1W57A

Structure of the bifunctional ispdf from campylobacter jejuni containing zn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
EMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
total genus 106
structure length 368
sequence length 368
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w57A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w57A01
2OI7A 5EIYA 2D0JA 1FWYA 1WT1A 3F0DA 3IOJA 2BO4A 4FRAA 4CJCA 4D0TA 2VS3A 1VH3A 3I0EA 2P6WA 1G8OA 5C47A 1LZIA 1LZ0A 4E1KA 4B4MA 3OH1A 1GWVA 3USRA 3FWWA 1JVGA 2FYCB 3Q8HA 4NANA 4Y64A 4Y62A 2YC5A 1NMMB 4NAKA 1VZTA 5J49A 3PKPA 2PA4A 1H5SA 1HM9A 3OH2A 5C1HA 4C82A 3SX8A 4B3UA 4ASJA 1G93A 1FR8A 3V90A 1JV1A 3I0DA 2X65A 5CMGX 4MYBA 4AAWA 1LL3A 2Y4LA 3F1CA 1FOAA 1IINA 3I0JA 2VS5A 3PKQA 1WT0A 3ZLLA 4Y7FA 5C3BA 1ZCTA 3JUJA 1VZXA 4C8EA 3FBAA 3MBMA 1G9RA 2GGOA 2BO7A 3KE1A 4FROA 2X5ZA 2X60A 3F1YA 3OH0A 3SXCA 4HO4A 3RMVA 2I7BA 1ZDGA 4HO5A 3SXEA 2V0KA 1H7FA 1NKHB 1KNJA 4J18A 5CQPA 4Y7GA 3T7MA 2WVMA 1NF5B 2AH9A 3CKQA 2I5EA 1H5SB 3K8DA 3O3PA 1JN1A 4KPZA 1R7UA 1QWJA 3HL3A 3ELCA 3N9WA 4DECA 2WVLA 1IV1A 2YESA 2OEGA 2APCA 4B5BA 2ICYA 1EYRA 3ZGFA 5BXCA 1ZHJA 3DK5A 4D0ZA 1FGXA 1H3MA 2QKXA 1VPAA 2Y4MA 5AJNA 1FG5N 4NAIA 4B42A 4M4KA 1TZFA 1FXOA 1NQIB 5C8RA 3CGXA 2WGZA 4ARWA 5I1FA 2JCLA 3JTJA 1S4NA 4XWIA 4EEMA 1IV2A 2FFUA 2FY7A 2Q4JA 4KC1A 2AM3A 2RIZA 4B2XA 1MP3A 1ZCUA 1LZJA 2V0LA 1INIA 1TVYA 1YQNA 1GX1A 2JCOA 3IOHA 3V91A 4DE7A 4ASYA 2OI6A 1VGZA 2XMHA 1VH8A 1U3PA 1H48A 5C1GA 4KNXA 4EEAA 3R3IA 1ZI5A 1H4CA 4G3PA 2O1FA 4FRDA 4D48A 5FTVA 1YP4A 1IIMA 4Y7TA 4K6RA 3V0QA 4M2BA 1GX4A 3U2UA 3EE5A 3ZLKA 5EJZA 3B6NA 2RJ5A 3Q7UA 2ZU7A 1VM8A 2O1GA 5C36A 2ICXA 5AJOA 3R2WA 4B2WA 1QG8A 4EE3A 4G87A 5C4DA 1H7EA 2JCKA 4Y63A 1QGQA 5B8FA 2FYDB 3U2TA 4C8IA 4HO9A 1H47A 3E25A 4D11A 2VXLA 3V0PA 1R82A 4LW3A 1R7TA 1G23A 2RJ4A 5CQMX 1KNKA 4KT7A 1ZJOA 4HO2A 1ZCVA 1GWWA 2O1HA 3CKVA 4HOCA 4C2SA 1V84A 1PZYB 5C4FA 4MNDA 1O0RA 4LW6A 1JYLA 1WSZA 1ZI4A 1LL0A 4FCUA 2Y4JA 3D98A 2RJ6A 4C81A 2WEEA 3I0GA 2ZU8A 2AM5A 1OQMB 2AESA 5HS2A 1JY8A 4FREA 2V0HA 1R80A 1VICA 2AECA 3POLA 3I0KA 1NWGB 1O23B 3OKRA 2PGVA 1XHBA 2QGIA 3BCVA 1JV3A 5FU0A 2PMPA 2RJ8A 3F0EA 1OMZA 1HJJA 3T7NA 3V0NA 4HCQA 5C4EA 5L6VA 2YQJA 3CU0A 3T80A 1H5TA 3JUKA 1V83A 1ON6A 5C3AA 4HO0A 2FFVA 4NALA 5CQLX 4HO6A 4EVWA 3ST8A 1HJLA 1QGSA 1T0AA 2A8WA 5CMIA 1W77A 3SX7A 2AMTA 1YP3A 4FRQA 3OAMA 4KNRA 1G97A 1WT3A 1H7LA 4KRVA 1ON8A 2AGDA 1ZDFA 4FRHA 5C48A 1U43A 2AM4A 1KWSA 2Z86A 1NHEB 3IEWA 4BQHA 1IV4A 1FR9A 1G0RA 5C4BA 1H5SD 2Z87A 2YC3A 5DDTA 4AYJA 1FRWA 5IDSA 2FYAA 2RIXA 1HV9A 1H5SC 1H5TB 2XMEA 1MP5A 4B4GA 1IV3A 3Q4SA 5JQQA 1K4VA 2GGQA 3F0FA 3TZTA 1ZCYA 4Y6NA 1FO8A 2VD4A 1W57A 3IOIA 4P00A 3P0ZA 2MZBA 4Y9XA 2AE7A 1ZJ0A 3D5NA 1S4OA 1JYKA 3OGZA 1HM8A 1TW1A 3QVBA 4AC3A 4EE4A 2BO8A 1Z90A 2OI5A 5CQNX 2RJ1A 3F0GA 4KC2A 3BRKX 3V0MA 5EJ1A 3PNNA 4KC4A 1VGWA 2CU2A 3SXAA 3K14A 1H4EA 2VFZA 3JVHA 4IRPA 3I0LA 4KXOA 4YS8A 3IKFA 2YQCA 1GQCA 1H5RA 1R7YA 3CKNA 3SPTA 1G3LA 2A8UA 1W55A 5L6SA 3U0XA 5CMJA 2ZU9A 2E3DA 2QH5A 1VZUA 1WT2A 3CKOA 1LVWA 1JVDA 3D8VA 1LL2A 5DDVA 3DJ4A 2RJ9A 4FRBA 2DPWA 3OC9A 2XWNA 2Y4KA 1H7QA 1ZI1A 3RE3A 2VS4A 1U3LA 4M2AA 1FO9A 4KPXA 3V0LA 1R7VA 1XZ6A 2VSHA 4BMAA 4L41C 1SS9A 2D7IA 2BO6A 3USQA 3GHZA 2UX8A 1GA8A 3DUVA 1H5RB 3U2WA 3SXGA 4CJ8A 4Y7VA 1ZIZA 2OEFA 2NXVA 3IEQA 2V0JA 4Y7UA 1YROB 4IRQA 2X5SA 2PX7A 3CKJA 5FYEA 1H4DA 4UEGA 4G3QA 2XWMA 2P72A 2D7RA 3SXBA 5AJPA 1E5KA 4HO3A 2UZHA 4FRPA 1R7XA 3OH4A 2WVKA 4D11C 4CVHA 1MP4A 4R7PA 1H7HA 3ERNA 1FGGA 4HO8A 3SX3A 2PGYA 3OH3A 5IFYA 3EORA 1V82A 4ECMA 1O7OA 3I0HA 5CMFX 2W0WA 3I0FA 2RJ0A 3ESJA 3U2VA 1H7TA 3KIAA 4EE5A 1S4PA 1FZWA 3IKEA 3I0CA 4Y6UA 1INJA 1EZIA 4EEOA 2W0VA 4FRLA 4CJBA 3K2XA 4JISA 5FV9A 3QHDA 1G1LA 1ZJPA 3V8ZA 4M28A 3FPIA 1GQ9A 5CMHA 3RSBA 2VSIA 2GZLA 1LZ7A 1YP2A 4P02A 5C4CA 1ZJ1A 4G3SA 3LW6A 2P73A 1R81A 5C1LA 1ZJ2A 5FTSA 2WAWA 1FXJA 1ZJ3A 1G2VA 5FU8A 4EEGA 4FCEA 4GBPA 2WE9A 2Y6PA 3RMWA 4ZDQA 1TW5A 2JCJA 1OMXA 1WVCA 3ZGGA 1VGTA 4DDZA 3TQDA 1VH1A 1VGUA 1ZI3A 5FUHA 5C38A 5CQOA 3ZF8A 2I5KA 1GX0A 4AYLA 4C8GA 1O7QA 3FOQA 4JD0A 2V0IA 3GUEA 1H7GA 2FYBA 2E8BA 4B4BA 3I0IX 1PZTA 4HG6A 3T7OA 5C49A 3V0OA 4KQLA 2XWLA 2YCMA 3Q80A 1MC3A 3V8YA 3P10A 2RIYA 4FRMA 2RITA 1HM0A 3SX5A 4FQWA 3U0YA 2RJ7A 3SXDA 2Y7AA 2YQHA 3K8EA 3U2XA 2VXMA 1G95A 3F6MA 1VHAA 1U40A 2YQSA 5IDTA 3E26A 5C3DA 1I52A 3NGWA
chains in the Genus database with same CATH superfamily
