1W57A

Structure of the bifunctional ispdf from campylobacter jejuni containing zn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'EMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
molecule tags Transferase
source organism Campylobacter jejuni
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
total genus 106
structure length 368
sequence length 368
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w57A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w57A01
5FYEA 1VHAA 4KNRA 1U43A 1JYKA 1MP4A 3IOJA 1QGSA 5DDVA 2PGYA 1EYRA 3RE3A 1IIMA 1R7XA 1O0RA 1S4NA 4Y7FA 2QKXA 4FCEA 4NAIA 3USQA 5L6SA 2YESA 5C8RA 3BCVA 4E1KA 3D98A 2JCOA 2UX8A 5FU0A 3I0HA 1G0RA 1H47A 1HM0A 1V82A 1GX4A 2GGOA 3I0CA 3ZGFA 5C4EA 1NMMB 2D7IA 3CKVA 4ARWA 3SX7A 5CMJA 5FUHA 1ZJPA 4EE3A 3OH4A 2RJ1A 1ZJ0A 3CGXA 4D0TA 4DECA 3ERNA 2I5KA 5C3BA 1NWGB 3KIAA 3U2VA 3U0YA 3CU0A 2PA4A 1H7TA 1R7UA 1G8OA 3SX8A 4FRQA 1YP3A 2FYAA 1VGTA 1ZDFA 2ZU7A 1U40A 1MP5A 1EZIA 1VH3A 4KT7A 4JISA 1VZUA 1E5KA 1TW5A 4AYLA 2X5SA 3V0QA 4Y9XA 4YS8A 4Y6NA 1ZI4A 4L41C 4DDZA 4Y7GA 5C48A 3F0FA 4EE5A 3E26A 2X65A 4HCQA 1OMXA 1GQCA 2V0JA 3IKFA 2P6WA 5IDTA 1FOAA 1GX0A 3I0LA 1H5SD 3U2UA 4BMAA 2CU2A 2Y4KA 5C49A 4HO8A 1H5SC 4K6RA 1QG8A 1QWJA 2AH9A 4UEGA 4EEAA 2ICXA 2OEFA 4NAKA 3SXEA 1ZJ2A 4C82A 2RJ0A 1T0AA 3V0MA 2RJ5A 2QGIA 1FZWA 1NHEB 1H7HA 4CJ8A 1ZCUA 3PNNA 1FG5N 4Y7VA 2FYBA 3USRA 1H4CA 3ESJA 4HO0A 3CKOA 5C4DA 4ASJA 3DJ4A 2VSHA 3T7NA 3V0LA 3R2WA 1LZ0A 3Q4SA 2X60A 1JV3A 4Y64A 1LZJA 2I7BA 1Z90A 3IKEA 3OC9A 1IV1A 1IV3A 3V0OA 4LW3A 2NXVA 5L6VA 3QHDA 4HO3A 4G87A 1H4EA 1G93A 2BO4A 4MNDA 2O1GA 3N9WA 1VGZA 4FCUA 2WVMA 1TW1A 2ZU9A 3T80A 1HJJA 1GA8A 1O7QA 3RMVA 2PGVA 2WE9A 3SXBA 2Y4JA 5CMHA 4FRMA 2V0LA 2I5EA 2RJ7A 4M28A 2VD4A 1G2VA 4HO2A 3GHZA 4ASYA 1H7FA 3K14A 3D8VA 4B2WA 3D5NA 2Q4JA 5C3DA 2BO6A 3CKJA 4KRVA 4NALA 1VZXA 2BO8A 3HL3A 2P72A 2A8WA 3SXCA 1ZI5A 4FRAA 3MBMA 1W77A 3ZF8A 4EEMA 3ST8A 1JYLA 1ZJ1A 3JUKA 2W0VA 3FPIA 1TZFA 3E25A 2AM4A 3F6MA 4KXOA 5FTSA 1INIA 3DK5A 4EEGA 1VICA 3JTJA 5EIYA 1XHBA 3I0KA 2WVKA 1GX1A 3Q8HA 1KNKA 1HV9A 4M2BA 3O3PA 1JVDA 1LL2A 2GGQA 5CMFX 1WT1A 4C81A 4HO6A 5FU8A 1VGWA 2UZHA 2MZBA 4KPZA 3SPTA 1FR8A 3CKNA 4R7PA 3IEQA 3FWWA 4HO5A 3ZGGA 3TQDA 5CQPA 4KC2A 2APCA 4LW6A 2WAWA 2XMEA 2Z86A 1H5TB 3BRKX 1H5TA 2AMTA 1O23B 2VXMA 2Y4MA 3V0PA 5CMGX 4KPXA 1U3LA 4HG6A 2YC5A 5C4CA 2VS3A 2OEGA 1WT2A 1FO8A 4EVWA 3I0FA 4Y7TA 1S4PA 4KC1A 3GUEA 1WSZA 1ON8A 2XWNA 1R82A 2OI5A 3KE1A 4KC4A 2AE7A 1YP4A 3CKQA 3K8DA 3POLA 1ZCYA 3U2XA 4AC3A 4B4BA 1YQNA 1IV2A 2WGZA 2Y4LA 1H4DA 2FYCB 1KNJA 4B42A 1FXOA 1IINA 1HM9A 3QVBA 5AJPA 1ON6A 3Q7UA 1W55A 3OKRA 2JCKA 2PMPA 2RIXA 3SXGA 5FV9A 1H5RA 1U3PA 1R81A 3NGWA 5C1HA 4ECMA 3T7OA 2AM5A 1VH1A 4CJBA 1HJLA 1H5SB 2FFUA 1NF5B 3F1YA 1H5SA 1MP3A 2O1FA 5C4FA 4DE7A 