 2J0BA 3CU0A 1ZI1A 3I0CA 4NAIA 3U2WA 3GUEA 5JCOC 3VCZA 4EVWA 1G97A 2IQQA 1Q7YH 3EE5A 4Y7TA 1U43A 1Z5VA 3CKNA 2RHOA 3VYUC 4E1KA 1RQ2A 2OTJF 2YCMA 3SXBA 3NK7A 2Y4KA 2LBTA 4KNXA 3I0KA 5AVMA 3ON1A 1KNKA 1T0AA 4FRLA 2RJ9A 3ST8A 5ITZB 3WGNA 2YXZA 1S4PA 2O1FA 2WAWA 3UT5A 4C4WC 1LL0A 3CCEF 2AH9A 2WVLA 3I55F 3CCVF 3SXDA 2AESA 1O0RA 3CKQA 3IKFA 1R80A 1TZFA 2QI2A 4G4VA 3KIAA 2RB9A 4G3SA 5GIOC 3CC7F 4C2SA 3RYHA 4EB6B 3LWPC 1G93A 3QVBA 3F6MA 5EYPA 3CC2F 5BMVB 4NUTA 2Q1XA 4BT2A 1X7OA 2NMUA 1V82A 2PA4A 1ZWZA 5IYZB 1VQ5F 2B33A 1TW5A 2CWJA 2D7RA 2VFZA 5CMJA 3JALA 2GLZA 3EORA 4WBNA 1FGXA 4YJ2B 3OKRA 4HO2A 2UZHA 1VQ4F 3V0PA 2GGQA 2FGYA 3J81M 1R7UA 2J0AA 5IJ9B 4O4JB 3I3FA 3E22B 3SIVA 2GGOA 4KQLA 4PWTA 3LFOA 4F6RB 1XHOA 5ITZA 3CMEF 1W5FA 2BO7A 3LW6A 1FOAA 4FIXA 1HV9A 1N8RH 2VXYA 1R7VA 5LXTB 4D0ZA 4Y9XA 1EZIA 1W42A 3SX3A 1XBIA 4FQWA 3K14A 3CCUF 1G9RA 3SXAA 3ZO8A 3WGMA 1WT2A 1ZJ0A 1YJNF 4I55B 4YJ3B 1S4NA 1VZXA 3SX5A 5MN5A 1S4OA 3S0WA 3RYHB 1SS9A 1XRGA 3JVHA 3HJWC 3NVKE 4B62A 2FFUA 2MZBA 4P02A 1OAPA 2X5SA 1RQ7A 3LWQC 1Q82H 2RJ5A 3OH2A 5I1FA 2W0VA 4IRQA 1ODEA 1ZI3A 2RIYA 2VSIA 1FNKA 4JD0A 3KE1A 1MC3A 4FRMA 2JCKA 3ESJA 5FLXM 4HNAB 2KTUA 1VQKF 4HO9A 3OONA 5IJ0A 3E22A 3F0DA 1JY8A 1K73H 3E26A 4AC3A 5EAZA 4ZI7B 4Y7UA 1R7YA 5CMIA 4FFBB 3QUWA 4G4WA 3JAKA 3V7EA 2WVKA 2R751 2YC3A 1IV4A 5C38A 4DECA 2YYEA 4LNUA 5EJ1A 4KWEA 3V7QA 2OEFA 3BRKX 1FFXA 4I50B 2V0LA 1ZHJA 5LOVB 2R6R1 4BVQA 4TUYA 3D01A 1VQPF 3CGXA 2RJ6A 1H7FA 5LYJB 1H4EA 3VOAA 2O1HA 1CLIA 2PMPA 1TVYA 5HP7A 3RMWA 3V4DA 1E5KA 1YGYA 4RHAA 5HY1A 1Z90A 5J49A 4D11A 3QTYA 5C4BA 1JD1A 1HJLA 3GYQA 3JARA 4KRVA 2QTPA 3F0GA 3Q8HA 4BVRA 2ZU7A 1OQMB 1TUBA 1VK3A 2RJ1A 1U3PA 2FC3A 1HM0A 2WVMA 4X1KB 4ZI7A 2CHSA 3CC4F 5G4UC 3PLAC 5G4VC 2DYYA 3TD3A 3M84A 1VQOF 4YS8A 3P0ZA 5HY0A 1U40A 2AM3A 1W59A 2JNBA 4BT7A 3FPIA 2Y4JA 1W77A 3JAMM 1H5SC 4EE4A 3IEWA 1GQCA 4Y64A 5EB0A 3IMPA 4O4JA 4DXDA 1HJJA 4KC1A 2ZAUA 3TQDA 1OMXA 5C36A 2ICYA 4TUYB 1VZTA 3ZGGA 2E3DA 4JISA 3L7QA 5EIBC 1FO8A 2K1SA 1YQNA 1GZ0A 2Z1FA 3U0OA 1XHBA 1LVWA 1VHAA 3V0QA 4NALA 3CYPB 3CCJF 1KQSF 1NF5B 1W581 3SPTA 3RE3A 1FG5N 5CQLX 1LZIA 2FYAA 2P6YA 5KMGB 3K2XA 3NK6A 4U3JA 1TUBB 1R81A 3CG6A 3WJPA 3F1CA 3N4YA 4ERHA 4NANA 5MN4A 3RYFB 5AJNA 4DDZA 5IYZA 1KD1H 2DPWA 4X1YA 1QWJA 1ZCVA 1CN7A 2H6LA 2ZU8A 5C4EA 1UFYA 3RYIB 2QH5A 2WE9A 1SZQA 1Q86H 5IDSA 1VGTA 1H5TB 1GA8A 2I7BA 2PHNA 1NMMB 3CKOA 4EE3A 4IHJA 1W2BF 4HO8A 1E7KA 3OC9A 2BO6A 4M2BA 4F6RA 3USQA 2Z1UA 3I0HA 3DUVA 5J2UB 4EI8A 3O3PA 3CCLF 3V0LA 3S02A 4C8IA 3JASB 2Y6PA 4KPZA 5CQMX 2KG4A 5C8YB 4BQHA 3F0FA 4LNUB 1R1MA 1ONIA 1NWGB 3SIUA 1ZDFA 1VQVA 4G88A 3HAXD 1ZJ2A 4HOCA 2YQSA 1RA4A 2QEXF 2I5EA 4FIYA 4B3UA 1FWYA 2P72A 2CW4A 5CA0A 1ZJOA 2V0KA 3KIZA 3PAFA 3I0IX 3OBWA 4G3PA 3P10A 3UT5B 3G71F 3NVIB 3OGZA 3T7MA 1YP4A 1W55A 5LYJA 1V84A 2Y4MA 3FD5A 3VIUA 2Y4LA 3ZLLA 4Y63A 2QKXA 5C48A 3WGJA 3RYCA 1X52A 3NMUC 2RHHA 2FYBA 2OZBA 1ZIZA 1LL3A 4KXOA 5C47A 1QVFF 2Y7AA 1CK2A 4IHJB 2VAPA 3O85A 1JYLA 1ZJ3A 4X20B 5GANK 1W5BA 1TVKA 5GONA 4FRDA 2BTUA 4X1KA 1H5RA 4ASYA 2HX0A 4X3LA 2VAMA 4I4TA 1LZ0A 3JALB 3CCRF 3C9UA 3HKDA 5JVDB 3LDTA 1FFXB 4O4HA 1VZUA 4I50A 2YQJA 5LOVA 4LCKA 1YROB 1G1LA 1ZI5A 2HP0A 3T7OA 3ZLKA 4EEGA 3C9TA 3D54A 3BCVA 2RITA 1VPAA 2IAFA 4O4LB 3CYQA 1TW1A 5C8RA 5BXCA 3DDNA 5EZYB 1JYKA 5C49A 4R40B 5HWEA 5CMGX 5GINC 4Y7FA 5HS2A 4KNRA 5C4FA 4NQ3A 1U3LA 2BTOA 2QGIA 4EI7A 4MYBA 5FJ4C 3MQWA 3OH3A 5JCOA 1RLUA 2UYKA 1KC8H 3NGWA 2A8WA 3LYBA 3N2KB 2AIFA 4O4IB 5GONB 3VI6A 1SDSA 1VH3A 1H5RB 3N9WA 5DDVA 1VICA 2PGVA 1ZDGA 4FROA 1VGUA 2FYDB 1PF5A 4I4TB 3M1XA 5HY2A 3R0PA 4BY9D 4E6EA 1JVDA 4O6MA 3VO8A 5FTSA 2VGMA 3RYIA 3ZF8A 3IEQA 3WPXA 4EI9A 3M4SA 1V83A 2ZVYA 3T7NA 2ICXA 4B2WA 2HRUA 4O2BA 1FXOA 2W0WA 1ZCUA 4D0TA 4B45A 1NHEB 3SXGA 3T80A 3TZTA 4O2AA 1YJ9F 3OH4A 4J18A 4O4LA 4G3QA 4CJBA 5C3BA 3V91A 1T0KB 4ARWA 3JAKB 3JASA 1FZWA 2YQHA 5C8YA 2RJ7A 2FYCB 1SA0B 2N48A 4ZHWA 3CXCF 1S72F 3HL3A 3HTNA 2VD4A 5KMGA 4ZOLB 2GVIA 3IR9A 2ZOVA 4BMAA 5CB4A 5FTVA 5HXUA 2ZU9A 4CJ8A 3V90A 4M2AA 3JCMM 3Q80A 1YI2F 4AYJA 4HO4A 5CA1A 3U2TA 2OI5A 1H4DA 3I0GA 3RYCB 2AM5A 3RMVA 5EIYA 1H5TA 4BT4A 4Q7CA 4HO5A 1VQLF 1YP2A 3K12A 3JUKA 4X20A 4O2AB 3WJQA 1FGGA 2HS3A 5CQNX 1UI9A 2H8EA 1X25A 2ZVZA 1JN1A 3D98A 3PKQA 5C1GA 5C3AA 4D11C 3DC2A 3ZP4A 2AE7A 2I6DA 2LBXA 4DRXB 3E25A 5AJOA 3QHDA 5JVDA 2O1GA 1NMUB 3C8LA 1Z5WA 4KC2A 2JCOA 3CPWF 3U2UA 5C4CA 1K8AH 1FR9A 1I52A 