3NMUC 5EIYA 3CC4F 1WT1A 2BO4A 4FRAA 2Q1XA 4ZI7B 4X1KB 1TVKB 1W41A 4TZZA 1G8OA 2B33A 3OH1A 3USRA 4Y64A 3DDNA 2ZAUA 1QD9A 3OH2A 4C82A 1QVGF 4B3UA 4ASJA 1G93A 3V90A 3I0DA 2UYPA 1IINA 3I0JA 2VS5A 1OAPA 3CCQF 4C8EA 3RA5A 2LBTA 3RMVA 1ZDGA 3SXEA 4O4LA 1KNJA 4J18A 5CQPA 3LFOA 3CKQA 2I5EA 3O3PA 4KPZA 1IV1A 3ZGFA 2ZF8A 5GANK 4B42A 1NQIB 5C8RA 4ARWA 5I1FA 3JTJA 4XWIA 1CN7A 2FFUA 4FIXA 2AM3A 2RIZA 4O4LB 4DE7A 2OI6A 3CCEF 5C1GA 4EEAA 3R3IA 1H4CA 1YITF 2O1FA 4ZHQA 4FRDA 5MN5A 4D48A 5HY1A 4Y7TA 3E1YA 5FJ4C 2ALEA 3KJKA 3U2UA 3EE5A 2QA4F 4DXDA 2RJ5A 5EWRA 2ZU7A 5C36A 2ICXA 5AJOA 1QG8A 3VYSC 1QGQA 2FYDB 3IR9A 3SIVA 2VXLA 2RJ4A 1ZJOA 5LYJA 4WBNA 4ZHQB 1ZCVA 1GWWA 3CKVA 4C2SA 3RA6A 2HS4A 1O0RA 1JYLA 1CK2A 3CC2F 2P6YA 3D98A 2RJ6A 2WEEA 4FREA 1R80A 4IIJA 3POLA 3K0TA 1XHBA 3BCVA 1JV3A 2R6R1 2PMPA 3V0NA 4HCQA 2YQJA 3T80A 1H5TA 5LYJB 1KQSF 1V83A 4WBNB 2FFVA 5CQLX 4F6RA 5CMIA 4KNRA 3G4SF 1ON8A 2QI2A 4BT4A 5C48A 2AM4A 4IIJB 2HRUA 4BQHA 3CG6A 2YC3A 4AYJA 1FRWA 5IDSA 5J2UA 2KTUA 1H5SC 4DRXA 1H5TB 2XMEA 1M1KH 1CLIA 4O6MA 1MP5A 3HKDA 3HWUA 3CMAF 1YJNF 3Q4SA 2IAFA 4F6RB 5GINC 1GO1A 3WJPA 3TZTA 3CB2A 1FO8A 2VAMA 4ZHYB 5C8YA 2HS3A 3P0ZA 1TUBA 3ZO8A 3D5NA 2FGYA 3FFMA 4AC3A 4EE4A 3N2KA 1FSZA 4ZHVA 5J2UB 4DRXB 1VGWA 2CU2A 4KC4A 1H4EA 2VFZA 3JVHA 3RYIA 3I0LA 5FNVA 2V9YA 3HKDB 4G88A 5L6SA 1SZQA 3M4SA 4YJ2A 1WT2A 3CKOA 5C8YB 1W5BA 1J7HA 1TUBB 1VQLF 1X7OA 3N2KB 2VS4A 2FC3A 4G4ZA 3V0LA 4BMAA 1SS9A 3RYIB 5HXUA 5FNVB 2D7IA 2BO6A 3USQA 1E7KA 1GA8A 4LNUA 4Y7VA 3M1XA 2OEFA 2NXVA 2I6DA 4YJ2B 3LWQC 1ONIA 2PX7A 5IYZA 3E22A 2VK9A 3N2GA 3SXBA 4HO3A 1UI9A 1R7XA 3J7AR 1H7HA 3ERNA 3SX3A 3N4YA 3EORA 1V82A 1O7OA 5CMFX 4LNUB 4B62A 4PWTA 1H7TA 3IKEA 4Y6UA 1COMA 3D01A 5IYZB 4FRLA 4CJBA 4JISA 3L7QA 3QHDA 3E22B 4M28A 3FPIA 1GQ9A 3N2GB 5J2TA 2CZWA 2GZLA 1W5FA 3JALA 3HKCA 2Q1YA 4ZDQA 5JQGA 3ZGGA 4DDZA 2HS0A 1VH1A 1VGUA 1ZI3A 3VOBA 5CQOA 4JD0A 3VCZA 4BVRA 2OTJF 2FYBA 3T7OA 5J2TB 2YCMA 3Q80A 2LBXA 4O2AA 3J81M 3U0YA 3JALB 3HKEA 3HKCB 2VGNA 5JQGB 1U40A 2JNBA 5C3DA 1I52A 2HVYD 2OI7A 1FWYA 3S0WA 3V3TA 4B5CA 3O85A 3OBWA 3IOJA 4B45A 5CA0A 2P6WA 3NVIB 5C47A 1LZIA 4B4MA 3R0PA 3I55F 2FYCB 4O2AB 2YC5A 4NAKA 2PA4A 5C1HA 3SX8A 3HKEB 1Q7YH 1K73H 1JV1A 1Q86H 4MYBA 4ERHA 2Y4LA 4B46A 2Z01A 3JATA 3PKQA 4Y7FA 5C3BA 3JUJA 2KTVA 2RHLA 3FBAA 5IJ9A 1G9RA 5CA0B 2BO7A 2UYJA 4BT3A 2AIFA 3F1YA 3OH0A 3SXCA 4HO4A 2R751 2I7BA 3HKBA 1NKHB 1RLUA 3T7MA 5EAZA 3CYPB 3TD3A 3HL3A 3N9WA 2YESA 2ICYA 4D0ZA 3JATB 1FG5N 1SA0A 4M4KA 1JFFA 5IJ9B 1RQ2A 2WGZA 2AIZP 3MCQA 1S4NA 4EEMA 1IV2A 4KC1A 3HKBB 2Z1UA 4NUTA 1QU9A 2V0LA 1INIA 1TVYA 1GX1A 2JCOA 3LWOC 3S02A 1VGZA 3J80M 4G3PA 1K8AH 2OTMA 2DT4A 2BTUA 4RHAA 3WGKA 4FIYA 1YI2F 3B6NA 3S0HA 3Q7UA 1SA0B 1VM8A 1JFFB 3R2WA 5EB0A 4G87A 5C4DA 5G4VC 5B8FA 2RHOA 2H6LA 4HO9A 1H47A 1NQ3A 4D11A 3V0PA 1G23A 3OW2F 4KT7A 3CXCF 1KD1H 2ZVYA 3WPXA 5C4FA 3MDOA 3ZP4A 4LW6A 4NQ3A 4X3MA 2Y4JA 1KC8H 3WXMB 3I0GA 2J0AA 2ZU8A 1OQMB 2AESA 5HS2A 2CHSA 5JCOA 1RLGA 3MQWA 2YYEA 5FU0A 5IJ0A 1T0KB 1OMZA 5JVDA 1M90H 3T7NA 3KHNA 3GTZA 4HO6A 1T0AA 2A8WA 2AMTA 1YP3A 3C9RA 1G97A 1WT3A 2AGDA 3CPWF 5LA6A 2L26A 1U43A 2Z86A 3IEWA 4C4WC 5IJ0B 1VQ9F 1IV4A 5C4BA 4X3LA 1H5SD 5EIBD 3VYUC 2RIXA 4B4GA 1VQVA 1Z5VA 1NJIH 1IV3A 3WJQA 5LXTA 5AVMA 4X1YA 1GO0A 1W57A 2MZBA 2AE7A 1XRGA 5LA6B 1JYKA 1HM8A 1VK3A 1JD1A 4TV9A 3QVBA 3VYTC 3C9SA 3F0GA 3BRKX 3V0MA 5EJ1A 4ZK7A 3PNNA 3SXAA 4IRPA 3IKFA 3ON1A 1R7YA 5LXTB 3V4DA 1G3LA 3U0XA 5CMJA 4X1YB 2QH5A 4EI8A 3QTYA 1W42A 4FRBA 2WALA 4TV9B 2Y4KA 2H8EA 3RE3A 4O6NA 4M2AA 1JJ2F 4L41C 3SXGA 4CJ8A 1ZIZA 3WGNA 3PLAC 2V0JA 4Y7UA 3LYBA 2NMUA 1YROB 3CKJA 4G3QA 1DT9A 5AJPA 5EB1B 1UFYA 2WVKA 5HY2A 4R7PA 4I50A 5IFYA 4ECMA 3I0HA 1ODEA 2RJ0A 2RHJA 3JASA 4EE5A 5HY0A 1FZWA 3NVKE 1EZIA 5FV9A 1G1LA 3V8ZA 3IMPA 2VAPA 2K1SA 4P02A 1ZJ1A 3LW6A 4O4HA 1ZJ2A 3TD5A 4I50B 1TW5A 2JCJA 3JARA 1OMXA 3CCLF 3UT5A 3JASB 5C38A 2I5KA 5D92A 3HJWC 1H7GA 5DCVA 5FLXM 1W59A 4HG6A 2OZBA 3G71F 2XWLA 3MCAB 3C9TA 4O4HB 4FRMA 3M84A 3C9UA 3SX5A 4FQWA 5HP7A 4BW0B 3SXDA 2Y7AA 2YQHA 3JARB 1G95A 4X20A 3UT5B 5MN4A 1X7PA 2HQSC 4CJCA 4D0TA 2VS3A 1VH3A 3I0EA 3VTIC 2LBWA 1LZ0A 4E1KA 1GWVA 3Q8HA 1VQ8F 1NMMB 3K12A 1VZTA 5J49A 1H5SA 2ZODA 1FR8A 5CMGX 5JH7A 1PF5A 1FOAA 4X20B 4O4IA 3ZLLA 1XBIA 3KE1A 2N48A 1VQPF 4BT5A 5CB4A 4U39A 5KX5A 1NMUB 1H5SB 3K8DA 2MQEA 1R7UA 4DECA 2OEGA 4B5BA 5JH7B 5BXCA 1ZHJA 1VQMF 2QKXA 1VPAA 4O4IB 5AJNA 4BT6A 4BT7A 4NAIA 1TZFA 1FXOA 3CGXA 3TD4A 4ZHWA 3CD6F 2Q4JA 5CB4B 1LZJA 1W40A 3V91A 3QUWA 5KX5B 1U3PA 3I7TA 4KNXA 1XV2A 3I56F 4M8IA 2W8BC 1GX4A 4G4WA 3ZLKA 3LWPC 4LCKA 5EJZA 2KG4A 1S72F 2O1GA 4B2WA 1YIJF 3BYQA 4XCQA 2JCKA 3U2TA 4C8IA 1R82A 1R7TA 1W2BF 4HNAA 3CCSF 1W5EA 3LWRC 2O1HA 1W5AA 3JAMM 4HOCA 4EI7A 5HXZA 1ZI4A 1LL0A 4FCUA 4C81A 4BVSA 4R40B 1JY8A 2GLZA 1VICA 1QAHA 3VOAA 2AECA 3OKRA 2PGVA 3E20B 2J0BA 3JAKA 2RJ8A 3F0EA 2Z1TA 4BY9D 5L6VA 4HNAB 3JUKA 5G4UC 5C3AA 3GYQA 4NALA 3ST8A 1YGYA 1W77A 3SX7A 4FRQA 3CCRF 2CVLA 2HRYA 2VGMA 2UYKA 2DYYA 4FRHA 2F9ZC 3CYQA 1FR9A 1G0RA 3JAKB 2Z87A 5CA1A 4I4TA 5IT9M 4TV8A 1K4VA 1ZCYA 4Y6NA 2HX0A 4P00A 4Y9XA 3OONA 3OGZA 1TW1A 2BO8A 1Z90A 2OI5A 2RB9A 2Z1EA 2RJ1A 5CA1B 4I4TB 2VXYA 1X52A 1PXWA 4TV8B 3K14A 2YQCA 1GQCA 1H5RA 3SPTA 1W55A 5LP6A 2ZU9A 2HP0A 1VQOF 4U3JA 5EYPA 3D8VA 4BT2A 2H8CA 1LL2A 3DJ4A 2RJ9A 1YJ9F 2XWNA 5BMVA 3CC7F 1ZI1A 1U3LA 1SDSA 1FO9A 1XZ6A 2VSHA 3RYFA 3GHZA 2UX8A 3DUVA 3KIZA 1H5RB 5LP6B 2HP0B 4IRQA 2C0NA 4U3JB 3JAWA 5FYEA 1VQ4F 5EYPB 1VQ5F 4UEGA 2XWMA 5EO3A 2P72A 2CSLA 2D7RA 1E5KA 5EZYA 5BMVB 2I6RA 3OH4A 4CVHA 3VO8A 3WJRA 1FGGA 2PGYA 4G4XA 3OH3A 3RYFB 3I0FA 3FD5A 1S4PA 5JVDB 4EEOA 3JAWB 2W0VA 3RSBA 2VSIA 1YP2A 5EZYB 1LZ7A 3S0YA 