3IEWA 5I1FA 1WVCA 2RITA 2PX7A 2V0KA 5CQLX 2DPWA 3B6NA 4FRPA 2BO7A 1G3LA 1R7VA 3RMWA 2X5ZA 3IOHA 2GZLA 4ZDQA 5B8FA 2E3DA 3K2XA 1ZJOA 4C2SA 1HM8A 1G97A 4Y7UA 4Y63A 5AJOA 3F0GA 1JN1A 4FQWA 1GWVA 5CQMX 5C3AA 5JQQA 1H7QA 4G3PA 1R7YA 1H48A 2XWLA 4C8IA 2OI7A 1FO9A 2RJ9A 2AESA 1KWSA 3V8ZA 5EJZA 3F0DA 4KQLA 4EE4A 4CVHA 2XMHA 1H7GA 4HO9A 1YROB 2V0HA 1FRWA 5CQNX 1G23A 1FR9A 1VPAA 1OQMB 2VS4A 2ZU8A 3EE5A 2AM3A 3SXAA 4HO4A 1IV4A 1ZIZA 3OH3A 2XWMA 1TVYA 3SXDA 1LL3A 2RIZA 2VS5A 3U2TA 2RJ6A 3R3IA 5C4BA 2AECA 5FTVA 4B4GA 1FXJA 4IRPA 4KNXA 1V84A 4Y62A 5AJNA 2OI6A 2JCJA 2ICYA 5IFYA 4C8EA 5CQOA 3P10A 2FYDB 2RJ8A 4BQHA 4FREA 3JUJA 3DUVA 4CJCA 2YQCA 1S4OA 4D0ZA 1OMZA 1I52A 1PZTA 3OH2A 3OH0A 1GWWA 4MYBA 3JVHA 2D7RA 3PKQA 1QGQA 3FOQA 3F0EA 3F1CA 2YQSA 3I0GA 4FRLA 2AGDA 4AYJA 3K8EA 4HOCA 1G9RA 4B4MA 3ZLLA 1XZ6A 1VGUA 2WEEA 1W57A 1SS9A 1V83A 3I0EA 5C1GA 4B2XA 1H3MA 4JD0A 1PZYB 1GQ9A 3SX5A 1H7EA 3I0JA 3T7MA 1JVGA 3V90A 5J49A 3OAMA 2VSIA 2QH5A 1FGGA 1LZIA 3ZLKA 3U2WA 3OH1A 3I0IX 4G3QA 4M2AA 1LZ7A 2RIYA 1WT3A 3PKPA 1LL0A 3TZTA 3LW6A 2YCMA 3SX3A 3ELCA 4P00A 2YQHA 3V91A 4FRDA 2A8UA 1ZCTA 3I0DA 1ZI1A 4G3SA 1WT0A 2VFZA 4FRHA 4D48A 2Y6PA 1JV1A 1ZI3A 1FWYA 2WVLA 4B5BA 3Q80A 3RSBA 5C38A 2D0JA 2FY7A 4C8GA 1FGXA 1O7OA 1INJA 4IRQA 5BXCA 5C1LA 2V0IA 1NKHB 1ZDGA 1ZHJA 5C47A 4AAWA 5DDTA 3EORA 1ZJ3A 5IDSA 2O1HA 3IOIA 2VXLA 1H5RB 4FRBA 1R7TA 3U0XA 1YP2A 2JCLA 1ZCVA 4XWIA 4NANA 2Z87A 3P0ZA 2YC3A 5EJ1A 1VZTA 4EEOA 1NQIB 2YQJA 4D11C 1VH8A 1G95A 1JY8A 1LVWA 2RJ4A 1K4VA 4P02A 1R80A 3V8YA 4D11A 1MC3A 2E8BA 3OGZA 2W0WA 4B3UA 2Y7AA 3V0NA 4M4KA 4GBPA 1VM8A 2FFVA 4FROA 5C36A 4Y6UA 3FBAA 1G1LA 2P73A 5CMIA 5HS2A 1H7LA 4J18A
chains in the Genus database with same CATH superfamily
4ZI7A 3N2KA 5FJ4C 5FYEA 4YJ2B 1VHAA 5FNVA 3N2KB 3CMEF 3V7EA 1W5EA 4KNRA 5FNVB 3VYSC 1U43A 1VQOF 2F9ZC 2IAFA 1JYKA 1MP4A 3IOJA 1QGSA 5DDVA 5JVDA 2PGYA 3CPWF 2BTQB 1EYRA 2B33A 3RE3A 1IIMA 1R7XA 3M84A 3FFMA 1O0RA 1S4NA 4Y7FA 2QKXA 4O4HB 4FCEA 4NAIA 3USQA 3JAWB 5KX5A 2YESA 5C8RA 3BCVA 5L6SA 4E1KA 3FD6A 3D98A 2JCOA 3MCQA 5IYZB 2UX8A 3RYHB 5FU0A 3I0HA 5IYZA 1YITF 1VK3A 1H47A 1G0RA 1HM0A 1V82A 4R40B 1GX4A 2GGOA 3I0CA 3ZGFA 5C4EA 1NMMB 2D7IA 2GVIA 3CKVA 2CZWA 4ARWA 2KTVA 3VI6A 3WGNA 1OFUA 3SX7A 3HKDA 5CMJA 3CCRF 3I7TA 3NMUC 3V0QA 2KTUA 3HJWC 5FUHA 1ZJPA 2EWCA 4RQOA 3LWPC 4EE3A 3OH4A 2RJ1A 1VQMF 1ZJ0A 4X20A 3CGXA 4D0TA 4X20B 4X1IB 1VQNF 4DECA 3RYIB 5GAPK 5HXUA 2ZAUA 3ERNA 4RHAA 4X1IA 2I5KA 5C3BA 1NWGB 3KIAA 3U2VA 3U0YA 3LWQC 3FD5A 3TD4A 2PA4A 3CU0A 1H7TA 2RHOA 1R7UA 4I50B 1G8OA 3SX8A 3JAMM 4FRQA 1YP3A 3WJRA 1NQ3A 3NK7A 2FYAA 1VGTA 1ZDFA 2ZU7A 4C4WC 1U40A 1GO0A 1MP5A 1EZIA 5EIBC 1VH3A 4KT7A 4JISA 3RA6A 5G4UC 1VZUA 3C9SA 5EIBD 4B62A 1E5KA 3CCLF 3VTIC 1TW5A 5EB0A 1VQKF 2X5SA 1UFYA 4Y9XA 4Y6NA 1Z5VA 4O4IA 4XCQA 