3S0YA 2I5KA 5FUHA 1O7QA 3SXEA 4D48A 1VGZA 3V0MA 2AMTA 3J80M 2Q1YA 1EYRA 1LZJA 3WXMB 1Q81H 2CSLA 1H7QA 3U2VA 1H3MA 4HG6A 4AYLA 3JAWB 1MP4A 3F1YA 1RLGA 1QU9A 2KGWA 2V0JA 2GZLA 1GX0A 5GIPC 1FR8A 2CVLA 1NQIB 1ON6A 4ZHVA 3LWOC 2HVYD 2YQCA 1DBFA 3I0EA 2UX8A 4O6NA 4B42A 1IPAA 4U3JB 2HRYA 1WT1A 1KNJA 5FYEA 2RHJA 2VGNA 5FNVA 1TVKB 2HQSC 3J7AR 1MP3A 3RYFA 1WT0A 2P6WA 2RJ4A 3WGKA 3S03A 3ERNA 4X1YB 3V0OA 1PZYB 3SX8A 2HP3A 3FBAA 1G95A 3HKDB 5AJPA 4O4HB 4DRXA 4TZZA 3VOBA 1M90H 2IG8A 1ZCYA 1K9MH 3OAMA 3C9RA 4MNDA 1NQ3A 3POLA 4O2BB 2LCAA 3CKJA 3I0DA 1IV2A 4X3MA 5J2UA 1PXWA 1H5SA 3I0LA 3PKPA 5L6SA 4X1IA 2VSHA 2Z01A 1ZCTA 4ZK7A 5EZYA 2RJ0A 3CMAF 2PX7A 3OH0A 3KJJA 4FRHA 3HKCA 5LP6A 3JTJA 3WGLA 4M8IA 3R3IA 2P73A 5C1HA 3N4ZA 4BT5A 1INIA 1GX4A 3U0XA 4B5CA 4IIJB 2JCJA 2NXVA 2X65A 1FNJA 4IRPA 3R2WA 3I0JA 4TV9B 5CA0B 4FRBA 4FRPA 1VQ9F 5D92A 5KX5A 3MCAB 1R7TA 1JVGA 4Y7VA 1JJ2F 3LMEA 2W8BC 3Q7UA 2V0IA 3OW2F 4Y62A 5DCVA 2VS4A 1HM8A 3S06A 2OTMA 1O7OA 3E20B 5CQOA 5C4DA 1OFUA 5L6VA 2UYNA 2XWNA 4XWIA 3GTZA 4Y6UA 2CU2A 3D8VA 3DJ4A 1IINA 2RHLA 1H7MA 4B4MA 5JQGA 4XCQA 2AM4A 2AGDA 4X1IB 5HY4A 1SA0A 1R7XA 3JUJA 4LW3A 2JCLA 4BT3A 3ZP7A 1LL2A 1ZJPA 2BO8A 1W40A 2I6RA 4G4ZA 3IOHA 3GHZA 4IIJA 3SXCA 1YJWF 2HP0B 2BTQB 2Z1TA 1M1KH 2OHWA 5KX5B 2ZF8A 3C9SA 3IOJA 1XZ6A 1QGSA 5EJZA 1H4CA 1FSZA 5HP8A 3OBYA 1VQ6F 3BYQA 2UYJA 2YC5A 1W57A 2VS5A 2L26A 2WALA 3VYTC 3FOQA 4B46A 2UYPA 1WSZA 3FD6A 2X60A 2C0NA 4L41C 1K4VA 4UEGA 3D00A 1IV1A 3LWRC 1VGWA 4FCUA 4KC4A 2DT4A 1IIMA 3N2KA 4O4IA 1VQ8F 5JQGB 3HKEB 5EYPB 4KPXA 5FU0A 2OI6A 3MCQA 1QD9A 3IOIA 1GWWA 4G87A 4AAWA 3IKEA 3G4SF 4FRAA 3SX7A 1YHQF 4ZHQB 3ZGFA 3JATB 5EWRA 5CQPA 2D0JA 4P00A 3ELCA 3RA5A 3WJRA 3G6EF 1YIJF 4C82A 4DE7A 1NKHB 3FFMA 1H5SB 1XV2A 1WVCA 4U39A 1IV3A 1W5AA 2ZODA 2RIXA 4HO6A 4HO3A 3JAWA 4LW6A 4TV8A 4EEOA 3HKCB 1JFFB 5LP6B 1J7HA 2D7IA 3PNNA 1GO0A 1G23A 2XMEA 5EB1B 4EEMA 3CD6F 4ZOLA 2MQEA 3WPWA 2Z1EA 1OMZA 3CKVA 1QVGF 4Y7GA 5CB4B 3U0YA 3U2XA 4B4BA 2F9ZC 2RJ8A 1H7HA 3LWVC 1W41A 1NJIH 1PZTA 1H7LA 2X5ZA 5HXZA 1VH1A 2E8BA 5CA1B 3V8ZA 3P4EA 1H5SD 4MIXA 3HKBB 3JATA 4EE5A 2UYNB 1R82A 2WGZA 5FU8A 1ON8A 3HWUA 3VMFB 2V0HA 3K8EA 1VH8A 5IJ0B 2RIZA 4M4KA 4FCEA 3RSBA 4EEAA 5FV9A 2V9YA 2VXMA 5IFYA 1WT3A 4B4GA 1H48A 2LBWA 1FXJA 4ZHYB 3MBMA 2AIZP 1W5EA 2AECA 4WBNB 4YJ2A 3F0EA 4CJCA 4BT6A 1G2VA 3USRA 4TV9A 4NWOB 1W3EX 1Q8RA 2CHTA 4ECMA 3I56F 5DDTA 4KT7A 4ZDQA 4GBPA 5JH7B 3V0NA 1G8OA 1H47A 3E1YA 3KHNA 3V3TA 1FO9A 2PGYA 5EIBD 2OI7A 2VAWA 2HS4A 3K8DA 3CCQF 5LA6A 5GAPK 2FY7A 3JARB 5IDTA 3FWWA 2OTLF 5B8FA 5JQQA 5FNVB 1JV3A 2Q4JA 3I0FA 4BVTA 2G9IA 1GX1A 3HKEA 2KTVA 5IT9M 3CPQA 1VQNF 3N2GA 1GO1A 2WEEA 3VTIC 1INJA 2VK9A 3MDOA 5IJ9A 2CZWA 4R7PA 2QA4F 4HNAA
chains in the Genus database with same CATH topology
1O23B 1FRWA 1GQ9A 3V8YA 1QG8A 1QGQA 5C1LA 1YP3A 2Z87A 4E1KA 1ZI4A 5CMHA 1VM8A 3Q4SA 1H7TA 3D5NA 4FREA 4HO5A 2A8UA 4D0TA 2FFVA 3B6NA 1HM9A 2VS3A 1H7EA 4NAKA 4B5BA 4FRQA 4HCQA 4C8GA 1KWSA 4C81A 2YESA 2BO4A 1LZ7A 4HO0A 3DK5A 5CMFX 1G0RA 2XWMA 1MP5A 4Y6NA 1H7GA 2XWLA 1GWVA 2OEGA 5D91A 4K6RA 4C8EA 4CVHA 1G3LA 2VXLA 2XMHA 4M28A 4B2XA 5JQQA 4ASJA 1JV1A 2APCA 2Z86A 3OH1A 1ZJ1A 3CU0A 2J0BA 1ZI1A 3I0CA 4NAIA 3U2WA 3GUEA 4EVWA 1G97A 4Y7TA 3EE5A 1U43A 3CKNA 2YCMA 3SXBA 2Y4KA 4KNXA 3I0KA 1KNKA 1T0AA 4FRLA 2RJ9A 3ST8A 1S4PA 2WAWA 2O1FA 3SXDA 1LL0A 2AH9A 2WVLA 2AESA 1O0RA 3CKQA 3IKFA 1R80A 1TZFA 3KIAA 4G3SA 4C2SA 1G93A 3QVBA 3F6MA 2PA4A 1V82A 3OH0A 2VFZA 1TW5A 2D7RA 5CMJA 3OKRA 3EORA 1FGXA 4HO2A 2UZHA 3V0PA 2GGQA 1R7UA 2J0AA 2GGOA 4KQLA 2BO7A 3LW6A 1FOAA 4FIXA 1HV9A 1R7VA 4D0ZA 4Y9XA 1EZIA 3SX3A 4FQWA 3K14A 1G9RA 3SXAA 1WT2A 1ZJ0A 1S4NA 1VZXA 3SX5A 1S4OA 1SS9A 3JVHA 2MZBA 2FFUA 4P02A 2X5SA 2RJ5A 3OH2A 5I1FA 2W0VA 4IRQA 1ZI3A 2VSIA 2RIYA 4JD0A 3KE1A 1MC3A 4FRMA 2JCKA 3ESJA 4HO9A 3F0DA 3E26A 1JY8A 4AC3A 4Y7UA 1R7YA 5CMIA 2WVKA 2YC3A 1IV4A 5C38A 4DECA 5EJ1A 2OEFA 3BRKX 2V0LA 1ZHJA 3CGXA 2RJ6A 1H7FA 1H4EA 2O1HA 2PMPA 1TVYA 3RMWA 1E5KA 1Z90A 5J49A 4D11A 5C4BA 1HJLA 4KRVA 3F0GA 3Q8HA 2ZU7A 1OQMB 2RJ1A 1U3PA 1HM0A 2WVMA 4YS8A 3P0ZA 1U40A 2AM3A 2Y4JA 3FPIA 4EE4A 1W77A 1H5SC 3IEWA 1GQCA 4Y64A 1HJJA 5C36A 4KC1A 1OMXA 2ICYA 1VZTA 3ZGGA 2E3DA 4JISA 1FO8A 1YQNA 1XHBA 1LVWA 1VHAA 3V0QA 4NALA 1NF5B 3RE3A 1FG5N 5CQLX 1LZIA 2FYAA 3K2XA 1R81A 3F1CA 4NANA 5AJNA 4DDZA 2DPWA 1QWJA 1ZCVA 2ZU8A 5C4EA 2QH5A 2WE9A 5IDSA 1VGTA 1H5TB 1GA8A 2I7BA 1NMMB 3CKOA 4EE3A 