5C4CA 2YXZA 3WPWA 5FTSA 1G2VA 4EEGA 1W581 3NK6A 4FCEA 2OHWA 4GBPA 2WE9A 1VQKF 3D00A 3KJJA 5FUHA 3ZF8A 1FNKA 4C8GA 4AYLA 1O7QA 3FOQA 3SIUA 2E8BA 3I0IX 3CPQA 4EI9A 5C49A 3V0OA 4KQLA 2RIYA 3FD6A 1HM0A 4G4VA 3K8EA 3F6MA 1VHAA 4MIXA 2YQSA 3V7QA 2D0JA 3F0DA 3CCVF 3RYCA 4E6EA 2LCAA 1IPAA 2GVIA 1FNJA 3CCMF 3FWWA 1JVGA 3LWVC 4NANA 1H7MA 4Y62A 1Q8RA 3PKPA 1HM9A 5GIOC 5GAPK 3WGMA 2X65A 4AAWA 1LL3A 3F1CA 2ZOVA 1WT0A 1ZCTA 1VZXA 3MBMA 3RYCB 2GGOA 4FROA 4RQOA 2X5ZA 2X60A 3LMEA 3C8LA 5KMGA 4HO5A 3CMEF 1H7FA 4IHJA 2V0KA 4Y7GA 2WVMA 1NF5B 2AH9A 1JN1A 1QWJA 3ELCA 2WVLA 2APCA 1GZ0A 1YHQF 1K9MH 1EYRA 3DK5A 1FGXA 1H3MA 2BTOA 2Y4MA 2JCLA 5EIBC 1Q81H 1RA4A 2IG8A 2FY7A 5KMGB 4IHJB 1VQNF 4B2XA 4I55A 1MP3A 1ZCUA 5A2QM 1YQNA 3VI6A 3IOHA 3V7EA 2Z1FA 4ASYA 2XMHA 1VH8A 1H48A 1ZI5A 5GONA 2QEXF 5FTVA 1YP4A 1IIMA 4K6RA 3V0QA 4M2BA 4NWOB 5HP8A 4EE3A 1H7EA 4Y63A 2ZVZA 2HP3A 4I55B 3E25A 1ZWZA 4LW3A 5CQMX 1KNKA 4HO2A 5GONB 1X25A 1V84A 1PZYB 4MNDA 1WSZA 3CCJF 2AM5A 2CWJA 2V0HA 5ITZA 2CW4A 3I0KA 1NWGB 1OFUA 1O23B 3N4ZA 2QGIA 4O4JA 5MN6A 3AGKA 3S06A 1HJJA 2G9IA 5GIPC 5C4EA 3CU0A 1ON6A 4HO0A 5LOVA 4KWEA 4EVWA 1HJLA 1QGSA 3OAMA 1H7LA 4KRVA 1ZDFA 5ITZB 1KWSA 3ZOPA 1NHEB 4O4JB 4YJ3A 5DDTA 2FYAA 1HV9A 3I3FA 5LOVB 1VQ6F 2UYNA 3WGJA 1XHOA 5JQQA 2GGQA 3DC2A 3F0FA 3JCMM 1Q82H 2VD4A 2VAWA 3IOIA 1ZJ0A 4FFBA 1S4OA 4O2BA 5CQNX 4YJ3B 4KC2A 1DBFA 4EB6A 5D91A 3HTNA 4KXOA 4YS8A 2KGWA 2UYNB 3CKNA 2RHHA 3OBYA 2A8UA 3P4EA 2E3DA 1Z5WA 1VZUA 1LVWA 3ZP7A 1JVDA 4FFBB 1QVFF 5DDVA 2DPWA 4Q7CA 3OC9A 4O2BB 3RYHA 1VQ7F 3CCUF 1H7QA 1W3EX 2PHNA 4EB6B 4KPXA 2BTQB 1R7VA 1R1MA 2EWCA 3WGLA 3U2WA 3G6EF 4BVTA 3IEQA 3VMFB 2X5SA 1H4DA 5HY4A 2UZHA 4FRPA 3RYHB 4ZOLA 4D11C 1MP4A 5LP6C 4HO8A 2BO1A 3VIUA 2W0WA 2OTLF 3ESJA 3U2VA 4G4YA 3KIAA 1YJWF 3S03A 4X1IA 3I0CA 3U0OA 1INJA 2QTPA 5JCOC 3D54A 3K2XA 1ZJPA 5CMHA 5HWEA 4G3SA 2P73A 1R81A 5C1LA 4TUYA 4ZOLB 2WAWA 1FXJA 1ZJ3A 3NK7A 5FU8A 2CHTA 2Y6PA 3RMWA 1FFXA 1WVCA 1VGTA 3TQDA 1GX0A 4X1IB 3LDTA 2V0IA 4ZI7A 3GUEA 4X1KA 1TVKA 4B4BA 3PAFA 1PZTA 1MC3A 3V8YA 3P10A 1RQ7A 4TUYB 3HAXD 2RITA 4BVQA 2RJ7A 1N8RH 2IQQA 3U2XA 2VXMA 1FFXB 5IDTA 3E26A 3NGWA
chains in the Genus database with same CATH topology
2OI7A 5EIYA 2D0JA 1FWYA 1WT1A 3F0DA 3IOJA 2BO4A 4FRAA 4CJCA 4D0TA 2VS3A 1VH3A 3I0EA 2P6WA 1G8OA 5C47A 1LZIA 1LZ0A 4E1KA 4B4MA 3OH1A 1GWVA 3USRA 3FWWA 1JVGA 2FYCB 3Q8HA 4NANA 4Y64A 4Y62A 2YC5A 1NMMB 4NAKA 1VZTA 5J49A 3PKPA 2PA4A 1H5SA 1HM9A 3OH2A 5C1HA 4C82A 3SX8A 4B3UA 4ASJA 1G93A 1FR8A 3V90A 1JV1A 3I0DA 2X65A 5CMGX 4MYBA 4AAWA 1LL3A 2Y4LA 3F1CA 1FOAA 1IINA 3I0JA 2VS5A 3PKQA 1WT0A 3ZLLA 4Y7FA 5C3BA 1ZCTA 3JUJA 1VZXA 4C8EA 3FBAA 3MBMA 1G9RA 2GGOA 2BO7A 3KE1A 4FROA 2X5ZA 2X60A 3F1YA 3OH0A 3SXCA 4HO4A 3RMVA 2I7BA 1ZDGA 4HO5A 3SXEA 2V0KA 1H7FA 1NKHB 1KNJA 4J18A 5CQPA 4Y7GA 3T7MA 2WVMA 1NF5B 2AH9A 3CKQA 2I5EA 1H5SB 3K8DA 3O3PA 1JN1A 4KPZA 1R7UA 1QWJA 3HL3A 3ELCA 3N9WA 4DECA 2WVLA 1IV1A 2YESA 2OEGA 2APCA 4B5BA 2ICYA 1EYRA 3ZGFA 5BXCA 1ZHJA 3DK5A 4D0ZA 1FGXA 1H3MA 2QKXA 1VPAA 2Y4MA 5AJNA 1FG5N 4NAIA 4B42A 4M4KA 1TZFA 1FXOA 1NQIB 5C8RA 3CGXA 2WGZA 4ARWA 5I1FA 2JCLA 3JTJA 1S4NA 4XWIA 4EEMA 1IV2A 2FFUA 2FY7A 2Q4JA 4KC1A 4FIXA 2AM3A 2RIZA 4B2XA 1MP3A 1ZCUA 1LZJA 2V0LA 1INIA 1TVYA 1YQNA 1GX1A 2JCOA 3IOHA 3V91A 4DE7A 4ASYA 2OI6A 1VGZA 2XMHA 1VH8A 1U3PA 1H48A 5C1GA 4KNXA 4EEAA 3R3IA 1ZI5A 1H4CA 4G3PA 2O1FA 4FRDA 4D48A 5FTVA 1YP4A 1IIMA 4Y7TA 4K6RA 3V0QA 4M2BA 1GX4A 3U2UA 3EE5A 4FIYA 3ZLKA 5EJZA 3B6NA 2RJ5A 3Q7UA 2ZU7A 1VM8A 2O1GA 5C36A 2ICXA 5AJOA 3R2WA 4B2WA 1QG8A 4EE3A 4G87A 5C4DA 1H7EA 2JCKA 4Y63A 1QGQA 5B8FA 2FYDB 3U2TA 4C8IA 4HO9A 1H47A 3E25A 4D11A 2VXLA 3V0PA 1R82A 4LW3A 1R7TA 1G23A 2RJ4A 5CQMX 1KNKA 4KT7A 1ZJOA 4HO2A 1ZCVA 1GWWA 2O1HA 3CKVA 4HOCA 4C2SA 1V84A 1PZYB 5C4FA 4MNDA 1O0RA 4LW6A 1JYLA 1WSZA 1ZI4A 1LL0A 4FCUA 2Y4JA 3D98A 2RJ6A 4C81A 2WEEA 3I0GA 2J0AA 2ZU8A 2AM5A 1OQMB 2AESA 5HS2A 1JY8A 4FREA 2V0HA 1R80A 1VICA 2AECA 3POLA 3I0KA 1NWGB 1O23B 3OKRA 2PGVA 1XHBA 2QGIA 3BCVA 1JV3A 5FU0A 2J0BA 2PMPA 2RJ8A 3F0EA 1OMZA 1HJJA 3T7NA 3V0NA 4HCQA 5C4EA 5L6VA 2YQJA 3CU0A 3T80A 1H5TA 3JUKA 1V83A 1ON6A 5C3AA 4HO0A 2FFVA 4NALA 5CQLX 4HO6A 4EVWA 3ST8A 1HJLA 1QGSA 1T0AA 2A8WA 5CMIA 1W77A 3SX7A 2AMTA 1YP3A 4FRQA 3OAMA 4KNRA 1G97A 1WT3A 1H7LA 4KRVA 1ON8A 2AGDA 1ZDFA 4FRHA 5C48A 1U43A 2AM4A 1KWSA 2Z86A 1NHEB 3IEWA 4BQHA 1IV4A 1FR9A 1G0RA 5C4BA 1H5SD 2Z87A 2YC3A 5DDTA 4AYJA 1FRWA 5IDSA 2FYAA 2RIXA 1HV9A 1H5SC 1H5TB 2XMEA 4O6MA 1MP5A 4B4GA 1IV3A 3Q4SA 5JQQA 1K4VA 2GGQA 3F0FA 3TZTA 1ZCYA 4Y6NA 1FO8A 2VD4A 1W57A 3IOIA 4P00A 3P0ZA 2MZBA 4Y9XA 2AE7A 1ZJ0A 3D5NA 1S4OA 1JYKA 3OGZA 1HM8A 1TW1A 3QVBA 4AC3A 4EE4A 2BO8A 1Z90A 2OI5A 5CQNX 2RJ1A 3F0GA 4KC2A 3BRKX 3V0MA 5EJ1A 3PNNA 5D91A 4KC4A 1VGWA 2CU2A 3SXAA 3K14A 1H4EA 2VFZA 3JVHA 4IRPA 3I0LA 4KXOA 4YS8A 3IKFA 2YQCA 1GQCA 1H5RA 1R7YA 3CKNA 3SPTA 1G3LA 2A8UA 1W55A 5L6SA 3U0XA 5CMJA 2ZU9A 2E3DA 2QH5A 1VZUA 1WT2A 3CKOA 1LVWA 1JVDA 3D8VA 1LL2A 5DDVA 3DJ4A 2RJ9A 4FRBA 2DPWA 4Q7CA 3OC9A 2XWNA 2Y4KA 1H7QA 1ZI1A 3RE3A 2VS4A 1U3LA 4O6NA 