1VQ4F 1ZI4A 4L41C 4YS8A 4DDZA 3DDNA 3K12A 3QUWA 4Y7GA 3F0FA 4O4IB 5C48A 4EE5A 5MN4A 4BVTA 4IHJA 3E26A 2X65A 4HCQA 1OMXA 1GQCA 2V0JA 3IKFA 2P6WA 4PWTA 5IDTA 1FOAA 1GX0A 1ODEA 5JCOA 3VOAA 4EB6A 4O2AB 1YJWF 1S72F 3I0LA 1SA0A 2Z01A 1W42A 1H5SD 2ZU8A 3CCMF 4EB6B 4X1YB 4O2AA 5J2TA 2CU2A 5LA6A 2Y4KA 5LOVA 4HO8A 3U2UA 4BMAA 1H5SC 1ZWZA 2BO1A 4X1YA 5J2TB 1T0KB 1QG8A 1QWJA 2AH9A 4K6RA 2ICXA 4UEGA 5AVMA 4EEAA 3CCQF 2OEFA 2HX0A 2L26A 3J81M 5HP8A 5GINC 1VQ8F 4NAKA 3SXEA 4G4XA 1ZJ2A 4C82A 5GONA 2RJ0A 1T0AA 3CPQA 5HY4A 3RA5A 2YYEA 5EB1B 5GONB 4DRXA 5C49A 1JFFB 1VQLF 2QGIA 1FZWA 3P4EA 2RJ5A 3V0MA 3RYCB 1NHEB 1JFFA 1W3EX 4BT2A 1H7HA 4O6MA 4B2XA 4CJ8A 4O4JB 4EI9A 1ZCUA 4FFBA 3HKCB 1X7OA 3PNNA 1FG5N 4WBNB 4Y7VA 2FYBA 3HKCA 3CC2F 3USRA 5IJ0B 1H4CA 3ESJA 1RLGA 4HO0A 2Q1XA 3CKOA 3LWOC 5C4DA 3TD3A 4ASJA 3DJ4A 1QD9A 5J2UB 2P6YA 2VSHA 1RQ2A 4YJ3A 3R2WA 3OBYA 1LZ0A 3WJQA 3S02A 1JV3A 2X60A 3Q4SA 1CK2A 4YJ3B 2HRUA 1VQ6F 3WGJA 1LZJA 2OTMA 2I7BA 1Z90A 4Y64A 3JASA 3IKEA 3OC9A 1IV1A 1IV3A 3KHNA 3V0OA 4EI7A 4LW3A 3JASB 3C8LA 2NXVA 3QHDA 5L6VA 4HO3A 1K73H 2Z1FA 4G87A 3D00A 1H4EA 1G93A 4O6NA 1VQVA 2R6R1 2BO4A 4MNDA 2O1GA 3N9WA 1VGZA 4FCUA 2WVMA 4NUTA 3WJPA 1TW1A 2ZU9A 3T80A 2HQSC 1HJJA 1GA8A 1SDSA 3S06A 1O7QA 3RMVA 2PGVA 2WE9A 3SXBA 3VIUA 2Y4JA 2VAWA 3VCZA 5CMHA 4FRMA 3C9UA 3GTZA 2V0LA 2I5EA 2RJ7A 2VS4A 2ZODA 2VD4A 2HS0A 4M28A 1G2VA 4G4WA 3GHZA 4HO2A 2ZVZA 3G71F 2J0BA 4TV8B 4ASYA 3CCJF 3K14A 1H7FA 2N48A 3CCVF 3D8VA 1Q86H 3D5NA 2Q4JA 4B2WA 2BO6A 3CKJA 4KRVA 3JATB 5HXZA 1VZXA 4NALA 4KWEA 2BO8A 1FNJA 3V0LA 3HL3A 3IR9A 2P72A 3L7QA 3CMAF 5AJOA 2A8WA 3MDOA 1ZI5A 4FRAA 3SXCA 4FIYA 3NK6A 3MBMA 1W77A 3ZF8A 5G4VC 1YIJF 4EEMA 3ST8A 1RQ7A 1JYLA 3CD6F 1ZJ1A 5KMGB 3JUKA 4LCKA 2W0VA 3FPIA 1TZFA 3E25A 3OBWA 3N4YA 3V90A 2AM4A 2RHLA 2QI2A 3F6MA 3U0OA 4KXOA 1INIA 5JQGA 3DK5A 5CB4A 4Y7UA 2RHJA 1VICA 5FTSA 4EEGA 2CW4A 5EYPA 1PF5A 2HRYA 3N2GB 2LCAA 1FSZA 4YJ2A 3JTJA 5EIYA 2ALEA 1XHBA 1Z5WA 2RB9A 3M1XA 3G4SF 2WVKA 1GX1A 3CYPB 3Q8HA 3I0KA 1KNKA 4U39A 2DYYA 1HV9A 4M2BA 3O3PA 5ITZB 2HP3A 1JVDA 3CXCF 1LL2A 2GGQA 5CMFX 1WT1A 4C81A 4HO6A 5FU8A 1VGWA 1DBFA 1RLUA 2VK9A 4Q7CA 2QEXF 5CA0A 2UZHA 2I6DA 3JAWA 5KX5B 2MZBA 4BT3A 4KPZA 3SPTA 3JCMM 4TUYB 1FR8A 3CC7F 3CKNA 4R7PA 1R1MA 1W59A 1X25A 3IEQA 2J0AA 3FWWA 4BVSA 1Q7YH 4HO5A 3ZGGA 3TQDA 5CQPA 4KC2A 3SIVA 2APCA 5EAZA 4ERHA 4BW0B 4LW6A 2WAWA 4X1KA 3ZO8A 2XMEA 2Z86A 1H5TB 3HKDB 1QU9A 3BRKX 1H7MA 1H5TA 2AMTA 4ZHWA 1O23B 2VXMA 1PXWA 2Y4MA 3V0PA 3LMEA 5CMGX 1VQ5F 4KPXA 1U3LA 3UT5A 4HG6A 2YC5A 5C4CA 1IPAA 4TV9B 2OEGA 2VS3A 1FFXB 4M8IA 1WT2A 1FO8A 5FLXM 1W5FA 4TV9A 1RA4A 4EVWA 1FFXA 1W5BA 3I0FA 1S4PA 3JALA 4KC1A 3GUEA 4G88A 1X7PA 2R751 1WSZA 3ON1A 2H8EA 1ON8A 5IJ9A 2GLZA 2XWNA 1R82A 2OI5A 3C9RA 2VAMA 3KE1A 4KC4A 2AE7A 3VOBA 4I55A 1YP4A 3CKQA 3K8DA 