4M2BA 4HO8A 3OC9A 2BO6A 3USQA 3I0HA 3DUVA 3O3PA 3V0LA 4C8IA 2Y6PA 4KPZA 5CQMX 4BQHA 3F0FA 1NWGB 1ZDFA 1ZJ2A 4HOCA 2YQSA 4FIYA 2I5EA 4B3UA 1FWYA 2P72A 2V0KA 1ZJOA 3I0IX 4G3PA 3P10A 3OGZA 3T7MA 1YP4A 1W55A 1V84A 2Y4MA 2Y4LA 3ZLLA 4Y63A 2QKXA 2FYBA 1ZIZA 1LL3A 4KXOA 5C47A 2Y7AA 1JYLA 1ZJ3A 4FRDA 1H5RA 4ASYA 1LZ0A 1VZUA 2YQJA 3T7OA 4EEGA 1YROB 1G1LA 1ZI5A 3BCVA 2RITA 1VPAA 1TW1A 5C8RA 5BXCA 1JYKA 5C49A 5CMGX 4Y7FA 5HS2A 4KNRA 5C4FA 1U3LA 2QGIA 4MYBA 3OH3A 3NGWA 2A8WA 5C48A 5DDVA 3N9WA 1VH3A 1H5RB 1VICA 2PGVA 1ZDGA 4FROA 1VGUA 2FYDB 5FTSA 1JVDA 4O6MA 3ZF8A 3IEQA 1V83A 3T7NA 2ICXA 4B2WA 1FXOA 2W0WA 1ZCUA 1NHEB 3SXGA 3T80A 3TZTA 3OH4A 4J18A 4G3QA 4CJBA 5C3BA 3V91A 4ARWA 1FZWA 2YQHA 2RJ7A 2FYCB 3HL3A 2VD4A 4BMAA 4CJ8A 5FTVA 2ZU9A 3V90A 4M2AA 3Q80A 4AYJA 4HO4A 3U2TA 2OI5A 1H4DA 3I0GA 2AM5A 3RMVA 5EIYA 1H5TA 4Q7CA 1YP2A 3JUKA 1FGGA 5CQNX 3D98A 5C1GA 3PKQA 5C3AA 3ZLKA 4D11C 5C3DA 2AE7A 5AJOA 3E25A 3QHDA 2O1GA 4KC2A 2JCOA 3U2UA 5C4CA 1FR9A 1I52A 2I5KA 5FUHA 1O7QA 4D48A 1VGZA 3V0MA 2AMTA 1EYRA 1LZJA 3U2VA 1H7QA 1H3MA 4AYLA 1MP4A 3F1YA 2V0JA 2GZLA 1GX0A 1ON6A 1FR8A 2YQCA 1NQIB 3I0EA 4O6NA 2UX8A 4B42A 1WT1A 1KNJA 5FYEA 1MP3A 2RJ4A 2P6WA 1WT0A 3ERNA 3V0OA 1PZYB 3SX8A 1G95A 3FBAA 5AJPA 1ZCYA 3OAMA 4MNDA 3POLA 3CKJA 3I0DA 1IV2A 3I0LA 5L6SA 1H5SA 3PKPA 2VSHA 1ZCTA 2RJ0A 2PX7A 4FRHA 4HG6A 5C1HA 3JTJA 3SPTA 3USRA 3R3IA 2P73A 3U0XA 1INIA 1GX4A 2JCJA 2NXVA 2X65A 4IRPA 3R2WA 3I0JA 4FRPA 4FRBA 5D92A 1R7TA 1JVGA 4Y7VA 3Q7UA 2V0IA 4Y62A 2VS4A 1HM8A 1O7OA 5CQOA 5C4DA 5L6VA 2XWNA 4XWIA 4Y6UA 2CU2A 3D8VA 3DJ4A 1IINA 4B4MA 2AM4A 2AGDA 1R7XA 3JUJA 4LW3A 2JCLA 4EEAA 2BO8A 1LL2A 1ZJPA 3SXCA 3IOHA 3GHZA 3IOJA 1XZ6A 5EJZA 1H4CA 2YC5A 1W57A 2VS5A 3FOQA 3SXEA 1WSZA 4L41C 2X60A 2C0NA 4UEGA 1K4VA 3TQDA 1IV1A 1VGWA 4FCUA 4KC4A 1IIMA 4KPXA 5FU0A 2OI6A 3IOIA 1GWWA 4G87A 4AAWA 3IKEA 4FRAA 3SX7A 3ZGFA 5CQPA 2D0JA 4P00A 3ELCA 4C82A 4DE7A 1NKHB 1H5SB 1WVCA 1IV3A 4LW6A 2RIXA 4HO6A 4HO3A 4EEOA 2D7IA 3PNNA 1G23A 2XMEA 4EEMA 3CKVA 1OMZA 3U2XA 4Y7GA 4B4BA 3U0YA 2RJ8A 1H7HA 1PZTA 1H7LA 2X5ZA 1VH1A 2E8BA 3V8ZA 1H5SD 4MIXA 4EE5A 1R82A 2WGZA 5FU8A 1ON8A 2V0HA 3K8EA 1VH8A 2RIZA 4M4KA 4FCEA 3RSBA 5FV9A 5IFYA 2VXMA 1WT3A 4B4GA 1H48A 1FXJA 3MBMA 2AECA 3F0EA 4CJCA 1G2VA 4ECMA 5DDTA 4KT7A 4ZDQA 4GBPA 3V0NA 1G8OA 1H47A 1FO9A 2PGYA 3K8DA 2OI7A 2FY7A 5IDTA 3FWWA 5B8FA 1JV3A 2Q4JA 3I0FA 1GX1A 2WEEA 1INJA 2VK9A 1JN1A 1QGSA 4R7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O23 B;  1FRW A;  1GQ9 A;  3V8Y A;  1QG8 A;  1QGQ A;  5C1L A;  1YP3 A;  2Z87 A;  4E1K A;  1ZI4 A;  5CMH A;  1VM8 A;  3Q4S A;  1H7T A;  3D5N A;  4FRE A;  4HO5 A;  2A8U A;  4D0T A;  2FFV A;  3B6N A;  1HM9 A;  2VS3 A;  1H7E A;  4NAK A;  4B5B A;  4FRQ A;  4HCQ A;  4C8G A;  1KWS A;  4C81 A;  2YES A;  2BO4 A;  1LZ7 A;  4HO0 A;  3DK5 A;  5CMF X;  1G0R A;  2XWM A;  1MP5 A;  4Y6N A;  1H7G A;  2XWL A;  1GWV A;  2OEG A;  4K6R A;  4C8E A;  4CVH A;  1G3L A;  2VXL A;  2XMH A;  4M28 A;  4B2X A;  5JQQ A;  4ASJ A;  1JV1 A;  2APC A;  2Z86 A;  3OH1 A;  1ZJ1 A;  3CU0 A;  1ZI1 A;  3I0C A;  4NAI A;  3U2W A;  3GUE A;  4EVW A;  1G97 A;  4Y7T A;  3EE5 A;  1U43 A;  3CKN A;  2YCM A;  3SXB A;  2Y4K A;  4KNX A;  3I0K A;  1KNK A;  1T0A A;  4FRL A;  2RJ9 A;  3ST8 A;  1S4P A;  2WAW A;  2O1F A;  3SXD A;  1LL0 A;  2AH9 A;  2WVL A;  2AES A;  1O0R A;  3CKQ A;  3IKF A;  1R80 A;  1TZF A;  3KIA A;  4G3S A;  4C2S A;  1G93 A;  3QVB A;  3F6M A;  2PA4 A;  1V82 A;  3OH0 A;  2VFZ A;  1TW5 A;  2D7R A;  5CMJ A;  3OKR A;  3EOR A;  1FGX A;  4HO2 A;  2UZH A;  3V0P A;  2GGQ A;  1R7U A;  2GGO A;  4KQL A;  2BO7 A;  3LW6 A;  1FOA A;  1HV9 A;  1R7V A;  4D0Z A;  4Y9X A;  1EZI A;  3SX3 A;  4FQW A;  3K14 A;  1G9R A;  3SXA A;  1WT2 A;  1ZJ0 A;  1S4N A;  1VZX A;  3SX5 A;  1S4O A;  1SS9 A;  3JVH A;  2MZB A;  2FFU A;  4P02 A;  2X5S A;  2RJ5 A;  3OH2 A;  5I1F A;  2W0V A;  4IRQ A;  1ZI3 A;  2VSI A;  2RIY A;  4JD0 A;  3KE1 A;  1MC3 A;  4FRM A;  2JCK A;  3ESJ A;  4HO9 A;  3F0D A;  3E26 A;  1JY8 A;  4AC3 A;  4Y7U A;  1R7Y A;  5CMI A;  2WVK A;  2YC3 A;  1IV4 A;  5C38 A;  4DEC A;  5EJ1 A;  2OEF A;  3BRK X;  2V0L A;  1ZHJ A;  3CGX A;  2RJ6 A;  1H7F A;  1H4E A;  2O1H A;  2PMP A;  1TVY A;  3RMW A;  1E5K A;  1Z90 A;  5J49 A;  4D11 A;  5C4B A;  1HJL A;  4KRV A;  3F0G A;  3Q8H A;  2ZU7 A;  1OQM B;  2RJ1 A;  1U3P A;  1HM0 A;  2WVM A;  4YS8 A;  3P0Z A;  1U40 A;  2AM3 