4M2AA 1FO9A 4KPXA 3V0LA 1R7VA 1XZ6A 2VSHA 4BMAA 4L41C 1SS9A 2D7IA 2BO6A 3USQA 3GHZA 2UX8A 1GA8A 3DUVA 1H5RB 3U2WA 3SXGA 4CJ8A 4Y7VA 1ZIZA 2OEFA 2NXVA 3IEQA 2V0JA 4Y7UA 1YROB 4IRQA 2C0NA 2X5SA 2PX7A 3CKJA 5FYEA 1H4DA 4UEGA 4G3QA 2XWMA 2P72A 2VK9A 2D7RA 3SXBA 5AJPA 1E5KA 4HO3A 2UZHA 4FRPA 1R7XA 3OH4A 2WVKA 4D11C 4CVHA 1MP4A 4R7PA 1H7HA 3ERNA 1FGGA 4HO8A 3SX3A 2PGYA 3OH3A 5IFYA 3EORA 1V82A 4ECMA 1O7OA 3I0HA 5CMFX 2W0WA 3I0FA 2RJ0A 3ESJA 3U2VA 1H7TA 3KIAA 4EE5A 1S4PA 1FZWA 3IKEA 3I0CA 4Y6UA 1INJA 1EZIA 4EEOA 2W0VA 4FRLA 4CJBA 3K2XA 4JISA 5FV9A 3QHDA 1G1LA 1ZJPA 3V8ZA 4M28A 3FPIA 1GQ9A 5CMHA 3RSBA 2VSIA 2GZLA 1LZ7A 1YP2A 4P02A 5C4CA 1ZJ1A 4G3SA 3LW6A 2P73A 1R81A 5C1LA 1ZJ2A 5FTSA 2WAWA 1FXJA 1ZJ3A 1G2VA 5FU8A 4EEGA 4FCEA 4GBPA 2WE9A 2Y6PA 3RMWA 4ZDQA 1TW5A 2JCJA 1OMXA 1WVCA 3ZGGA 1VGTA 4DDZA 3TQDA 1VH1A 1VGUA 1ZI3A 5FUHA 5C38A 5CQOA 3ZF8A 2I5KA 1GX0A 4AYLA 4C8GA 1O7QA 3FOQA 5D92A 4JD0A 2V0IA 3GUEA 1H7GA 2FYBA 2E8BA 4B4BA 3I0IX 1PZTA 4HG6A 3T7OA 5C49A 3V0OA 4KQLA 2XWLA 2YCMA 3Q80A 1MC3A 3V8YA 3P10A 2RIYA 4FRMA 2RITA 1HM0A 3SX5A 4FQWA 3U0YA 2RJ7A 3SXDA 2Y7AA 2YQHA 3K8EA 3U2XA 2VXMA 1G95A 3F6MA 1VHAA 1U40A 2YQSA 4MIXA 5IDTA 3E26A 5C3DA 1I52A 3NGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI7 A;  5EIY A;  2D0J A;  1FWY A;  1WT1 A;  3F0D A;  3IOJ A;  2BO4 A;  4FRA A;  4CJC A;  4D0T A;  2VS3 A;  1VH3 A;  3I0E A;  2P6W A;  1G8O A;  5C47 A;  1LZI A;  1LZ0 A;  4E1K A;  4B4M A;  3OH1 A;  1GWV A;  3USR A;  3FWW A;  1JVG A;  2FYC B;  3Q8H A;  4NAN A;  4Y64 A;  4Y62 A;  2YC5 A;  1NMM B;  4NAK A;  1VZT A;  5J49 A;  3PKP A;  2PA4 A;  1H5S A;  1HM9 A;  3OH2 A;  5C1H A;  4C82 A;  3SX8 A;  4B3U A;  4ASJ A;  1G93 A;  1FR8 A;  3V90 A;  1JV1 A;  3I0D A;  2X65 A;  5CMG X;  4MYB A;  4AAW A;  1LL3 A;  2Y4L A;  3F1C A;  1FOA A;  1IIN A;  3I0J A;  2VS5 A;  3PKQ A;  1WT0 A;  3ZLL A;  4Y7F A;  5C3B A;  1ZCT A;  3JUJ A;  1VZX A;  4C8E A;  3FBA A;  3MBM A;  1G9R A;  2GGO A;  2BO7 A;  3KE1 A;  4FRO A;  2X5Z A;  2X60 A;  3F1Y A;  3OH0 A;  3SXC A;  4HO4 A;  3RMV A;  2I7B A;  1ZDG A;  4HO5 A;  3SXE A;  2V0K A;  1H7F A;  1NKH B;  1KNJ A;  4J18 A;  5CQP A;  4Y7G A;  3T7M A;  2WVM A;  1NF5 B;  2AH9 A;  3CKQ A;  2I5E A;  1H5S B;  3K8D A;  3O3P A;  1JN1 A;  4KPZ A;  1R7U A;  1QWJ A;  3HL3 A;  3ELC A;  3N9W A;  4DEC A;  2WVL A;  1IV1 A;  2YES A;  2OEG A;  2APC A;  4B5B A;  2ICY A;  1EYR A;  3ZGF A;  5BXC A;  1ZHJ A;  3DK5 A;  4D0Z A;  1FGX A;  1H3M A;  2QKX A;  1VPA A;  2Y4M A;  5AJN A;  1FG5 N;  4NAI A;  4B42 A;  4M4K A;  1TZF A;  1FXO A;  1NQI B;  5C8R A;  3CGX A;  2WGZ A;  4ARW A;  5I1F A;  2JCL A;  3JTJ A;  1S4N A;  4XWI A;  4EEM A;  1IV2 A;  2FFU A;  2FY7 A;  2Q4J A;  4KC1 A;  2AM3 A;  2RIZ A;  4B2X A;  1MP3 A;  1ZCU A;  1LZJ A;  2V0L A;  1INI A;  1TVY A;  1YQN A;  1GX1 A;  2JCO A;  3IOH A;  3V91 A;  4DE7 A;  4ASY A;  2OI6 A;  1VGZ A;  2XMH A;  1VH8 A;  1U3P A;  1H48 A;  5C1G A;  4KNX A;  4EEA A;  3R3I A;  1ZI5 A;  1H4C A;  4G3P A;  2O1F A;  4FRD A;  4D48 A;  5FTV A;  1YP4 A;  1IIM A;  4Y7T A;  4K6R A;  3V0Q A;  4M2B A;  1GX4 A;  3U2U A;  3EE5 A;  3ZLK A;  5EJZ A;  3B6N A;  2RJ5 A;  3Q7U A;  2ZU7 A;  1VM8 A;  2O1G A;  5C36 A;  2ICX A;  5AJO A;  3R2W A;  4B2W A;  1QG8 A;  4EE3 A;  4G87 A;  5C4D A;  1H7E A;  2JCK A;  4Y63 A;  1QGQ A;  5B8F A;  2FYD B;  3U2T A;  4C8I A;  4HO9 A;  1H47 A;  3E25 A;  4D11 A;  2VXL A;  3V0P A;  1R82 A;  4LW3 A;  1R7T A;  1G23 A;  2RJ4 A;  5CQM X;  1KNK A;  4KT7 A;  1ZJO A;  4HO2 A;  1ZCV A;  1GWW A;  2O1H A;  3CKV A;  4HOC A;  4C2S A;  1V84 A;  1PZY B;  5C4F A;  4MND A;  1O0R A;  4LW6 A;  1JYL A;  1WSZ A;  1ZI4 A;  1LL0 A;  4FCU A;  2Y4J A;  3D98 A;  2RJ6 A;  4C81 A;  2WEE A;  3I0G A;  2ZU8 A;  2AM5 A;  1OQM B;  2AES A;  5HS2 A;  1JY8 A;  4FRE A;  2V0H A;  1R80 A;  1VIC A;  2AEC A;  3POL A;  3I0K A;  1NWG B;  1O23 B;  3OKR A;  2PGV A;  1XHB A;  2QGI A;  3BCV A;  1JV3 A;  5FU0 A;  2PMP A;  2RJ8 A;  3F0E A;  1OMZ A;  1HJJ A;  3T7N A;  3V0N A;  4HCQ A;  5C4E A;  5L6V A;  2YQJ A;  3CU0 A;  3T80 A;  1H5T A;  3JUK A;  1V83 A;  1ON6 A;  5C3A A;  4HO0 A;  2FFV A;  4NAL A;  5CQL X;  4HO6 A;  4EVW A;  3ST8 A;  1HJL A;  1QGS A;  1T0A A;  2A8W A;  5CMI A;  1W77 A;  3SX7 A;  2AMT A;  1YP3 A;  4FRQ A;  3OAM A;  4KNR A;  1G97 A;  1WT3 A;  1H7L A;  4KRV A;  1ON8 A;  2AGD A;  1ZDF A;  4FRH A;  5C48 A;  1U43 A;  2AM4 A;  1KWS A;  2Z86 A;  1NHE B;  3IEW A;  4BQH A;  1IV4 A;  1FR9 A;  1G0R A;  5C4B A;  1H5S D;  2Z87 A;  2YC3 A;  5DDT A;  4AYJ A;  1FRW A;  5IDS A;  2FYA A;  2RIX A;  1HV9 A;  1H5S C;  1H5T B;  2XME A;  1MP5 A;  4B4G A;  1IV3 A;  3Q4S A;  5JQQ A;  1K4V A;  2GGQ A;  3F0F A;  3TZT A;  1ZCY A;  4Y6N A;  1FO8 A;  2VD4 A;  1W57 A;  3IOI A;  4P00 A;  3P0Z A;  2MZB A;  4Y9X A;  2AE7 A;  1ZJ0 A;  3D5N A;  1S4O A;  1JYK A;  3OGZ A;  1HM8 A;  1TW1 A;  3QVB A;  4AC3 A;  4EE4 A;  2BO8 A;  1Z90 A;  2OI5 A;  5CQN X;  2RJ1 A;  3F0G A;  4KC2 A;  3BRK X;  3V0M A;  5EJ1 A;  3PNN A;  4KC4 A;  1VGW A;  2CU2 A;  3SXA A;  3K14 