3POLA 1ZCYA 3U2XA 4AC3A 4BVQA 1YQNA 4I55B 3CCEF 4B4BA 1IV2A 3S0YA 2WGZA 1M90H 3WGKA 2Y4LA 1H4DA 1CLIA 2FYCB 1KNJA 4G4YA 4B42A 1OAPA 1KC8H 3E22A 3CB2A 5EO3A 1FXOA 1IINA 1HM9A 3QVBA 3E22B 5AJPA 4MIXA 1ON6A 3Q7UA 1W55A 4O2BB 3I56F 4BY9D 3OKRA 2BTUA 2WALA 2PMPA 2JCKA 2HP0B 4ZHVA 2RIXA 5C3DA 4O2BA 3SXGA 5FV9A 4BVRA 1H5RA 1U3PA 4ZHQA 2H6LA 5C8YB 1R81A 3NGWA 5CA1B 5C1HA 4ECMA 5BMVB 2QA4F 5CA1A 3T7OA 2AM5A 1VH1A 4CJBA 4BT6A 5BMVA 2RHHA 1H5SB 1HJLA 2AIZP 1NF5B 2FFUA 4LNUA 3E20B 3F1YA 3D01A 3CG6A 1H5SA 1MP3A 2O1FA 5C4FA 4DE7A 3HKBA 3IEWA 1XV2A 5I1FA 1QVGF 1WVCA 2RITA 2PX7A 2V0KA 4U3JA 5CQLX 1UI9A 2DPWA 2NMUA 3B6NA 3HKEA 3PLAC 2IG8A 2KG4A 2BO7A 4FRPA 3VYUC 3HKEB 1W581 1G3LA 1R7VA 5EWRA 3RMWA 4DRXB 2X5ZA 2CVLA 2GZLA 3N4ZA 3IOHA 4ZDQA 1Q82H 2LBWA 1FNKA 2Z1TA 5B8FA 2OTLF 1J7HA 1Q8RA 1QAHA 4O4JA 1SZQA 3K2XA 2E3DA 1ZJOA 4X3MA 4FFBB 2H8CA 3LYBA 3LWVC 1HM8A 4C2SA 5EZYA 2CWJA 1G97A 1YHQF 4O4LA 5EZYB 1DT9A 3VYTC 4Y63A 1JN1A 3F0GA 4BT5A 3OW2F 1GWVA 4FQWA 5CQMX 4O4LB 3OONA 5IJ0A 5C3AA 5JQQA 4EI8A 1COMA 2PHNA 2VAPA 1H7QA 4G3PA 2IQQA 1R7YA 3PAFA 5D91A 1H48A 5MN6A 1VQ7F 2XWLA 4C8IA 3J80M 2OI7A 3CYQA 5JVDB 1FO9A 2RJ9A 4B5CA 2AESA 1KWSA 3V8ZA 5JH7B 5EJZA 2VGMA 3F0DA 2ZVYA 5JH7A 4O4HA 3ZP7A 2CSLA 2DT4A 1KQSF 4KQLA 1GZ0A 4EE4A 3AGKA 4CVHA 2FGYA 3IMPA 2XMHA 1H7GA 3RYHA 3V3TA 3KJKA 4ZK7A 1VQPF 1YROB 3WXMB 2V0HA 4HO9A 1NMUB 2HS3A 4I4TA 1FRWA 4NWOB 5CQNX 1G23A 1FR9A 1W40A 3LFOA 1OQMB 4I4TB 1W2BF 2QTPA 4G4VA 1VPAA 4ZOLA 5MN5A 2AM3A 3EE5A 3CCSF 2K1SA 2FC3A 4HO4A 1IV4A 1ZIZA 4ZOLB 3OH3A 2XWMA 1TVYA 3SXDA 1LL3A 2RIZA 1ONIA 2VS5A 2W8BC 2RJ6A 3U2TA 3R3IA 5C4BA 2AECA 5FTVA 4B4GA 1FXJA 4IRPA 4KNXA 3T7NA 3CCUF 1V84A 1K9MH 3K0TA 3MCAB 3RYIA 1E7KA 2OTJF 4Y62A 5AJNA 3JATA 1XHOA 2OI6A 2JCJA 2ICYA 4Y7TA 5IFYA 4C8EA 2UYNA 5CQOA 3P10A 3HAXD 1W41A 1XRGA 2FYDB 2RJ8A 2UYNB 4FREA 4BQHA 2CHSA 4I50A 3WGMA 4DXDA 3DUVA 3JUJA 2CHTA 4CJCA 5HY0A 3LDTA 2YQCA 1S4OA 4D0ZA 1OMZA 1I52A 1PZTA 1KD1H 3OH2A 3OH0A 4BT7A 1GWWA 4MYBA 3SXAA 1YJNF 3JVHA 2D7RA 3PKQA 1TVKB 1QGQA 2YXZA 5CB4B 1YI2F 3FOQA 1TVKA 2LBXA 3F0EA 1N8RH 2YQSA 3F1CA 3I0GA 5GIOC 4FRLA 4F6RB 3N2GA 3E1YA 2AGDA 4AYJA 1K8AH 4F6RA 3VO8A 1JJ2F 4G4ZA 3GYQA 3K8EA 4HOCA 1G9RA 2Z1UA 4B4MA 5A2QM 3ZLLA 1XZ6A 4IHJB 5GANK 1VGUA 4HNAA 5DCVA 2WEEA 1W57A 3CC4F 1SS9A 5ITZA 1W5AA 1V83A 4HNAB 3I0EA 5C1GA 2BTOA 4FIXA 1H3MA 4JD0A 1JD1A 1PZYB 1GQ9A 2V9YA 3SX5A 1QVFF 3JARB 3BYQA 1H7EA 3I0JA 5CA0B 1SA0B 1JVGA 3T7MA 3TD5A 4E6EA 5HY1A 3WPXA 3JARA 3OAMA 5J49A 5LA6B 4TUYA 5LOVB 3MQWA 3J7AR 2VSIA 3KJJA 2QH5A 1FGGA 1LZIA 2HVYD 2Z1EA 3ZLKA 2HS4A 1YJ9F 2C0NA 3U2WA 3OH1A 3S0HA 3I0IX 4G3QA 5D92A 4M2AA 1LZ7A 4X1KB 2RIYA 1WT3A 3PKPA 1LL0A 2LBTA 4B46A 3RYCA 3TZTA 3LW6A 2JNBA 4BT4A 2YCMA 3SX3A 3ELCA 4P00A 2YQHA 3V91A 4AYLA 3I55F 4FRDA 2AIFA 2MQEA 3D54A 2A8UA 3UT5B 