A;  2Y4J A;  3FPI A;  4EE4 A;  1W77 A;  1H5S C;  3IEW A;  1GQC A;  4Y64 A;  1HJJ A;  5C36 A;  4KC1 A;  1OMX A;  2ICY A;  1VZT A;  3ZGG A;  2E3D A;  4JIS A;  1FO8 A;  1YQN A;  1XHB A;  1LVW A;  1VHA A;  3V0Q A;  4NAL A;  1NF5 B;  3RE3 A;  1FG5 N;  5CQL X;  1LZI A;  2FYA A;  3K2X A;  1R81 A;  3F1C A;  4NAN A;  5AJN A;  4DDZ A;  2DPW A;  1QWJ A;  1ZCV A;  2ZU8 A;  5C4E A;  2QH5 A;  2WE9 A;  5IDS A;  1VGT A;  1H5T B;  1GA8 A;  2I7B A;  1NMM B;  3CKO A;  4EE3 A;  4M2B A;  4HO8 A;  3OC9 A;  2BO6 A;  3USQ A;  3I0H A;  3DUV A;  3O3P A;  3V0L A;  4C8I A;  2Y6P A;  4KPZ A;  5CQM X;  4BQH A;  3F0F A;  1NWG B;  1ZDF A;  1ZJ2 A;  4HOC A;  2YQS A;  2I5E A;  4B3U A;  1FWY A;  2P72 A;  2V0K A;  1ZJO A;  3I0I X;  4G3P A;  3P10 A;  3OGZ A;  3T7M A;  1YP4 A;  1W55 A;  1V84 A;  2Y4M A;  2Y4L A;  3ZLL A;  4Y63 A;  2QKX A;  2FYB A;  1ZIZ A;  1LL3 A;  4KXO A;  5C47 A;  2Y7A A;  1JYL A;  1ZJ3 A;  4FRD A;  1H5R A;  4ASY A;  1LZ0 A;  1VZU A;  2YQJ A;  3T7O A;  4EEG A;  1YRO B;  1G1L A;  1ZI5 A;  3BCV A;  2RIT A;  1VPA A;  1TW1 A;  5C8R A;  5BXC A;  1JYK A;  5C49 A;  5CMG X;  4Y7F A;  5HS2 A;  4KNR A;  5C4F A;  1U3L A;  2QGI A;  4MYB A;  3OH3 A;  3NGW A;  2A8W A;  5C48 A;  5DDV A;  3N9W A;  1VH3 A;  1H5R B;  1VIC A;  2PGV A;  1ZDG A;  4FRO A;  1VGU A;  2FYD B;  5FTS A;  1JVD A;  3ZF8 A;  3IEQ A;  1V83 A;  3T7N A;  2ICX A;  4B2W A;  1FXO A;  2W0W A;  1ZCU A;  1NHE B;  3SXG A;  3T80 A;  3TZT A;  3OH4 A;  4J18 A;  4G3Q A;  4CJB A;  5C3B A;  3V91 A;  4ARW A;  1FZW A;  2YQH A;  2RJ7 A;  2FYC B;  3HL3 A;  2VD4 A;  4BMA A;  4CJ8 A;  5FTV A;  2ZU9 A;  3V90 A;  4M2A A;  3Q80 A;  4AYJ A;  4HO4 A;  3U2T A;  2OI5 A;  1H4D A;  3I0G A;  2AM5 A;  3RMV A;  5EIY A;  1H5T A;  1YP2 A;  3JUK A;  1FGG A;  5CQN X;  3D98 A;  5C1G A;  3PKQ A;  5C3A A;  3ZLK A;  4D11 C;  5C3D A;  2AE7 A;  5AJO A;  3E25 A;  3QHD A;  2O1G A;  4KC2 A;  2JCO A;  3U2U A;  5C4C A;  1FR9 A;  1I52 A;  2I5K A;  5FUH A;  1O7Q A;  4D48 A;  1VGZ A;  3V0M A;  2AMT A;  1EYR A;  1LZJ A;  3U2V A;  1H7Q A;  1H3M A;  4AYL A;  1MP4 A;  3F1Y A;  2V0J A;  2GZL A;  1GX0 A;  1ON6 A;  1FR8 A;  2YQC A;  1NQI B;  3I0E A;  2UX8 A;  4B42 A;  1WT1 A;  1KNJ A;  5FYE A;  1MP3 A;  2RJ4 A;  2P6W A;  1WT0 A;  3ERN A;  3V0O A;  1PZY B;  3SX8 A;  1G95 A;  3FBA A;  5AJP A;  1ZCY A;  3OAM A;  4MND A;  3POL A;  3CKJ A;  3I0D A;  1IV2 A;  3I0L A;  5L6S A;  1H5S A;  3PKP A;  2VSH A;  1ZCT A;  2RJ0 A;  2PX7 A;  4FRH A;  4HG6 A;  5C1H A;  3JTJ A;  3SPT A;  3USR A;  3R3I A;  2P73 A;  3U0X A;  1INI A;  1GX4 A;  2JCJ A;  2NXV A;  2X65 A;  4IRP A;  3R2W A;  3I0J A;  4FRP A;  4FRB A;  1R7T A;  1JVG A;  4Y7V A;  3Q7U A;  2V0I A;  4Y62 A;  2VS4 A;  1HM8 A;  1O7O A;  5CQO A;  5C4D A;  5L6V A;  2XWN A;  4XWI A;  4Y6U A;  2CU2 A;  3D8V A;  3DJ4 A;  1IIN A;  4B4M A;  2AM4 A;  2AGD A;  1R7X A;  3JUJ A;  4LW3 A;  2JCL A;  4EEA A;  2BO8 A;  1LL2 A;  1ZJP A;  3SXC A;  3IOH A;  3GHZ A;  3IOJ A;  1XZ6 A;  5EJZ A;  1H4C A;  2YC5 A;  1W57 A;  2VS5 A;  3FOQ A;  3SXE A;  1WSZ A;  4L41 C;  2X60 A;  4UEG A;  1K4V A;  3TQD A;  1IV1 A;  1VGW A;  4FCU A;  4KC4 A;  1IIM A;  4KPX A;  5FU0 A;  2OI6 A;  3IOI A;  1GWW A;  4G87 A;  4AAW A;  3IKE A;  4FRA A;  3SX7 A;  3ZGF A;  5CQP A;  2D0J A;  4P00 A;  3ELC A;  4C82 A;  4DE7 A;  1NKH B;  1H5S B;  1WVC A;  1IV3 A;  4LW6 A;  2RIX A;  4HO6 A;  4HO3 A;  4EEO A;  2D7I A;  3PNN A;  1G23 A;  2XME A;  4EEM A;  3CKV A;  1OMZ A;  3U2X A;  4Y7G A;  4B4B A;  3U0Y A;  2RJ8 A;  1H7H A;  1PZT A;  1H7L A;  2X5Z A;  1VH1 A;  2E8B A;  3V8Z A;  1H5S D;  4EE5 A;  1R82 A;  2WGZ A;  5FU8 A;  1ON8 A;  2V0H A;  3K8E A;  1VH8 A;  2RIZ A;  4M4K A;  4FCE A;  3RSB A;  5FV9 A;  5IFY A;  2VXM A;  1WT3 A;  4B4G A;  1H48 A;  1FXJ A;  3MBM A;  2AEC A;  3F0E A;  4CJC A;  1G2V A;  4ECM A;  5DDT A;  4KT7 A;  4ZDQ A;  4GBP A;  3V0N A;  1G8O A;  1H47 A;  1FO9 A;  2PGY A;  3K8D A;  2OI7 A;  2FY7 A;  5IDT A;  3FWW A;  5B8F A;  1JV3 A;  2Q4J A;  3I0F A;  1GX1 A;  2WEE A;  1INJ A;  1JN1 A;  1QGS A;  4R7P A; 
#chains in the Genus database with same CATH topology