A;  1H4E A;  2VFZ A;  3JVH A;  4IRP A;  3I0L A;  4KXO A;  4YS8 A;  3IKF A;  2YQC A;  1GQC A;  1H5R A;  1R7Y A;  3CKN A;  3SPT A;  1G3L A;  2A8U A;  1W55 A;  5L6S A;  3U0X A;  5CMJ A;  2ZU9 A;  2E3D A;  2QH5 A;  1VZU A;  1WT2 A;  3CKO A;  1LVW A;  1JVD A;  3D8V A;  1LL2 A;  5DDV A;  3DJ4 A;  2RJ9 A;  4FRB A;  2DPW A;  3OC9 A;  2XWN A;  2Y4K A;  1H7Q A;  1ZI1 A;  3RE3 A;  2VS4 A;  1U3L A;  4M2A A;  1FO9 A;  4KPX A;  3V0L A;  1R7V A;  1XZ6 A;  2VSH A;  4BMA A;  4L41 C;  1SS9 A;  2D7I A;  2BO6 A;  3USQ A;  3GHZ A;  2UX8 A;  1GA8 A;  3DUV A;  1H5R B;  3U2W A;  3SXG A;  4CJ8 A;  4Y7V A;  1ZIZ A;  2OEF A;  2NXV A;  3IEQ A;  2V0J A;  4Y7U A;  1YRO B;  4IRQ A;  2X5S A;  2PX7 A;  3CKJ A;  5FYE A;  1H4D A;  4UEG A;  4G3Q A;  2XWM A;  2P72 A;  2D7R A;  3SXB A;  5AJP A;  1E5K A;  4HO3 A;  2UZH A;  4FRP A;  1R7X A;  3OH4 A;  2WVK A;  4D11 C;  4CVH A;  1MP4 A;  4R7P A;  1H7H A;  3ERN A;  1FGG A;  4HO8 A;  3SX3 A;  2PGY A;  3OH3 A;  5IFY A;  3EOR A;  1V82 A;  4ECM A;  1O7O A;  3I0H A;  5CMF X;  2W0W A;  3I0F A;  2RJ0 A;  3ESJ A;  3U2V A;  1H7T A;  3KIA A;  4EE5 A;  1S4P A;  1FZW A;  3IKE A;  3I0C A;  4Y6U A;  1INJ A;  1EZI A;  4EEO A;  2W0V A;  4FRL A;  4CJB A;  3K2X A;  4JIS A;  5FV9 A;  3QHD A;  1G1L A;  1ZJP A;  3V8Z A;  4M28 A;  3FPI A;  1GQ9 A;  5CMH A;  3RSB A;  2VSI A;  2GZL A;  1LZ7 A;  1YP2 A;  4P02 A;  5C4C A;  1ZJ1 A;  4G3S A;  3LW6 A;  2P73 A;  1R81 A;  5C1L A;  1ZJ2 A;  5FTS A;  2WAW A;  1FXJ A;  1ZJ3 A;  1G2V A;  5FU8 A;  4EEG A;  4FCE A;  4GBP A;  2WE9 A;  2Y6P A;  3RMW A;  4ZDQ A;  1TW5 A;  2JCJ A;  1OMX A;  1WVC A;  3ZGG A;  1VGT A;  4DDZ A;  3TQD A;  1VH1 A;  1VGU A;  1ZI3 A;  5FUH A;  5C38 A;  5CQO A;  3ZF8 A;  2I5K A;  1GX0 A;  4AYL A;  4C8G A;  1O7Q A;  3FOQ A;  4JD0 A;  2V0I A;  3GUE A;  1H7G A;  2FYB A;  2E8B A;  4B4B A;  3I0I X;  1PZT A;  4HG6 A;  3T7O A;  5C49 A;  3V0O A;  4KQL A;  2XWL A;  2YCM A;  3Q80 A;  1MC3 A;  3V8Y A;  3P10 A;  2RIY A;  4FRM A;  2RIT A;  1HM0 A;  3SX5 A;  4FQW A;  3U0Y A;  2RJ7 A;  3SXD A;  2Y7A A;  2YQH A;  3K8E A;  3U2X A;  2VXM A;  1G95 A;  3F6M A;  1VHA A;  1U40 A;  2YQS A;  5IDT A;  3E26 A;  5C3D A;  1I52 A;  3NGW A; 
#chains in the Genus database with same CATH topology
 3NMU C;  5EIY A;  3CC4 F;  1WT1 A;  2BO4 A;  4FRA A;  2Q1X A;  4ZI7 B;  4X1K B;  1TVK B;  1W41 A;  4TZZ A;  1G8O A;  2B33 A;  3OH1 A;  3USR A;  4Y64 A;  3DDN A;  2ZAU A;  1QD9 A;  3OH2 A;  4C82 A;  1QVG F;  4B3U A;  4ASJ A;  1G93 A;  3V90 A;  3I0D A;  2UYP A;  1IIN A;  3I0J A;  2VS5 A;  1OAP A;  3CCQ F;  4C8E A;  3RA5 A;  2LBT A;  3RMV A;  1ZDG A;  3SXE A;  4O4L A;  1KNJ A;  4J18 A;  5CQP A;  3LFO A;  3CKQ A;  2I5E A;  3O3P A;  4KPZ A;  1IV1 A;  3ZGF A;  2ZF8 A;  5GAN K;  4B42 A;  1NQI B;  5C8R A;  4ARW A;  5I1F A;  3JTJ A;  4XWI A;  1CN7 A;  2FFU A;  4FIX A;  2AM3 A;  2RIZ A;  4O4L B;  4DE7 A;  2OI6 A;  3CCE F;  5C1G A;  4EEA A;  3R3I A;  1H4C A;  1YIT F;  2O1F A;  4ZHQ A;  4FRD A;  5MN5 A;  4D48 A;  5HY1 A;  4Y7T A;  3E1Y A;  5FJ4 C;  2ALE A;  3KJK A;  3U2U A;  3EE5 A;  2QA4 F;  4DXD A;  2RJ5 A;  5EWR A;  2ZU7 A;  5C36 A;  2ICX A;  5AJO A;  1QG8 A;  3VYS C;  1QGQ A;  2FYD B;  3IR9 A;  3SIV A;  2VXL A;  2RJ4 A;  1ZJO A;  5LYJ A;  4WBN A;  4ZHQ B;  1ZCV A;  1GWW A;  3CKV A;  4C2S A;  3RA6 A;  2HS4 A;  1O0R A;  1JYL A;  1CK2 A;  3CC2 F;  2P6Y A;  3D98 A;  2RJ6 A;  2WEE A;  4FRE A;  1R80 A;  4IIJ A;  3POL A;  3K0T A;  1XHB A;  3BCV A;  1JV3 A;  2R6R 1;  2PMP A;  3V0N A;  4HCQ A;  2YQJ A;  3T80 A;  1H5T A;  5LYJ B;  1KQS F;  1V83 A;  4WBN B;  2FFV A;  5CQL X;  4F6R A;  5CMI A;  4KNR A;  3G4S F;  1ON8 A;  2QI2 A;  4BT4 A;  5C48 A;  2AM4 A;  4IIJ B;  2HRU A;  4BQH A;  3CG6 A;  2YC3 A;  4AYJ A;  1FRW A;  5IDS A;  5J2U A;  2KTU A;  1H5S C;  4DRX A;  1H5T B;  2XME A;  1M1K H;  1CLI A;  4O6M A;  1MP5 A;  3HKD A;  3HWU A;  3CMA F;  1YJN F;  3Q4S A;  2IAF A;  4F6R B;  5GIN C;  1GO1 A;  3WJP A;  3TZT A;  3CB2 A;  1FO8 A;  2VAM A;  4ZHY B;  5C8Y A;  2HS3 A;  3P0Z A;  1TUB A;  3ZO8 A;  3D5N A;  2FGY A;  3FFM A;  4AC3 A;  4EE4 A;  3N2K A;  1FSZ A;  4ZHV A;  5J2U B;  4DRX B;  1VGW A;  2CU2 A;  4KC4 A;  1H4E A;  2VFZ A;  3JVH A;  3RYI A;  3I0L A;  5FNV A;  2V9Y A;  3HKD B;  4G88 A;  5L6S A;  1SZQ A;  3M4S A;  4YJ2 A;  1WT2 A;  3CKO A;  5C8Y B;  1W5B A;  1J7H A;  1TUB B;  1VQL F;  1X7O A;  3N2K B;  2VS4 A;  2FC3 A;  4G4Z A;  3V0L A;  4BMA A;  1SS9 A;  3RYI B;  5HXU A;  5FNV B;  2D7I A;  2BO6 A;  3USQ A;  1E7K A;  1GA8 A;  4LNU A;  4Y7V A;  3M1X A;  2OEF A;  2NXV A;  2I6D A;  4YJ2 B;  3LWQ C;  1ONI A;  2PX7 A;  5IYZ A;  3E22 A;  2VK9 A;  3N2G A;  3SXB A;  4HO3 A;  1UI9 A;  1R7X A;  3J7A R;  1H7H A;  3ERN A;  3SX3 A;  3N4Y A;  3EOR A;  1V82 A;  1O7O A;  5CMF X;  4LNU B;  4B62 A;  4PWT A;  1H7T A;  3IKE A;  4Y6U A;  1COM A;  3D01 A;  5IYZ B;  4FRL A;  4CJB A;  4JIS A;  3L7Q A;  3QHD A;  3E22 B;  4M28 A;  3FPI A;  1GQ9 A;  3N2G B;  5J2T A;  2CZW A;  2GZL A;  1W5F A;  3JAL A;  3HKC A;  2Q1Y A;  4ZDQ A;  5JQG A;  