4WBNA 4ZHYB 5HY2A 5GIPC 1ZCTA 3I0DA 1X52A 2VXYA 1M1KH 1ZI1A 3I3FA 4G3SA 1WT0A 3R0PA 2VFZA 4FRHA 3JALB 2Y6PA 4D48A 1JV1A 1ZI3A 3C9TA 5IJ9B 1FWYA 2WVLA 4B5BA 2VGNA 2UYKA 3RYFB 5HWEA 5J2UA 1TUBA 2ZF8A 3S03A 5IT9M 3Q80A 3RSBA 5C38A 3RYFA 1TUBB 3DC2A 2D0JA 2FY7A 5LP6A 4C8GA 5LYJA 3VMFB 5LP6B 1FGXA 3JAKB 1O7OA 5LYJB 1INJA 3WGLA 4IRQA 5BXCA 5C1LA 2V0IA 3JAKA 2G9IA 3WPWA 3O85A 3ZOPA 3V4DA 1NKHB 3M4SA 1ZDGA 3V7QA 1ZHJA 1YGYA 5C47A 1GO1A 4AAWA 5DDTA 3EORA 3HWUA 2HP0A 1ZJ3A 5IDSA 2O1HA 3IOIA 2VXLA 1H5RB 5C8YA 4ZHQB 1NJIH 4FRBA 4TZZA 1R7TA 3U0XA 1YP2A 2JCLA 1ZCVA 2ZOVA 4XWIA 4NANA 2I6RA 4IIJB 2Z87A 3ZP4A 3P0ZA 2YC3A 4TV8A 3NVIB 4LNUB 4IIJA 5EJ1A 1VQ9F 1VZTA 4NQ3A 3KIZA 4EEOA 5HP7A 1NQIB 3NVKE 2YQJA 4D11C 1VH8A 1G95A 3HKBB 1JY8A 1LVWA 2RJ4A 3SIUA 1K4VA 4P02A 5LXTA 1R80A 2OHWA 5JCOC 4U3JB 1MC3A 3V8YA 4D11A 1XBIA 5LXTB 2OZBA 2E8BA 2UYPA 3OGZA 3HTNA 2W0WA 4B3UA 2Y7AA 3V0NA 4M4KA 2Q1YA 3S0WA 3G6EF 4GBPA 4B45A 3LWRC 1VM8A 2FFVA 4FROA 5C36A 5KMGA 4Y6UA 3FBAA 1Q81H 2UYJA 1G1LA 4X3LA 2KGWA 3QTYA 5LP6C 2P73A 5JQGB 5CMIA 1CN7A 4ZI7B 5HS2A 1H7LA 4J18A 5EYPB
chains in the Genus database with same CATH topology
5FYEA 1VHAA 4KNRA 1U43A 1JYKA 1MP4A 3IOJA 1QGSA 5DDVA 2PGYA 1EYRA 3RE3A 1IIMA 1R7XA 1O0RA 1S4NA 4Y7FA 2QKXA 4FCEA 4NAIA 3USQA 5L6SA 2YESA 5C8RA 3BCVA 4E1KA 3D98A 2JCOA 2UX8A 5FU0A 3I0HA 1G0RA 1H47A 1HM0A 1V82A 1GX4A 2GGOA 3I0CA 3ZGFA 5C4EA 1NMMB 2D7IA 3CKVA 4ARWA 3SX7A 5CMJA 5FUHA 1ZJPA 4EE3A 3OH4A 2RJ1A 1ZJ0A 3CGXA 4D0TA 4DECA 3ERNA 2I5KA 5C3BA 1NWGB 3KIAA 3U2VA 3U0YA 3CU0A 2PA4A 1H7TA 1R7UA 1G8OA 3SX8A 4FRQA 1YP3A 2FYAA 1VGTA 1ZDFA 2ZU7A 1U40A 1MP5A 1EZIA 1VH3A 4KT7A 4JISA 1VZUA 1E5KA 1TW5A 4AYLA 2X5SA 3V0QA 4Y9XA 4YS8A 4Y6NA 1ZI4A 4L41C 4DDZA 4Y7GA 5C48A 3F0FA 4EE5A 3E26A 2X65A 4HCQA 1OMXA 1GQCA 2V0JA 3IKFA 2P6WA 5IDTA 1FOAA 1GX0A 3I0LA 1H5SD 3U2UA 4BMAA 2CU2A 2Y4KA 5C49A 4HO8A 1H5SC 4K6RA 1QG8A 1QWJA 2AH9A 4UEGA 4EEAA 2ICXA 2OEFA 4NAKA 3SXEA 1ZJ2A 4C82A 2RJ0A 1T0AA 3V0MA 2RJ5A 2QGIA 1FZWA 1NHEB 1H7HA 4O6MA 4CJ8A 1ZCUA 3PNNA 1FG5N 4Y7VA 2FYBA 3USRA 1H4CA 3ESJA 4HO0A 3CKOA 5C4DA 4ASJA 3DJ4A 2VSHA 3T7NA 3V0LA 3R2WA 1LZ0A 3Q4SA 2X60A 1JV3A 4Y64A 1LZJA 2I7BA 1Z90A 3IKEA 3OC9A 1IV1A 1IV3A 3V0OA 4LW3A 2NXVA 5L6VA 3QHDA 4HO3A 4G87A 1H4EA 1G93A 2BO4A 4MNDA 2O1GA 3N9WA 1VGZA 4FCUA 2WVMA 1TW1A 2ZU9A 3T80A 1HJJA 1GA8A 1O7QA 3RMVA 2PGVA 2WE9A 3SXBA 2Y4JA 5CMHA 4FRMA 2V0LA 2I5EA 2RJ7A 4M28A 2VD4A 1G2VA 4HO2A 3GHZA 2J0BA 4ASYA 1H7FA 3K14A 3D8VA 4B2WA 3D5NA 2Q4JA 5C3DA 2BO6A 3CKJA 4KRVA 4NALA 1VZXA 2BO8A 3HL3A 2P72A 2A8WA 3SXCA 1ZI5A 4FRAA 4FIYA 3MBMA 1W77A 3ZF8A 4EEMA 3ST8A 1JYLA 1ZJ1A 3JUKA 2W0VA 3FPIA 1TZFA 3E25A 2AM4A 3F6MA 4KXOA 5FTSA 1INIA 3DK5A 4EEGA 1VICA 3JTJA 5EIYA 1XHBA 3I0KA 2WVKA 1GX1A 3Q8HA 1KNKA 1HV9A 4M2BA 3O3PA 1JVDA 1LL2A 2GGQA 5CMFX 