 5MN6 A;  1FRW A;  1GQ9 A;  1O23 B;  3TD4 A;  1QG8 A;  5J2T A;  3V8Y A;  1QGQ A;  3CCM F;  2HS0 A;  5C1L A;  1VQM F;  5JH7 A;  1YP3 A;  3RA6 A;  2Z87 A;  2H8C A;  5LXT A;  1ZI4 A;  1VM8 A;  5CMH A;  3Q4S A;  1H7T A;  3D5N A;  4FRE A;  2ALE A;  1QAH A;  4TV8 B;  3KJK A;  3VYS C;  5A2Q M;  2A8U A;  1JFF A;  1COM A;  2FFV A;  3B6N A;  1HM9 A;  2VS3 A;  4RQO A;  1H7E A;  3AGK A;  4I55 A;  4YJ3 A;  5LA6 B;  4NAK A;  4FRQ A;  4HCQ A;  4C8G A;  4B5B A;  4BVS A;  1KWS A;  2EWC A;  1VQ7 F;  5C3D A;  3TD5 A;  4C81 A;  3I7T A;  3CCS F;  1LZ7 A;  2BO4 A;  2YES A;  3K0T A;  2BO1 A;  3DK5 A;  4HO0 A;  1YIT F;  5CMF X;  1G0R A;  2XWM A;  1MP5 A;  4Y6N A;  1H7G A;  2XWL A;  1GWV A;  4ZHQ A;  2OEG A;  5D91 A;  1DT9 A;  4K6R A;  3N2G B;  3HKB A;  4C8E A;  4CVH A;  1G3L A;  2VXL A;  4G4X A;  2XMH A;  4M28 A;  4B2X A;  3CB2 A;  3ZOP A;  4G4Y A;  4EB6 A;  4ASJ A;  1JV1 A;  2APC A;  2Z86 A;  3S0H A;  3OH1 A;  1X7P A;  5J2T B;  1ZJ1 A;  4BW0 B;  5LP6 C;  5BMV A;  4FFB A;  5EO3 A;  2J0B A;  3CU0 A;  1ZI1 A;  3I0C A;  4NAI A;  3U2W A;  3GUE A;  5JCO C;  3VCZ A;  4EVW A;  1G97 A;  2IQQ A;  1Q7Y H;  3EE5 A;  4Y7T A;  1U43 A;  1Z5V A;  3CKN A;  2RHO A;  3VYU C;  4E1K A;  1RQ2 A;  2OTJ F;  2YCM A;  3SXB A;  3NK7 A;  2Y4K A;  2LBT A;  4KNX A;  3I0K A;  5AVM A;  3ON1 A;  1KNK A;  1T0A A;  4FRL A;  2RJ9 A;  3ST8 A;  5ITZ B;  3WGN A;  2YXZ A;  1S4P A;  2O1F A;  2WAW A;  3UT5 A;  4C4W C;  1LL0 A;  3CCE F;  2AH9 A;  2WVL A;  3I55 F;  3CCV F;  3SXD A;  2AES A;  1O0R A;  3CKQ A;  3IKF A;  1R80 A;  1TZF A;  2QI2 A;  4G4V A;  3KIA A;  2RB9 A;  4G3S A;  5GIO C;  3CC7 F;  4C2S A;  3RYH A;  4EB6 B;  3LWP C;  1G93 A;  3QVB A;  3F6M A;  5EYP A;  3CC2 F;  5BMV B;  4NUT A;  2Q1X A;  4BT2 A;  1X7O A;  2NMU A;  1V82 A;  2PA4 A;  1ZWZ A;  5IYZ B;  1VQ5 F;  2B33 A;  1TW5 A;  2CWJ A;  2D7R A;  2VFZ A;  5CMJ A;  3JAL A;  2GLZ A;  3EOR A;  4WBN A;  1FGX A;  4YJ2 B;  3OKR A;  4HO2 A;  2UZH A;  1VQ4 F;  3V0P A;  2GGQ A;  2FGY A;  3J81 M;  1R7U A;  2J0A A;  5IJ9 B;  4O4J B;  3I3F A;  3E22 B;  3SIV A;  2GGO A;  4KQL A;  4PWT A;  3LFO A;  4F6R B;  1XHO A;  5ITZ A;  3CME F;  1W5F A;  2BO7 A;  3LW6 A;  1FOA A;  4FIX A;  1HV9 A;  1N8R H;  2VXY A;  1R7V A;  5LXT B;  4D0Z A;  4Y9X A;  1EZI A;  1W42 A;  3SX3 A;  1XBI A;  4FQW A;  3K14 A;  3CCU F;  1G9R A;  3SXA A;  3ZO8 A;  3WGM A;  1WT2 A;  1ZJ0 A;  1YJN F;  4I55 B;  4YJ3 B;  1S4N A;  1VZX A;  3SX5 A;  5MN5 A;  1S4O A;  3S0W A;  3RYH B;  1SS9 A;  1XRG A;  3JVH A;  3HJW C;  3NVK E;  4B62 A;  2FFU A;  2MZB A;  4P02 A;  1OAP A;  2X5S A;  1RQ7 A;  3LWQ C;  1Q82 H;  2RJ5 A;  3OH2 A;  5I1F A;  2W0V A;  4IRQ A;  1ODE A;  1ZI3 A;  2RIY A;  2VSI A;  1FNK A;  4JD0 A;  3KE1 A;  1MC3 A;  4FRM A;  2JCK A;  3ESJ A;  5FLX M;  4HNA B;  2KTU A;  1VQK F;  4HO9 A;  3OON A;  5IJ0 A;  3E22 A;  3F0D A;  1JY8 A;  1K73 H;  3E26 A;  4AC3 A;  5EAZ A;  4ZI7 B;  4Y7U A;  1R7Y A;  5CMI A;  4FFB B;  3QUW A;  4G4W A;  3JAK A;  3V7E A;  2WVK A;  2R75 1;  2YC3 A;  1IV4 A;  5C38 A;  4DEC A;  2YYE A;  4LNU A;  5EJ1 A;  4KWE A;  3V7Q A;  2OEF A;  3BRK X;  1FFX A;  4I50 B;  2V0L A;  1ZHJ A;  5LOV B;  2R6R 1;  4BVQ A;  4TUY A;  3D01 A;  1VQP F;  3CGX A;  2RJ6 A;  1H7F A;  5LYJ B;  1H4E A;  3VOA A;  2O1H A;  1CLI A;  2PMP A;  1TVY A;  5HP7 A;  3RMW A;  3V4D A;  1E5K A;  1YGY A;  4RHA A;  5HY1 A;  1Z90 A;  5J49 A;  4D11 A;  3QTY A;  5C4B A;  1JD1 A;  1HJL A;  3GYQ A;  3JAR A;  4KRV A;  2QTP A;  3F0G A;  3Q8H A;  4BVR A;  2ZU7 A;  1OQM B;  1TUB A;  1VK3 A;  2RJ1 A;  1U3P A;  2FC3 A;  1HM0 A;  2WVM A;  4X1K B;  4ZI7 A;  2CHS A;  3CC4 F;  5G4U C;  3PLA C;  5G4V C;  2DYY A;  3TD3 A;  3M84 A;  1VQO F;  4YS8 A;  3P0Z A;  5HY0 A;  1U40 A;  2AM3 A;  1W59 A;  2JNB A;  4BT7 A;  3FPI A;  2Y4J A;  1W77 A;  3JAM M;  1H5S C;  4EE4 A;  3IEW A;  1GQC A;  4Y64 A;  5EB0 A;  3IMP A;  4O4J A;  4DXD A;  1HJJ A;  4KC1 A;  2ZAU A;  3TQD A;  1OMX A;  5C36 A;  2ICY A;  4TUY B;  1VZT A;  3ZGG A;  2E3D A;  4JIS A;  3L7Q A;  5EIB C;  1FO8 A;  2K1S A;  1YQN A;  1GZ0 A;  2Z1F A;  3U0O A;  1XHB A;  1LVW A;  1VHA A;  3V0Q A;  4NAL A;  3CYP B;  3CCJ F;  1KQS F;  1NF5 B;  1W58 1;  3SPT A;  3RE3 A;  1FG5 N;  5CQL X;  1LZI A;  2FYA A;  2P6Y A;  5KMG B;  3K2X A;  3NK6 A;  4U3J A;  1TUB B;  1R81 A;  3CG6 A;  3WJP A;  3F1C A;  3N4Y A;  4ERH A;  4NAN A;  5MN4 A;  3RYF B;  5AJN A;  4DDZ A;  5IYZ A;  1KD1 H;  2DPW A;  4X1Y A;  1QWJ A;  1ZCV A;  1CN7 A;  2H6L A;  2ZU8 A;  5C4E A;  1UFY A;  3RYI B;  2QH5 A;  2WE9 A;  1SZQ A;  1Q86 H;  5IDS A;  1VGT A;  1H5T B;  1GA8 A;  2I7B A;  2PHN A;  1NMM B;  3CKO A;  4EE3 A;  4IHJ A;  1W2B F;  4HO8 A;  1E7K A;  3OC9 A;  2BO6 A;  