3ZGG A;  4DDZ A;  2HS0 A;  1VH1 A;  1VGU A;  1ZI3 A;  3VOB A;  5CQO A;  4JD0 A;  3VCZ A;  4BVR A;  2OTJ F;  2FYB A;  3T7O A;  5J2T B;  2YCM A;  3Q80 A;  2LBX A;  4O2A A;  3J81 M;  3U0Y A;  3JAL B;  3HKE A;  3HKC B;  2VGN A;  5JQG B;  1U40 A;  2JNB A;  5C3D A;  1I52 A;  2HVY D;  2OI7 A;  1FWY A;  3S0W A;  3V3T A;  4B5C A;  3O85 A;  3OBW A;  3IOJ A;  4B45 A;  5CA0 A;  2P6W A;  3NVI B;  5C47 A;  1LZI A;  4B4M A;  3R0P A;  3I55 F;  2FYC B;  4O2A B;  2YC5 A;  4NAK A;  2PA4 A;  5C1H A;  3SX8 A;  3HKE B;  1Q7Y H;  1K73 H;  1JV1 A;  1Q86 H;  4MYB A;  4ERH A;  2Y4L A;  4B46 A;  2Z01 A;  3JAT A;  3PKQ A;  4Y7F A;  5C3B A;  3JUJ A;  2KTV A;  2RHL A;  3FBA A;  5IJ9 A;  1G9R A;  5CA0 B;  2BO7 A;  2UYJ A;  4BT3 A;  2AIF A;  3F1Y A;  3OH0 A;  3SXC A;  4HO4 A;  2R75 1;  2I7B A;  3HKB A;  1NKH B;  1RLU A;  3T7M A;  5EAZ A;  3CYP B;  3TD3 A;  3HL3 A;  3N9W A;  2YES A;  2ICY A;  4D0Z A;  3JAT B;  1FG5 N;  1SA0 A;  4M4K A;  1JFF A;  5IJ9 B;  1RQ2 A;  2WGZ A;  2AIZ P;  3MCQ A;  1S4N A;  4EEM A;  1IV2 A;  4KC1 A;  3HKB B;  2Z1U A;  4NUT A;  1QU9 A;  2V0L A;  1INI A;  1TVY A;  1GX1 A;  2JCO A;  3LWO C;  3S02 A;  1VGZ A;  3J80 M;  4G3P A;  1K8A H;  2OTM A;  2DT4 A;  2BTU A;  4RHA A;  3WGK A;  4FIY A;  1YI2 F;  3B6N A;  3S0H A;  3Q7U A;  1SA0 B;  1VM8 A;  1JFF B;  3R2W A;  5EB0 A;  4G87 A;  5C4D A;  5G4V C;  5B8F A;  2RHO A;  2H6L A;  4HO9 A;  1H47 A;  1NQ3 A;  4D11 A;  3V0P A;  1G23 A;  3OW2 F;  4KT7 A;  3CXC F;  1KD1 H;  2ZVY A;  3WPX A;  5C4F A;  3MDO A;  3ZP4 A;  4LW6 A;  4NQ3 A;  4X3M A;  2Y4J A;  1KC8 H;  3WXM B;  3I0G A;  2J0A A;  2ZU8 A;  1OQM B;  2AES A;  5HS2 A;  2CHS A;  5JCO A;  1RLG A;  3MQW A;  2YYE A;  5FU0 A;  5IJ0 A;  1T0K B;  1OMZ A;  5JVD A;  1M90 H;  3T7N A;  3KHN A;  3GTZ A;  4HO6 A;  1T0A A;  2A8W A;  2AMT A;  1YP3 A;  3C9R A;  1G97 A;  1WT3 A;  2AGD A;  3CPW F;  5LA6 A;  2L26 A;  1U43 A;  2Z86 A;  3IEW A;  4C4W C;  5IJ0 B;  1VQ9 F;  1IV4 A;  5C4B A;  4X3L A;  1H5S D;  5EIB D;  3VYU C;  2RIX A;  4B4G A;  1VQV A;  1Z5V A;  1NJI H;  1IV3 A;  3WJQ A;  5LXT A;  5AVM A;  4X1Y A;  1GO0 A;  1W57 A;  2MZB A;  2AE7 A;  1XRG A;  5LA6 B;  1JYK A;  1HM8 A;  1VK3 A;  1JD1 A;  4TV9 A;  3QVB A;  3VYT C;  3C9S A;  3F0G A;  3BRK X;  3V0M A;  5EJ1 A;  4ZK7 A;  3PNN A;  3SXA A;  4IRP A;  3IKF A;  3ON1 A;  1R7Y A;  5LXT B;  3V4D A;  1G3L A;  3U0X A;  5CMJ A;  4X1Y B;  2QH5 A;  4EI8 A;  3QTY A;  1W42 A;  4FRB A;  2WAL A;  4TV9 B;  2Y4K A;  2H8E A;  3RE3 A;  4O6N A;  4M2A A;  1JJ2 F;  4L41 C;  3SXG A;  4CJ8 A;  1ZIZ A;  3WGN A;  3PLA C;  2V0J A;  4Y7U A;  3LYB A;  2NMU A;  1YRO B;  3CKJ A;  4G3Q A;  1DT9 A;  5AJP A;  5EB1 B;  1UFY A;  2WVK A;  5HY2 A;  4R7P A;  4I50 A;  5IFY A;  4ECM A;  3I0H A;  1ODE A;  2RJ0 A;  2RHJ A;  3JAS A;  4EE5 A;  5HY0 A;  1FZW A;  3NVK E;  1EZI A;  5FV9 A;  1G1L A;  3V8Z A;  3IMP A;  2VAP A;  2K1S A;  4P02 A;  1ZJ1 A;  3LW6 A;  4O4H A;  1ZJ2 A;  3TD5 A;  4I50 B;  1TW5 A;  2JCJ A;  3JAR A;  1OMX A;  3CCL F;  3UT5 A;  3JAS B;  5C38 A;  2I5K A;  5D92 A;  3HJW C;  1H7G A;  5DCV A;  5FLX M;  1W59 A;  4HG6 A;  2OZB A;  3G71 F;  2XWL A;  3MCA B;  3C9T A;  4O4H B;  4FRM A;  3M84 A;  3C9U A;  3SX5 A;  4FQW A;  5HP7 A;  4BW0 B;  3SXD A;  2Y7A A;  2YQH A;  3JAR B;  1G95 A;  4X20 A;  3UT5 B;  5MN4 A;  1X7P A;  2HQS C;  4CJC A;  4D0T A;  2VS3 A;  1VH3 A;  3I0E A;  3VTI C;  2LBW A;  1LZ0 A;  4E1K A;  1GWV A;  3Q8H A;  1VQ8 F;  1NMM B;  3K12 A;  1VZT A;  5J49 A;  1H5S A;  2ZOD A;  1FR8 A;  5CMG X;  5JH7 A;  1PF5 A;  1FOA A;  4X20 B;  4O4I A;  3ZLL A;  1XBI A;  3KE1 A;  2N48 A;  1VQP F;  4BT5 A;  5CB4 A;  4U39 A;  5KX5 A;  1NMU B;  1H5S B;  3K8D A;  2MQE A;  1R7U A;  4DEC A;  2OEG A;  4B5B A;  5JH7 B;  5BXC A;  1ZHJ A;  1VQM F;  2QKX A;  1VPA A;  4O4I B;  5AJN A;  4BT6 A;  4BT7 A;  4NAI A;  1TZF A;  1FXO A;  3CGX A;  3TD4 A;  4ZHW A;  3CD6 F;  2Q4J A;  5CB4 B;  1LZJ A;  1W40 A;  3V91 A;  3QUW A;  5KX5 B;  1U3P A;  3I7T A;  4KNX A;  1XV2 A;  3I56 F;  4M8I A;  2W8B C;  1GX4 A;  4G4W A;  3ZLK A;  3LWP C;  4LCK A;  5EJZ A;  2KG4 A;  1S72 F;  2O1G A;  4B2W A;  1YIJ F;  3BYQ A;  4XCQ A;  2JCK A;  3U2T A;  4C8I A;  1R82 A;  1R7T A;  1W2B F;  4HNA A;  3CCS F;  1W5E A;  3LWR C;  2O1H A;  1W5A A;  3JAM M;  4HOC A;  4EI7 A;  5HXZ A;  1ZI4 A;  1LL0 A;  4FCU A;  4C81 A;  4BVS A;  4R40 B;  1JY8 A;  2GLZ A;  1VIC A;  1QAH A;  3VOA A;  2AEC A;  3OKR A;  2PGV A;  3E20 B;  2J0B A;  3JAK A;  2RJ8 A;  3F0E A;  2Z1T A;  4BY9 D;  5L6V A;  4HNA B;  3JUK A;  5G4U C;  5C3A A;  3GYQ A;  4NAL A;  3ST8 A;  1YGY A;  1W77 A;  3SX7 A;  4FRQ A;  3CCR F;  2CVL A;  2HRY A;  2VGM A;  2UYK A;  2DYY A;  4FRH A;  2F9Z C;  3CYQ A;  1FR9 A;  1G0R A;  3JAK B;  2Z87 A;  5CA1 A;  4I4T A;  5IT9 M;  4TV8 A;  1K4V A;  1ZCY A;  4Y6N A;  2HX0 A;  4P00 A;  4Y9X A;  3OON A;  3OGZ A;  1TW1 A;  2BO8 A;  1Z90 A;  2OI5 A;  2RB9 A;  2Z1E A;  2RJ1 A;  5CA1 B;  4I4T B;  2VXY A;  1X52 A;  1PXW A;  4TV8 B;  3K14 A;  2YQC A;  1GQC A;  1H5R A;  3SPT A;  1W55 A;  5LP6 