1WT1A 4C81A 4HO6A 5FU8A 1VGWA 2VK9A 4Q7CA 2UZHA 2MZBA 4KPZA 3SPTA 1FR8A 3CKNA 4R7PA 3IEQA 2J0AA 3FWWA 4HO5A 3ZGGA 3TQDA 5CQPA 4KC2A 2APCA 4LW6A 2WAWA 2XMEA 2Z86A 1H5TB 3BRKX 1H5TA 2AMTA 1O23B 2VXMA 2Y4MA 3V0PA 5CMGX 4KPXA 1U3LA 4HG6A 2YC5A 5C4CA 2VS3A 2OEGA 1WT2A 1FO8A 4EVWA 3I0FA 4Y7TA 1S4PA 4KC1A 3GUEA 1WSZA 1ON8A 2XWNA 1R82A 2OI5A 3KE1A 4KC4A 2AE7A 1YP4A 3CKQA 3K8DA 3POLA 1ZCYA 3U2XA 4AC3A 4B4BA 1YQNA 1IV2A 2WGZA 2Y4LA 1H4DA 2FYCB 1KNJA 4B42A 1FXOA 1IINA 1HM9A 3QVBA 5AJPA 4MIXA 1ON6A 3Q7UA 1W55A 4O6NA 3OKRA 2JCKA 2PMPA 2RIXA 3SXGA 5FV9A 1H5RA 1U3PA 1R81A 3NGWA 5C1HA 4ECMA 3T7OA 2AM5A 1VH1A 4CJBA 1HJLA 1H5SB 2FFUA 1NF5B 3F1YA 1H5SA 1MP3A 2O1FA 5C4FA 4DE7A 3IEWA 5I1FA 1WVCA 2RITA 2PX7A 2V0KA 5CQLX 2DPWA 3B6NA 4FRPA 2BO7A 1G3LA 1R7VA 3RMWA 2X5ZA 3IOHA 2GZLA 4ZDQA 5B8FA 2E3DA 3K2XA 1ZJOA 4C2SA 1HM8A 1G97A 4Y7UA 4Y63A 5AJOA 3F0GA 1JN1A 4FQWA 1GWVA 5CQMX 5C3AA 5JQQA 1H7QA 4G3PA 1R7YA 5D91A 1H48A 2XWLA 4C8IA 2OI7A 1FO9A 2RJ9A 2AESA 1KWSA 3V8ZA 5EJZA 3F0DA 4KQLA 4EE4A 4CVHA 2XMHA 1H7GA 4HO9A 1YROB 2V0HA 1FRWA 5CQNX 1G23A 1FR9A 1VPAA 1OQMB 2VS4A 2ZU8A 3EE5A 2AM3A 3SXAA 4HO4A 1IV4A 1ZIZA 3OH3A 2XWMA 1TVYA 3SXDA 1LL3A 2RIZA 2VS5A 3U2TA 2RJ6A 3R3IA 5C4BA 2AECA 5FTVA 4B4GA 1FXJA 4IRPA 4KNXA 1V84A 4Y62A 5AJNA 2OI6A 2JCJA 2ICYA 5IFYA 4C8EA 5CQOA 3P10A 2FYDB 2RJ8A 4BQHA 4FREA 3JUJA 3DUVA 4CJCA 2YQCA 1S4OA 4D0ZA 1OMZA 1I52A 1PZTA 3OH2A 3OH0A 1GWWA 4MYBA 3JVHA 2D7RA 3PKQA 1QGQA 3FOQA 3F0EA 3F1CA 2YQSA 3I0GA 4FRLA 2AGDA 4AYJA 3K8EA 4HOCA 1G9RA 4B4MA 3ZLLA 1XZ6A 1VGUA 2WEEA 1W57A 1SS9A 1V83A 3I0EA 5C1GA 4B2XA 4FIXA 1H3MA 4JD0A 1PZYB 1GQ9A 3SX5A 1H7EA 3I0JA 3T7MA 1JVGA 3V90A 5J49A 3OAMA 2VSIA 2QH5A 1FGGA 1LZIA 3ZLKA 2C0NA 3U2WA 3OH1A 3I0IX 4G3QA 5D92A 4M2AA 1LZ7A 2RIYA 1WT3A 3PKPA 1LL0A 3TZTA 3LW6A 2YCMA 3SX3A 3ELCA 4P00A 2YQHA 3V91A 4FRDA 2A8UA 1ZCTA 3I0DA 1ZI1A 4G3SA 1WT0A 2VFZA 4FRHA 4D48A 2Y6PA 1JV1A 1ZI3A 1FWYA 2WVLA 4B5BA 3Q80A 3RSBA 5C38A 2D0JA 2FY7A 4C8GA 1FGXA 1O7OA 1INJA 4IRQA 5BXCA 5C1LA 2V0IA 1NKHB 1ZDGA 1ZHJA 5C47A 4AAWA 5DDTA 3EORA 1ZJ3A 5IDSA 2O1HA 3IOIA 2VXLA 1H5RB 4FRBA 1R7TA 3U0XA 1YP2A 2JCLA 1ZCVA 4XWIA 4NANA 2Z87A 3P0ZA 2YC3A 5EJ1A 1VZTA 4EEOA 1NQIB 2YQJA 4D11C 1VH8A 1G95A 1JY8A 1LVWA 2RJ4A 1K4VA 4P02A 1R80A 3V8YA 4D11A 1MC3A 2E8BA 3OGZA 2W0WA 4B3UA 2Y7AA 3V0NA 4M4KA 4GBPA 1VM8A 2FFVA 4FROA 5C36A 4Y6UA 3FBAA 1G1LA 2P73A 5CMIA 5HS2A 1H7LA 4J18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYE A;  1VHA A;  4KNR A;  1U43 A;  1JYK A;  1MP4 A;  3IOJ A;  1QGS A;  5DDV A;  2PGY A;  1EYR A;  3RE3 A;  1IIM A;  1R7X A;  1O0R A;  1S4N A;  4Y7F A;  2QKX A;  4FCE A;  4NAI A;  3USQ A;  5L6S A;  2YES A;  5C8R A;  3BCV A;  4E1K A;  3D98 A;  2JCO A;  2UX8 A;  5FU0 A;  3I0H A;  1G0R A;  1H47 A;  1HM0 A;  1V82 A;  1GX4 A;  2GGO