4M2B A;  4F6R A;  3USQ A;  2Z1U A;  3I0H A;  3DUV A;  5J2U B;  4EI8 A;  3O3P A;  3CCL F;  3V0L A;  3S02 A;  4C8I A;  3JAS B;  2Y6P A;  4KPZ A;  5CQM X;  2KG4 A;  5C8Y B;  4BQH A;  3F0F A;  4LNU B;  1R1M A;  1ONI A;  1NWG B;  3SIU A;  1ZDF A;  1VQV A;  4G88 A;  3HAX D;  1ZJ2 A;  4HOC A;  2YQS A;  1RA4 A;  2QEX F;  2I5E A;  4FIY A;  4B3U A;  1FWY A;  2P72 A;  2CW4 A;  5CA0 A;  1ZJO A;  2V0K A;  3KIZ A;  3PAF A;  3I0I X;  3OBW A;  4G3P A;  3P10 A;  3UT5 B;  3G71 F;  3NVI B;  3OGZ A;  3T7M A;  1YP4 A;  1W55 A;  5LYJ A;  1V84 A;  2Y4M A;  3FD5 A;  3VIU A;  2Y4L A;  3ZLL A;  4Y63 A;  2QKX A;  5C48 A;  3WGJ A;  3RYC A;  1X52 A;  3NMU C;  2RHH A;  2FYB A;  2OZB A;  1ZIZ A;  1LL3 A;  4KXO A;  5C47 A;  1QVF F;  2Y7A A;  1CK2 A;  4IHJ B;  2VAP A;  3O85 A;  1JYL A;  1ZJ3 A;  4X20 B;  5GAN K;  1W5B A;  1TVK A;  5GON A;  4FRD A;  2BTU A;  4X1K A;  1H5R A;  4ASY A;  2HX0 A;  4X3L A;  2VAM A;  4I4T A;  1LZ0 A;  3JAL B;  3CCR F;  3C9U A;  3HKD A;  5JVD B;  3LDT A;  1FFX B;  4O4H A;  1VZU A;  4I50 A;  2YQJ A;  5LOV A;  4LCK A;  1YRO B;  1G1L A;  1ZI5 A;  2HP0 A;  3T7O A;  3ZLK A;  4EEG A;  3C9T A;  3D54 A;  3BCV A;  2RIT A;  1VPA A;  2IAF A;  4O4L B;  3CYQ A;  1TW1 A;  5C8R A;  5BXC A;  3DDN A;  5EZY B;  1JYK A;  5C49 A;  4R40 B;  5HWE A;  5CMG X;  5GIN C;  4Y7F A;  5HS2 A;  4KNR A;  5C4F A;  4NQ3 A;  1U3L A;  2BTO A;  2QGI A;  4EI7 A;  4MYB A;  5FJ4 C;  3MQW A;  3OH3 A;  5JCO A;  1RLU A;  2UYK A;  1KC8 H;  3NGW A;  2A8W A;  3LYB A;  3N2K B;  2AIF A;  4O4I B;  5GON B;  3VI6 A;  1SDS A;  1VH3 A;  1H5R B;  3N9W A;  5DDV A;  1VIC A;  2PGV A;  1ZDG A;  4FRO A;  1VGU A;  2FYD B;  1PF5 A;  4I4T B;  3M1X A;  5HY2 A;  3R0P A;  4BY9 D;  4E6E A;  1JVD A;  4O6M A;  3VO8 A;  5FTS A;  2VGM A;  3RYI A;  3ZF8 A;  3IEQ A;  3WPX A;  4EI9 A;  3M4S A;  1V83 A;  2ZVY A;  3T7N A;  2ICX A;  4B2W A;  2HRU A;  4O2B A;  1FXO A;  2W0W A;  1ZCU A;  4D0T A;  4B45 A;  1NHE B;  3SXG A;  3T80 A;  3TZT A;  4O2A A;  1YJ9 F;  3OH4 A;  4J18 A;  4O4L A;  4G3Q A;  4CJB A;  5C3B A;  3V91 A;  1T0K B;  4ARW A;  3JAK B;  3JAS A;  1FZW A;  2YQH A;  5C8Y A;  2RJ7 A;  2FYC B;  1SA0 B;  2N48 A;  4ZHW A;  3CXC F;  1S72 F;  3HL3 A;  3HTN A;  2VD4 A;  5KMG A;  4ZOL B;  2GVI A;  3IR9 A;  2ZOV A;  4BMA A;  5CB4 A;  5FTV A;  5HXU A;  2ZU9 A;  4CJ8 A;  3V90 A;  4M2A A;  3JCM M;  3Q80 A;  1YI2 F;  4AYJ A;  4HO4 A;  5CA1 A;  3U2T A;  2OI5 A;  1H4D A;  3I0G A;  3RYC B;  2AM5 A;  3RMV A;  5EIY A;  1H5T A;  4BT4 A;  4Q7C A;  4HO5 A;  1VQL F;  1YP2 A;  3K12 A;  3JUK A;  4X20 A;  4O2A B;  3WJQ A;  1FGG A;  2HS3 A;  5CQN X;  1UI9 A;  2H8E A;  1X25 A;  2ZVZ A;  1JN1 A;  3D98 A;  3PKQ A;  5C1G A;  5C3A A;  4D11 C;  3DC2 A;  3ZP4 A;  2AE7 A;  2I6D A;  2LBX A;  4DRX B;  3E25 A;  5AJO A;  3QHD A;  5JVD A;  2O1G A;  1NMU B;  3C8L A;  1Z5W A;  4KC2 A;  2JCO A;  3CPW F;  3U2U A;  5C4C A;  1K8A H;  1FR9 A;  1I52 A;  3S0Y A;  2I5K A;  5FUH A;  1O7Q A;  3SXE A;  4D48 A;  1VGZ A;  3V0M A;  2AMT A;  3J80 M;  2Q1Y A;  1EYR A;  1LZJ A;  3WXM B;  1Q81 H;  2CSL A;  1H7Q A;  3U2V A;  1H3M A;  4HG6 A;  4AYL A;  3JAW B;  1MP4 A;  3F1Y A;  1RLG A;  1QU9 A;  2KGW A;  2V0J A;  2GZL A;  1GX0 A;  5GIP C;  1FR8 A;  2CVL A;  1NQI B;  1ON6 A;  4ZHV A;  3LWO C;  2HVY D;  2YQC A;  1DBF A;  3I0E A;  2UX8 A;  4O6N A;  4B42 A;  1IPA A;  4U3J B;  2HRY A;  1WT1 A;  1KNJ A;  5FYE A;  2RHJ A;  2VGN A;  5FNV A;  1TVK B;  2HQS C;  3J7A R;  1MP3 A;  3RYF A;  1WT0 A;  2P6W A;  2RJ4 A;  3WGK A;  3S03 A;  3ERN A;  4X1Y B;  3V0O A;  1PZY B;  3SX8 A;  2HP3 A;  3FBA A;  1G95 A;  3HKD B;  5AJP A;  4O4H B;  4DRX A;  4TZZ A;  3VOB A;  1M90 H;  2IG8 A;  1ZCY A;  1K9M H;  3OAM A;  3C9R A;  4MND A;  1NQ3 A;  3POL A;  4O2B B;  2LCA A;  3CKJ A;  3I0D A;  1IV2 A;  4X3M A;  5J2U A;  1PXW A;  1H5S A;  3I0L A;  3PKP A;  5L6S A;  4X1I A;  2VSH A;  2Z01 A;  1ZCT A;  4ZK7 A;  5EZY A;  2RJ0 A;  3CMA F;  2PX7 A;  3OH0 A;  3KJJ A;  4FRH A;  3HKC A;  5LP6 A;  3JTJ A;  3WGL A;  4M8I A;  3R3I A;  2P73 A;  5C1H A;  3N4Z A;  4BT5 A;  1INI A;  1GX4 A;  3U0X A;  4B5C A;  4IIJ B;  2JCJ A;  2NXV A;  2X65 A;  1FNJ A;  4IRP A;  3R2W A;  3I0J A;  4TV9 B;  5CA0 B;  4FRB A;  4FRP A;  1VQ9 F;  5D92 A;  5KX5 A;  3MCA B;  1R7T A;  1JVG A;  4Y7V A;  1JJ2 F;  3LME A;  2W8B C;  3Q7U A;  2V0I A;  3OW2 F;  4Y62 A;  5DCV A;  2VS4 A;  1HM8 A;  3S06 A;  2OTM A;  