A;  2ZU9 A;  2HP0 A;  1VQO F;  4U3J A;  5EYP A;  3D8V A;  4BT2 A;  2H8C A;  1LL2 A;  3DJ4 A;  2RJ9 A;  1YJ9 F;  2XWN A;  5BMV A;  3CC7 F;  1ZI1 A;  1U3L A;  1SDS A;  1FO9 A;  1XZ6 A;  2VSH A;  3RYF A;  3GHZ A;  2UX8 A;  3DUV A;  3KIZ A;  1H5R B;  5LP6 B;  2HP0 B;  4IRQ A;  2C0N A;  4U3J B;  3JAW A;  5FYE A;  1VQ4 F;  5EYP B;  1VQ5 F;  4UEG A;  2XWM A;  5EO3 A;  2P72 A;  2CSL A;  2D7R A;  1E5K A;  5EZY A;  5BMV B;  2I6R A;  3OH4 A;  4CVH A;  3VO8 A;  3WJR A;  1FGG A;  2PGY A;  4G4X A;  3OH3 A;  3RYF B;  3I0F A;  3FD5 A;  1S4P A;  5JVD B;  4EEO A;  3JAW B;  2W0V A;  3RSB A;  2VSI A;  1YP2 A;  5EZY B;  1LZ7 A;  3S0Y A;  5C4C A;  2YXZ A;  3WPW A;  5FTS A;  1G2V A;  4EEG A;  1W58 1;  3NK6 A;  4FCE A;  2OHW A;  4GBP A;  2WE9 A;  1VQK F;  3D00 A;  3KJJ A;  5FUH A;  3ZF8 A;  1FNK A;  4C8G A;  4AYL A;  1O7Q A;  3FOQ A;  3SIU A;  2E8B A;  3I0I X;  3CPQ A;  4EI9 A;  5C49 A;  3V0O A;  4KQL A;  2RIY A;  3FD6 A;  1HM0 A;  4G4V A;  3K8E A;  3F6M A;  1VHA A;  4MIX A;  2YQS A;  3V7Q A;  2D0J A;  3F0D A;  3CCV F;  3RYC A;  4E6E A;  2LCA A;  1IPA A;  2GVI A;  1FNJ A;  3CCM F;  3FWW A;  1JVG A;  3LWV C;  4NAN A;  1H7M A;  4Y62 A;  1Q8R A;  3PKP A;  1HM9 A;  5GIO C;  5GAP K;  3WGM A;  2X65 A;  4AAW A;  1LL3 A;  3F1C A;  2ZOV A;  1WT0 A;  1ZCT A;  1VZX A;  3MBM A;  3RYC B;  2GGO A;  4FRO A;  4RQO A;  2X5Z A;  2X60 A;  3LME A;  3C8L A;  5KMG A;  4HO5 A;  3CME F;  1H7F A;  4IHJ A;  2V0K A;  4Y7G A;  2WVM A;  1NF5 B;  2AH9 A;  1JN1 A;  1QWJ A;  3ELC A;  2WVL A;  2APC A;  1GZ0 A;  1YHQ F;  1K9M H;  1EYR A;  3DK5 A;  1FGX A;  1H3M A;  2BTO A;  2Y4M A;  2JCL A;  5EIB C;  1Q81 H;  1RA4 A;  2IG8 A;  2FY7 A;  5KMG B;  4IHJ B;  1VQN F;  4B2X A;  4I55 A;  1MP3 A;  1ZCU A;  5A2Q M;  1YQN A;  3VI6 A;  3IOH A;  3V7E A;  2Z1F A;  4ASY A;  2XMH A;  1VH8 A;  1H48 A;  1ZI5 A;  5GON A;  2QEX F;  5FTV A;  1YP4 A;  1IIM A;  4K6R A;  3V0Q A;  4M2B A;  4NWO B;  5HP8 A;  4EE3 A;  1H7E A;  4Y63 A;  2ZVZ A;  2HP3 A;  4I55 B;  3E25 A;  1ZWZ A;  4LW3 A;  5CQM X;  1KNK A;  4HO2 A;  5GON B;  1X25 A;  1V84 A;  1PZY B;  4MND A;  1WSZ A;  3CCJ F;  2AM5 A;  2CWJ A;  2V0H A;  5ITZ A;  2CW4 A;  3I0K A;  1NWG B;  1OFU A;  1O23 B;  3N4Z A;  2QGI A;  4O4J A;  5MN6 A;  3AGK A;  3S06 A;  1HJJ A;  2G9I A;  5GIP C;  5C4E A;  3CU0 A;  1ON6 A;  4HO0 A;  5LOV A;  4KWE A;  4EVW A;  1HJL A;  1QGS A;  3OAM A;  1H7L A;  4KRV A;  1ZDF A;  5ITZ B;  1KWS A;  3ZOP A;  1NHE B;  4O4J B;  4YJ3 A;  5DDT A;  2FYA A;  1HV9 A;  3I3F A;  5LOV B;  1VQ6 F;  2UYN A;  3WGJ A;  1XHO A;  5JQQ A;  2GGQ A;  3DC2 A;  3F0F A;  3JCM M;  1Q82 H;  2VD4 A;  2VAW A;  3IOI A;  1ZJ0 A;  4FFB A;  1S4O A;  4O2B A;  5CQN X;  4YJ3 B;  4KC2 A;  1DBF A;  4EB6 A;  5D91 A;  3HTN A;  4KXO A;  4YS8 A;  2KGW A;  2UYN B;  3CKN A;  2RHH A;  3OBY A;  2A8U A;  3P4E A;  2E3D A;  1Z5W A;  1VZU A;  1LVW A;  3ZP7 A;  1JVD A;  4FFB B;  1QVF F;  5DDV A;  2DPW A;  4Q7C A;  3OC9 A;  4O2B B;  3RYH A;  1VQ7 F;  3CCU F;  1H7Q A;  1W3E X;  2PHN A;  4EB6 B;  4KPX A;  2BTQ B;  1R7V A;  1R1M A;  2EWC A;  3WGL A;  3U2W A;  3G6E F;  4BVT A;  3IEQ A;  3VMF B;  2X5S A;  1H4D A;  5HY4 A;  2UZH A;  4FRP A;  3RYH B;  4ZOL A;  4D11 C;  1MP4 A;  5LP6 C;  4HO8 A;  2BO1 A;  3VIU A;  2W0W A;  2OTL F;  3ESJ A;  3U2V A;  4G4Y A;  3KIA A;  1YJW F;  3S03 A;  4X1I A;  3I0C A;  3U0O A;  1INJ A;  2QTP A;  5JCO C;  3D54 A;  3K2X A;  1ZJP A;  5CMH A;  5HWE A;  4G3S A;  2P73 A;  1R81 A;  5C1L A;  4TUY A;  4ZOL B;  2WAW A;  1FXJ A;  1ZJ3 A;  3NK7 A;  5FU8 A;  2CHT A;  2Y6P A;  3RMW A;  1FFX A;  1WVC A;  1VGT A;  3TQD A;  1GX0 A;  4X1I B;  3LDT A;  2V0I A;  4ZI7 A;  3GUE A;  4X1K A;  1TVK A;  4B4B A;  3PAF A;  1PZT A;  1MC3 A;  3V8Y A;  3P10 A;  1RQ7 A;  4TUY B;  3HAX D;  2RIT A;  4BVQ A;  2RJ7 A;  1N8R H;  2IQQ A;  3U2X A;  2VXM A;  1FFX B;  5IDT A;  3E26 A;  3NGW A; 
#chains in the Genus database with same CATH homology
 2OI7 A;  5EIY A;  2D0J A;  1FWY A;  1WT1 A;  3F0D A;  3IOJ A;  2BO4 A;  4FRA A;  4CJC A;  4D0T A;  2VS3 A;  1VH3 A;  3I0E A;  2P6W A;  1G8O A;  5C47 A;  1LZI A;  1LZ0 A;  4E1K A;  4B4M A;  3OH1 A;  1GWV A;  3USR A;  3FWW A;  1JVG A;  2FYC B;  3Q8H A;  4NAN A;  4Y64 A;  4Y62 A;  2YC5 A;  1NMM B;  4NAK A;  1VZT A;  5J49 A;  3PKP A;  2PA4 A;  1H5S A;  1HM9 A;  3OH2 A;  5C1H A;  4C82 A;  3SX8 A;  4B3U A;  4ASJ A;  1G93 A;  1FR8 A;  3V90 A;  1JV1 A;  3I0D A;  2X65 A;  5CMG X;  4MYB A;  4AAW A;  1LL3 A;  2Y4L A;  3F1C A;  1FOA A;  1IIN A;  3I0J A;  2VS5 A;  3PKQ A;  1WT0 A;  3ZLL A;  4Y7F A;  5C3B A;  1ZCT A;  3JUJ A;  1VZX A;  4C8E A;  3FBA A;  3MBM A;  1G9R A;  2GGO A;  2BO7 A;  3KE1 A;  4FRO A;  2X5Z A;  2X60 A;  3F1Y A;  3OH0 A;  3SXC A;  4HO4 A;  3RMV A;  2I7B A;  1ZDG A;  4HO5 A;  3SXE A;  2V0K A;  1H7F A;  1NKH B;  1KNJ A;  4J18 A;  5CQP A;  4Y7G A;  3T7M A;  2WVM A;  1NF5 B;  2AH9 A;  3CKQ A;  2I5E A;  1H5S B;  3K8D A;  3O3P A;  1JN1 A;  4KPZ A;  1R7U A;  1QWJ A;  3HL3 A;  3ELC A;  3N9W A;  4DEC A;  2WVL A;  1IV1 A;  2YES A;  