A;  3I0C A;  3ZGF A;  5C4E A;  1NMM B;  2D7I A;  3CKV A;  4ARW A;  3SX7 A;  5CMJ A;  5FUH A;  1ZJP A;  4EE3 A;  3OH4 A;  2RJ1 A;  1ZJ0 A;  3CGX A;  4D0T A;  4DEC A;  3ERN A;  2I5K A;  5C3B A;  1NWG B;  3KIA A;  3U2V A;  3U0Y A;  3CU0 A;  2PA4 A;  1H7T A;  1R7U A;  1G8O A;  3SX8 A;  4FRQ A;  1YP3 A;  2FYA A;  1VGT A;  1ZDF A;  2ZU7 A;  1U40 A;  1MP5 A;  1EZI A;  1VH3 A;  4KT7 A;  4JIS A;  1VZU A;  1E5K A;  1TW5 A;  4AYL A;  2X5S A;  3V0Q A;  4Y9X A;  4YS8 A;  4Y6N A;  1ZI4 A;  4L41 C;  4DDZ A;  4Y7G A;  5C48 A;  3F0F A;  4EE5 A;  3E26 A;  2X65 A;  4HCQ A;  1OMX A;  1GQC A;  2V0J A;  3IKF A;  2P6W A;  5IDT A;  1FOA A;  1GX0 A;  3I0L A;  1H5S D;  3U2U A;  4BMA A;  2CU2 A;  2Y4K A;  5C49 A;  4HO8 A;  1H5S C;  4K6R A;  1QG8 A;  1QWJ A;  2AH9 A;  4UEG A;  4EEA A;  2ICX A;  2OEF A;  4NAK A;  3SXE A;  1ZJ2 A;  4C82 A;  2RJ0 A;  1T0A A;  3V0M A;  2RJ5 A;  2QGI A;  1FZW A;  1NHE B;  1H7H A;  4CJ8 A;  1ZCU A;  3PNN A;  1FG5 N;  4Y7V A;  2FYB A;  3USR A;  1H4C A;  3ESJ A;  4HO0 A;  3CKO A;  5C4D A;  4ASJ A;  3DJ4 A;  2VSH A;  3T7N A;  3V0L A;  3R2W A;  1LZ0 A;  3Q4S A;  2X60 A;  1JV3 A;  4Y64 A;  1LZJ A;  2I7B A;  1Z90 A;  3IKE A;  3OC9 A;  1IV1 A;  1IV3 A;  3V0O A;  4LW3 A;  2NXV A;  5L6V A;  3QHD A;  4HO3 A;  4G87 A;  1H4E A;  1G93 A;  2BO4 A;  4MND A;  2O1G A;  3N9W A;  1VGZ A;  4FCU A;  2WVM A;  1TW1 A;  2ZU9 A;  3T80 A;  1HJJ A;  1GA8 A;  1O7Q A;  3RMV A;  2PGV A;  2WE9 A;  3SXB A;  2Y4J A;  5CMH A;  4FRM A;  2V0L A;  2I5E A;  2RJ7 A;  4M28 A;  2VD4 A;  1G2V A;  4HO2 A;  3GHZ A;  4ASY A;  1H7F A;  3K14 A;  3D8V A;  4B2W A;  3D5N A;  2Q4J A;  5C3D A;  2BO6 A;  3CKJ A;  4KRV A;  4NAL A;  1VZX A;  2BO8 A;  3HL3 A;  2P72 A;  2A8W A;  3SXC A;  1ZI5 A;  4FRA A;  3MBM A;  1W77 A;  3ZF8 A;  4EEM A;  3ST8 A;  1JYL A;  1ZJ1 A;  3JUK A;  2W0V A;  3FPI A;  1TZF A;  3E25 A;  2AM4 A;  3F6M A;  4KXO A;  5FTS A;  1INI A;  3DK5 A;  4EEG A;  1VIC A;  3JTJ A;  5EIY A;  1XHB A;  3I0K A;  2WVK A;  1GX1 A;  3Q8H A;  1KNK A;  1HV9 A;  4M2B A;  3O3P A;  1JVD A;  1LL2 A;  2GGQ A;  5CMF X;  1WT1 A;  4C81 A;  4HO6 A;  5FU8 A;  1VGW A;  2UZH A;  2MZB A;  4KPZ A;  3SPT A;  1FR8 A;  3CKN A;  4R7P A;  3IEQ A;  3FWW A;  4HO5 A;  3ZGG A;  3TQD A;  5CQP A;  4KC2 A;  2APC A;  4LW6 A;  2WAW A;  2XME A;  2Z86 A;  1H5T B;  3BRK X;  1H5T A;  2AMT A;  1O23 B;  2VXM A;  2Y4M A;  3V0P A;  5CMG X;  4KPX A;  1U3L A;  4HG6 A;  2YC5 A;  5C4C A;  2VS3 A;  2OEG A;  1WT2 A;  1FO8 A;  4EVW A;  3I0F A;  4Y7T A;  1S4P A;  4KC1 A;  3GUE A;  1WSZ A;  1ON8 A;  2XWN A;  1R82 A;  2OI5 A;  3KE1 A;  4KC4 A;  2AE7 A;  1YP4 A;  3CKQ A;  3K8D A;  3POL A;  1ZCY A;  3U2X A;  4AC3 A;  4B4B A;  1YQN A;  1IV2 A;  2WGZ A;  2Y4L A;  1H4D A;  2FYC B;  1KNJ A;  4B42 A;  1FXO A;  1IIN A;  1HM9 A;  