1O7O A;  3E20 B;  5CQO A;  5C4D A;  1OFU A;  5L6V A;  2UYN A;  2XWN A;  4XWI A;  3GTZ A;  4Y6U A;  2CU2 A;  3D8V A;  3DJ4 A;  1IIN A;  2RHL A;  1H7M A;  4B4M A;  5JQG A;  4XCQ A;  2AM4 A;  2AGD A;  4X1I B;  5HY4 A;  1SA0 A;  1R7X A;  3JUJ A;  4LW3 A;  2JCL A;  4BT3 A;  3ZP7 A;  1LL2 A;  1ZJP A;  2BO8 A;  1W40 A;  2I6R A;  4G4Z A;  3IOH A;  3GHZ A;  4IIJ A;  3SXC A;  1YJW F;  2HP0 B;  2BTQ B;  2Z1T A;  1M1K H;  2OHW A;  5KX5 B;  2ZF8 A;  3C9S A;  3IOJ A;  1XZ6 A;  1QGS A;  5EJZ A;  1H4C A;  1FSZ A;  5HP8 A;  3OBY A;  1VQ6 F;  3BYQ A;  2UYJ A;  2YC5 A;  1W57 A;  2VS5 A;  2L26 A;  2WAL A;  3VYT C;  3FOQ A;  4B46 A;  2UYP A;  1WSZ A;  3FD6 A;  2X60 A;  2C0N A;  4L41 C;  1K4V A;  4UEG A;  3D00 A;  1IV1 A;  3LWR C;  1VGW A;  4FCU A;  4KC4 A;  2DT4 A;  1IIM A;  3N2K A;  4O4I A;  1VQ8 F;  5JQG B;  3HKE B;  5EYP B;  4KPX A;  5FU0 A;  2OI6 A;  3MCQ A;  1QD9 A;  3IOI A;  1GWW A;  4G87 A;  4AAW A;  3IKE A;  3G4S F;  4FRA A;  3SX7 A;  1YHQ F;  4ZHQ B;  3ZGF A;  3JAT B;  5EWR A;  5CQP A;  2D0J A;  4P00 A;  3ELC A;  3RA5 A;  3WJR A;  3G6E F;  1YIJ F;  4C82 A;  4DE7 A;  1NKH B;  3FFM A;  1H5S B;  1XV2 A;  1WVC A;  4U39 A;  1IV3 A;  1W5A A;  2ZOD A;  2RIX A;  4HO6 A;  4HO3 A;  3JAW A;  4LW6 A;  4TV8 A;  4EEO A;  3HKC B;  1JFF B;  5LP6 B;  1J7H A;  2D7I A;  3PNN A;  1GO0 A;  1G23 A;  2XME A;  5EB1 B;  4EEM A;  3CD6 F;  4ZOL A;  2MQE A;  3WPW A;  2Z1E A;  1OMZ A;  3CKV A;  1QVG F;  4Y7G A;  5CB4 B;  3U0Y A;  3U2X A;  4B4B A;  2F9Z C;  2RJ8 A;  1H7H A;  3LWV C;  1W41 A;  1NJI H;  1PZT A;  1H7L A;  2X5Z A;  5HXZ A;  1VH1 A;  2E8B A;  5CA1 B;  3V8Z A;  3P4E A;  1H5S D;  4MIX A;  3HKB B;  3JAT A;  4EE5 A;  2UYN B;  1R82 A;  2WGZ A;  5FU8 A;  1ON8 A;  3HWU A;  3VMF B;  2V0H A;  3K8E A;  1VH8 A;  5IJ0 B;  2RIZ A;  4M4K A;  4FCE A;  3RSB A;  4EEA A;  5FV9 A;  2V9Y A;  2VXM A;  5IFY A;  1WT3 A;  4B4G A;  1H48 A;  2LBW A;  1FXJ A;  4ZHY B;  3MBM A;  2AIZ P;  1W5E A;  2AEC A;  4WBN B;  4YJ2 A;  3F0E A;  4CJC A;  4BT6 A;  1G2V A;  3USR A;  4TV9 A;  4NWO B;  1W3E X;  1Q8R A;  2CHT A;  4ECM A;  3I56 F;  5DDT A;  4KT7 A;  4ZDQ A;  4GBP A;  5JH7 B;  3V0N A;  1G8O A;  1H47 A;  3E1Y A;  3KHN A;  3V3T A;  1FO9 A;  2PGY A;  5EIB D;  2OI7 A;  2VAW A;  2HS4 A;  3K8D A;  3CCQ F;  5LA6 A;  5GAP K;  2FY7 A;  3JAR B;  5IDT A;  3FWW A;  2OTL F;  5B8F A;  5JQQ A;  5FNV B;  1JV3 A;  2Q4J A;  3I0F A;  4BVT A;  2G9I A;  1GX1 A;  3HKE A;  2KTV A;  5IT9 M;  3CPQ A;  1VQN F;  3N2G A;  1GO1 A;  2WEE A;  3VTI C;  1INJ A;  2VK9 A;  3MDO A;  5IJ9 A;  2CZW A;  4R7P A;  2QA4 F;  4HNA A; 
#chains in the Genus database with same CATH homology
 1O23 B;  1FRW A;  1GQ9 A;  3V8Y A;  1QG8 A;  1QGQ A;  5C1L A;  1YP3 A;  2Z87 A;  4E1K A;  1ZI4 A;  5CMH A;  1VM8 A;  3Q4S A;  1H7T A;  3D5N A;  4FRE A;  4HO5 A;  2A8U A;  4D0T A;  2FFV A;  3B6N A;  1HM9 A;  2VS3 A;  1H7E A;  4NAK A;  4B5B A;  4FRQ A;  4HCQ A;  4C8G A;  1KWS A;  4C81 A;  2YES A;  2BO4 A;  1LZ7 A;  4HO0 A;  3DK5 A;  5CMF X;  1G0R A;  2XWM A;  1MP5 A;  4Y6N A;  1H7G A;  2XWL A;  1GWV A;  2OEG A;  5D91 A;  4K6R A;  4C8E A;  4CVH A;  1G3L A;  2VXL A;  2XMH A;  4M28 A;  4B2X A;  5JQQ A;  4ASJ A;  1JV1 A;  2APC A;  2Z86 A;  3OH1 A;  1ZJ1 A;  3CU0 A;  2J0B A;  1ZI1 A;  3I0C A;  4NAI A;  3U2W A;  3GUE A;  4EVW A;  1G97 A;  4Y7T A;  3EE5 A;  1U43 A;  3CKN A;  2YCM A;  3SXB A;  2Y4K A;  4KNX A;  3I0K A;  1KNK A;  1T0A A;  4FRL A;  2RJ9 A;  3ST8 A;  1S4P A;  2WAW A;  2O1F A;  3SXD A;  1LL0 A;  2AH9 A;  2WVL A;  2AES A;  1O0R A;  3CKQ A;  3IKF A;  1R80 A;  1TZF A;  3KIA A;  4G3S A;  4C2S A;  1G93 A;  3QVB A;  3F6M A;  2PA4 A;  1V82 A;  3OH0 A;  2VFZ A;  1TW5 A;  2D7R A;  5CMJ A;  3OKR A;  3EOR A;  1FGX A;  4HO2 A;  2UZH A;  3V0P A;  2GGQ A;  1R7U A;  2J0A A;  2GGO A;  4KQL A;  2BO7 A;  3LW6 A;  1FOA A;  4FIX A;  1HV9 A;  1R7V A;  4D0Z A;  4Y9X A;  1EZI A;  3SX3 A;  4FQW A;  3K14 A;  1G9R A;  3SXA A;  1WT2 A;  1ZJ0 A;  1S4N A;  1VZX A;  3SX5 A;  1S4O A;  1SS9 A;  3JVH A;  2MZB A;  2FFU A;  4P02 A;  2X5S A;  2RJ5 A;  3OH2 A;  5I1F A;  2W0V A;  4IRQ A;  1ZI3 A;  2VSI A;  2RIY A;  4JD0 A;  3KE1 A;  1MC3 A;  4FRM A;  2JCK A;  3ESJ A;  4HO9 A;  3F0D A;  3E26 A;  1JY8 A;  4AC3 A;  4Y7U A;  1R7Y A;  5CMI A;  2WVK A;  2YC3 A;  1IV4 A;  5C38 A;  4DEC A;  5EJ1 A;  2OEF A;  3BRK X;  2V0L A;  1ZHJ A;  3CGX A;  2RJ6 A;  1H7F A;  1H4E