2OEG A;  2APC A;  4B5B A;  2ICY A;  1EYR A;  3ZGF A;  5BXC A;  1ZHJ A;  3DK5 A;  4D0Z A;  1FGX A;  1H3M A;  2QKX A;  1VPA A;  2Y4M A;  5AJN A;  1FG5 N;  4NAI A;  4B42 A;  4M4K A;  1TZF A;  1FXO A;  1NQI B;  5C8R A;  3CGX A;  2WGZ A;  4ARW A;  5I1F A;  2JCL A;  3JTJ A;  1S4N A;  4XWI A;  4EEM A;  1IV2 A;  2FFU A;  2FY7 A;  2Q4J A;  4KC1 A;  4FIX A;  2AM3 A;  2RIZ A;  4B2X A;  1MP3 A;  1ZCU A;  1LZJ A;  2V0L A;  1INI A;  1TVY A;  1YQN A;  1GX1 A;  2JCO A;  3IOH A;  3V91 A;  4DE7 A;  4ASY A;  2OI6 A;  1VGZ A;  2XMH A;  1VH8 A;  1U3P A;  1H48 A;  5C1G A;  4KNX A;  4EEA A;  3R3I A;  1ZI5 A;  1H4C A;  4G3P A;  2O1F A;  4FRD A;  4D48 A;  5FTV A;  1YP4 A;  1IIM A;  4Y7T A;  4K6R A;  3V0Q A;  4M2B A;  1GX4 A;  3U2U A;  3EE5 A;  4FIY A;  3ZLK A;  5EJZ A;  3B6N A;  2RJ5 A;  3Q7U A;  2ZU7 A;  1VM8 A;  2O1G A;  5C36 A;  2ICX A;  5AJO A;  3R2W A;  4B2W A;  1QG8 A;  4EE3 A;  4G87 A;  5C4D A;  1H7E A;  2JCK A;  4Y63 A;  1QGQ A;  5B8F A;  2FYD B;  3U2T A;  4C8I A;  4HO9 A;  1H47 A;  3E25 A;  4D11 A;  2VXL A;  3V0P A;  1R82 A;  4LW3 A;  1R7T A;  1G23 A;  2RJ4 A;  5CQM X;  1KNK A;  4KT7 A;  1ZJO A;  4HO2 A;  1ZCV A;  1GWW A;  2O1H A;  3CKV A;  4HOC A;  4C2S A;  1V84 A;  1PZY B;  5C4F A;  4MND A;  1O0R A;  4LW6 A;  1JYL A;  1WSZ A;  1ZI4 A;  1LL0 A;  4FCU A;  2Y4J A;  3D98 A;  2RJ6 A;  4C81 A;  2WEE A;  3I0G A;  2J0A A;  2ZU8 A;  2AM5 A;  1OQM B;  2AES A;  5HS2 A;  1JY8 A;  4FRE A;  2V0H A;  1R80 A;  1VIC A;  2AEC A;  3POL A;  3I0K A;  1NWG B;  1O23 B;  3OKR A;  2PGV A;  1XHB A;  2QGI A;  3BCV A;  1JV3 A;  5FU0 A;  2J0B A;  2PMP A;  2RJ8 A;  3F0E A;  1OMZ A;  1HJJ A;  3T7N A;  3V0N A;  4HCQ A;  5C4E A;  5L6V A;  2YQJ A;  3CU0 A;  3T80 A;  1H5T A;  3JUK A;  1V83 A;  1ON6 A;  5C3A A;  4HO0 A;  2FFV A;  4NAL A;  5CQL X;  4HO6 A;  4EVW A;  3ST8 A;  1HJL A;  1QGS A;  1T0A A;  2A8W A;  5CMI A;  1W77 A;  3SX7 A;  2AMT A;  1YP3 A;  4FRQ A;  3OAM A;  4KNR A;  1G97 A;  1WT3 A;  1H7L A;  4KRV A;  1ON8 A;  2AGD A;  1ZDF A;  4FRH A;  5C48 A;  1U43 A;  2AM4 A;  1KWS A;  2Z86 A;  1NHE B;  3IEW A;  4BQH A;  1IV4 A;  1FR9 A;  1G0R A;  5C4B A;  1H5S D;  2Z87 A;  2YC3 A;  5DDT A;  4AYJ A;  1FRW A;  5IDS A;  2FYA A;  2RIX A;  1HV9 A;  1H5S C;  1H5T B;  2XME A;  4O6M A;  1MP5 A;  4B4G A;  1IV3 A;  3Q4S A;  5JQQ A;  1K4V A;  2GGQ A;  3F0F A;  3TZT A;  1ZCY A;  4Y6N A;  1FO8 A;  2VD4 A;  1W57 A;  3IOI A;  4P00 A;  3P0Z A;  2MZB A;  4Y9X A;  2AE7 A;  1ZJ0 A;  3D5N A;  1S4O A;  1JYK A;  3OGZ A;  1HM8 A;  1TW1 A;  3QVB A;  4AC3 A;  4EE4 A;  2BO8 A;  1Z90 A;  2OI5 A;  5CQN X;  2RJ1 A;  3F0G A;  4KC2 A;  3BRK X;  3V0M A;  5EJ1 A;  3PNN A;  5D91 A;  4KC4 A;  1VGW A;  2CU2 A;  3SXA A;  3K14 A;  1H4E A;  2VFZ A;  3JVH A;  4IRP A;  3I0L A;  4KXO A;  4YS8 A;  3IKF A;  2YQC A;  1GQC A;  1H5R A;  1R7Y A;  3CKN A;  3SPT A;  1G3L A;  2A8U A;  1W55 A;  5L6S A;  3U0X A;  5CMJ A;  2ZU9 A;  2E3D A;  2QH5 A;  1VZU A;  1WT2 A;  3CKO A;  1LVW A;  1JVD A;  3D8V A;  1LL2 A;  5DDV A;  3DJ4 A;  2RJ9 A;  4FRB A;  2DPW A;  4Q7C A;  3OC9 A;  2XWN A;  2Y4K A;  1H7Q A;  1ZI1 A;  3RE3 A;  2VS4 A;  1U3L A;  4O6N A;  4M2A A;  1FO9 A;  4KPX A;  3V0L A;  1R7V A;  1XZ6 A;  2VSH A;  4BMA A;  4L41 C;  1SS9 A;  2D7I A;  2BO6 A;  3USQ A;  3GHZ A;  2UX8 A;  1GA8 A;  3DUV A;  1H5R B;  3U2W A;  3SXG A;  4CJ8 A;  4Y7V A;  1ZIZ A;  2OEF A;  2NXV A;  3IEQ A;  2V0J A;  4Y7U A;  1YRO B;  4IRQ A;  2C0N A;  2X5S A;  2PX7 A;  3CKJ A;  5FYE A;  1H4D A;  4UEG A;  4G3Q A;  2XWM A;  2P72 A;  2VK9 A;  2D7R A;  3SXB A;  5AJP A;  1E5K A;  4HO3 A;  2UZH A;  4FRP A;  1R7X A;  3OH4 A;  2WVK A;  4D11 C;  4CVH A;  1MP4 A;  4R7P A;  1H7H A;  3ERN A;  1FGG A;  4HO8 A;  3SX3 A;  2PGY A;  3OH3 A;  5IFY A;  3EOR A;  1V82 A;  4ECM A;  1O7O A;  3I0H A;  5CMF X;  2W0W A;  3I0F A;  2RJ0 A;  3ESJ A;  3U2V A;  1H7T A;  3KIA A;  4EE5 A;  1S4P A;  1FZW A;  3IKE A;  3I0C A;  4Y6U A;  1INJ A;  1EZI A;  4EEO A;  2W0V A;  4FRL A;  4CJB A;  3K2X A;  4JIS A;  5FV9 A;  3QHD A;  1G1L A;  1ZJP A;  3V8Z A;  4M28 A;  3FPI A;  1GQ9 A;  5CMH A;  3RSB A;  2VSI A;  2GZL A;  1LZ7 A;  1YP2 A;  4P02 A;  5C4C A;  1ZJ1 A;  4G3S A;  3LW6 A;  2P73 A;  1R81 A;  5C1L A;  1ZJ2 A;  5FTS A;  2WAW A;  1FXJ A;  1ZJ3 A;  1G2V A;  5FU8 A;  4EEG A;  4FCE A;  4GBP A;  2WE9 A;  2Y6P A;  3RMW A;  4ZDQ A;  1TW5 A;  2JCJ A;  1OMX A;  1WVC A;  3ZGG A;  1VGT A;  4DDZ A;  3TQD A;  1VH1 A;  1VGU A;  1ZI3 A;  5FUH A;  5C38 A;  5CQO A;  3ZF8 A;  2I5K A;  1GX0 A;  4AYL A;  4C8G A;  1O7Q A;  3FOQ A;  5D92 A;  4JD0 A;  2V0I A;  3GUE A;  1H7G A;  2FYB A;  2E8B A;  4B4B A;  3I0I X;  1PZT A;  4HG6 A;  3T7O A;  5C49 A;  3V0O A;  4KQL A;  2XWL A;  2YCM A;  3Q80 A;  1MC3 A;  3V8Y A;  3P10 A;  2RIY A;  4FRM A;  2RIT A;  1HM0 A;  3SX5 A;  4FQW A;  3U0Y A;  2RJ7 A;  3SXD A;  2Y7A A;  2YQH A;  3K8E A;  3U2X A;  2VXM A;  1G95 A;  3F6M A;  1VHA A;  1U40 A;  2YQS A;  4MIX A;  5IDT A;  3E26 A;  5C3D A;  1I52 A;  3NGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...