A;  2O1H A;  2PMP A;  1TVY A;  3RMW A;  1E5K A;  1Z90 A;  5J49 A;  4D11 A;  5C4B A;  1HJL A;  4KRV A;  3F0G A;  3Q8H A;  2ZU7 A;  1OQM B;  2RJ1 A;  1U3P A;  1HM0 A;  2WVM A;  4YS8 A;  3P0Z A;  1U40 A;  2AM3 A;  2Y4J A;  3FPI A;  4EE4 A;  1W77 A;  1H5S C;  3IEW A;  1GQC A;  4Y64 A;  1HJJ A;  5C36 A;  4KC1 A;  1OMX A;  2ICY A;  1VZT A;  3ZGG A;  2E3D A;  4JIS A;  1FO8 A;  1YQN A;  1XHB A;  1LVW A;  1VHA A;  3V0Q A;  4NAL A;  1NF5 B;  3RE3 A;  1FG5 N;  5CQL X;  1LZI A;  2FYA A;  3K2X A;  1R81 A;  3F1C A;  4NAN A;  5AJN A;  4DDZ A;  2DPW A;  1QWJ A;  1ZCV A;  2ZU8 A;  5C4E A;  2QH5 A;  2WE9 A;  5IDS A;  1VGT A;  1H5T B;  1GA8 A;  2I7B A;  1NMM B;  3CKO A;  4EE3 A;  4M2B A;  4HO8 A;  3OC9 A;  2BO6 A;  3USQ A;  3I0H A;  3DUV A;  3O3P A;  3V0L A;  4C8I A;  2Y6P A;  4KPZ A;  5CQM X;  4BQH A;  3F0F A;  1NWG B;  1ZDF A;  1ZJ2 A;  4HOC A;  2YQS A;  4FIY A;  2I5E A;  4B3U A;  1FWY A;  2P72 A;  2V0K A;  1ZJO A;  3I0I X;  4G3P A;  3P10 A;  3OGZ A;  3T7M A;  1YP4 A;  1W55 A;  1V84 A;  2Y4M A;  2Y4L A;  3ZLL A;  4Y63 A;  2QKX A;  2FYB A;  1ZIZ A;  1LL3 A;  4KXO A;  5C47 A;  2Y7A A;  1JYL A;  1ZJ3 A;  4FRD A;  1H5R A;  4ASY A;  1LZ0 A;  1VZU A;  2YQJ A;  3T7O A;  4EEG A;  1YRO B;  1G1L A;  1ZI5 A;  3BCV A;  2RIT A;  1VPA A;  1TW1 A;  5C8R A;  5BXC A;  1JYK A;  5C49 A;  5CMG X;  4Y7F A;  5HS2 A;  4KNR A;  5C4F A;  1U3L A;  2QGI A;  4MYB A;  3OH3 A;  3NGW A;  2A8W A;  5C48 A;  5DDV A;  3N9W A;  1VH3 A;  1H5R B;  1VIC A;  2PGV A;  1ZDG A;  4FRO A;  1VGU A;  2FYD B;  5FTS A;  1JVD A;  4O6M A;  3ZF8 A;  3IEQ A;  1V83 A;  3T7N A;  2ICX A;  4B2W A;  1FXO A;  2W0W A;  1ZCU A;  1NHE B;  3SXG A;  3T80 A;  3TZT A;  3OH4 A;  4J18 A;  4G3Q A;  4CJB A;  5C3B A;  3V91 A;  4ARW A;  1FZW A;  2YQH A;  2RJ7 A;  2FYC B;  3HL3 A;  2VD4 A;  4BMA A;  4CJ8 A;  5FTV A;  2ZU9 A;  3V90 A;  4M2A A;  3Q80 A;  4AYJ A;  4HO4 A;  3U2T A;  2OI5 A;  1H4D A;  3I0G A;  2AM5 A;  3RMV A;  5EIY A;  1H5T A;  4Q7C A;  1YP2 A;  3JUK A;  1FGG A;  5CQN X;  3D98 A;  5C1G A;  3PKQ A;  5C3A A;  3ZLK A;  4D11 C;  5C3D A;  2AE7 A;  5AJO A;  3E25 A;  3QHD A;  2O1G A;  4KC2 A;  2JCO A;  3U2U A;  5C4C A;  1FR9 A;  1I52 A;  2I5K A;  5FUH A;  1O7Q A;  4D48 A;  1VGZ A;  3V0M A;  2AMT A;  1EYR A;  1LZJ A;  3U2V A;  1H7Q A;  1H3M A;  4AYL A;  1MP4 A;  3F1Y A;  2V0J A;  2GZL A;  1GX0 A;  1ON6 A;  1FR8 A;  2YQC A;  1NQI B;  3I0E A;  4O6N A;  2UX8 A;  4B42 A;  1WT1 A;  1KNJ A;  5FYE A;  1MP3 A;  2RJ4 A;  2P6W A;  1WT0 A;  3ERN A;  3V0O A;  1PZY B;  3SX8 A;  1G95 A;  3FBA A;  5AJP A;  1ZCY A;  3OAM A;  4MND A;  3POL A;  3CKJ A;  3I0D A;  1IV2 A;  3I0L A;  5L6S A;  1H5S A;  3PKP A;  2VSH A;  1ZCT A;  2RJ0 A;  2PX7 A;  4FRH A;  4HG6 A;  5C1H A;  3JTJ A;  3SPT A;  3USR A;  3R3I A;  2P73 A;  3U0X A;  1INI A;  1GX4 A;  2JCJ A;  2NXV A;  2X65 A;  4IRP A;  3R2W A;  3I0J A;  4FRP A;  4FRB A;  5D92 A;  1R7T A;  1JVG A;  4Y7V A;  3Q7U A;  2V0I A;  4Y62 A;  2VS4 A;  1HM8 A;  1O7O A;  5CQO A;  5C4D A;  5L6V A;  2XWN A;  4XWI A;  4Y6U A;  2CU2 A;  3D8V A;  3DJ4 A;  1IIN A;  4B4M A;  2AM4 A;  2AGD A;  1R7X A;  3JUJ A;  4LW3 A;  2JCL A;  4EEA A;  2BO8 A;  1LL2 A;  1ZJP A;  3SXC A;  3IOH A;  3GHZ A;  3IOJ A;  1XZ6 A;  5EJZ A;  1H4C A;  2YC5 A;  1W57 A;  2VS5 A;  3FOQ A;  3SXE A;  1WSZ A;  4L41 C;  2X60 A;  2C0N A;  4UEG A;  1K4V A;  3TQD A;  1IV1 A;  1VGW A;  4FCU A;  4KC4 A;  1IIM A;  4KPX A;  5FU0 A;  2OI6 A;  3IOI A;  1GWW A;  4G87 A;  4AAW A;  3IKE A;  4FRA A;  3SX7 A;  3ZGF A;  5CQP A;  2D0J A;  4P00 A;  3ELC A;  4C82 A;  4DE7 A;  1NKH B;  1H5S B;  1WVC A;  1IV3 A;  4LW6 A;  2RIX A;  4HO6 A;  4HO3 A;  4EEO A;  2D7I A;  3PNN A;  1G23 A;  2XME A;  4EEM A;  3CKV A;  1OMZ A;  3U2X A;  4Y7G A;  4B4B A;  3U0Y A;  2RJ8 A;  1H7H A;  1PZT A;  1H7L A;  2X5Z A;  1VH1 A;  2E8B A;  3V8Z A;  1H5S D;  4MIX A;  4EE5 A;  1R82 A;  2WGZ A;  5FU8 A;  1ON8 A;  2V0H A;  3K8E A;  1VH8 A;  2RIZ A;  4M4K A;  4FCE A;  3RSB A;  5FV9 A;  5IFY A;  2VXM A;  1WT3 A;  4B4G A;  1H48 A;  1FXJ A;  3MBM A;  2AEC A;  3F0E A;  4CJC A;  1G2V A;  4ECM A;  5DDT A;  4KT7 A;  4ZDQ A;  4GBP A;  3V0N A;  1G8O A;  1H47 A;  1FO9 A;  2PGY A;  3K8D A;  2OI7 A;  2FY7 A;  5IDT A;  3FWW A;  5B8F A;  1JV3 A;  2Q4J A;  3I0F A;  1GX1 A;  2WEE A;  1INJ A;  2VK9 A;  1JN1 A;  1QGS A;  4R7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...