3QVB A;  5AJP A;  1ON6 A;  3Q7U A;  1W55 A;  3OKR A;  2JCK A;  2PMP A;  2RIX A;  3SXG A;  5FV9 A;  1H5R A;  1U3P A;  1R81 A;  3NGW A;  5C1H A;  4ECM A;  3T7O A;  2AM5 A;  1VH1 A;  4CJB A;  1HJL A;  1H5S B;  2FFU A;  1NF5 B;  3F1Y A;  1H5S A;  1MP3 A;  2O1F A;  5C4F A;  4DE7 A;  3IEW A;  5I1F A;  1WVC A;  2RIT A;  2PX7 A;  2V0K A;  5CQL X;  2DPW A;  3B6N A;  4FRP A;  2BO7 A;  1G3L A;  1R7V A;  3RMW A;  2X5Z A;  3IOH A;  2GZL A;  4ZDQ A;  5B8F A;  2E3D A;  3K2X A;  1ZJO A;  4C2S A;  1HM8 A;  1G97 A;  4Y7U A;  4Y63 A;  5AJO A;  3F0G A;  1JN1 A;  4FQW A;  1GWV A;  5CQM X;  5C3A A;  5JQQ A;  1H7Q A;  4G3P A;  1R7Y A;  1H48 A;  2XWL A;  4C8I A;  2OI7 A;  1FO9 A;  2RJ9 A;  2AES A;  1KWS A;  3V8Z A;  5EJZ A;  3F0D A;  4KQL A;  4EE4 A;  4CVH A;  2XMH A;  1H7G A;  4HO9 A;  1YRO B;  2V0H A;  1FRW A;  5CQN X;  1G23 A;  1FR9 A;  1VPA A;  1OQM B;  2VS4 A;  2ZU8 A;  3EE5 A;  2AM3 A;  3SXA A;  4HO4 A;  1IV4 A;  1ZIZ A;  3OH3 A;  2XWM A;  1TVY A;  3SXD A;  1LL3 A;  2RIZ A;  2VS5 A;  3U2T A;  2RJ6 A;  3R3I A;  5C4B A;  2AEC A;  5FTV A;  4B4G A;  1FXJ A;  4IRP A;  4KNX A;  1V84 A;  4Y62 A;  5AJN A;  2OI6 A;  2JCJ A;  2ICY A;  5IFY A;  4C8E A;  5CQO A;  3P10 A;  2FYD B;  2RJ8 A;  4BQH A;  4FRE A;  3JUJ A;  3DUV A;  4CJC A;  2YQC A;  1S4O A;  4D0Z A;  1OMZ A;  1I52 A;  1PZT A;  3OH2 A;  3OH0 A;  1GWW A;  4MYB A;  3JVH A;  2D7R A;  3PKQ A;  1QGQ A;  3FOQ A;  3F0E A;  3F1C A;  2YQS A;  3I0G A;  4FRL A;  2AGD A;  4AYJ A;  3K8E A;  4HOC A;  1G9R A;  4B4M A;  3ZLL A;  1XZ6 A;  1VGU A;  2WEE A;  1W57 A;  1SS9 A;  1V83 A;  3I0E A;  5C1G A;  4B2X A;  1H3M A;  4JD0 A;  1PZY B;  1GQ9 A;  3SX5 A;  1H7E A;  3I0J A;  3T7M A;  1JVG A;  3V90 A;  5J49 A;  3OAM A;  2VSI A;  2QH5 A;  1FGG A;  1LZI A;  3ZLK A;  3U2W A;  3OH1 A;  3I0I X;  4G3Q A;  4M2A A;  1LZ7 A;  2RIY A;  1WT3 A;  3PKP A;  1LL0 A;  3TZT A;  3LW6 A;  2YCM A;  3SX3 A;  3ELC A;  4P00 A;  2YQH A;  3V91 A;  4FRD A;  2A8U A;  1ZCT A;  3I0D A;  1ZI1 A;  4G3S A;  1WT0 A;  2VFZ A;  4FRH A;  4D48 A;  2Y6P A;  1JV1 A;  1ZI3 A;  1FWY A;  2WVL A;  4B5B A;  3Q80 A;  3RSB A;  5C38 A;  2D0J A;  2FY7 A;  4C8G A;  1FGX A;  1O7O A;  1INJ A;  4IRQ A;  5BXC A;  5C1L A;  2V0I A;  1NKH B;  1ZDG A;  1ZHJ A;  5C47 A;  4AAW A;  5DDT A;  3EOR A;  1ZJ3 A;  5IDS A;  2O1H A;  3IOI A;  2VXL A;  1H5R B;  4FRB A;  1R7T A;  3U0X A;  1YP2 A;  2JCL A;  1ZCV A;  4XWI A;  4NAN A;  2Z87 A;  3P0Z A;  2YC3 A;  5EJ1 A;  1VZT A;  4EEO A;  1NQI B;  2YQJ A;  4D11 C;  1VH8 A;  1G95 A;  1JY8 A;  1LVW A;  2RJ4 A;  1K4V A;  4P02 A;  1R80 A;  3V8Y A;  4D11 A;  1MC3 A;  2E8B A;  3OGZ A;  2W0W A;  4B3U A;  2Y7A A;  3V0N A;  4M4K A;  4GBP A;  1VM8 A;  2FFV A;  4FRO A;  5C36 A;  4Y6U A;  3FBA A;  1G1L A;  2P73 A;  5CMI A;  5HS2 A;  1H7L A;  4J18 A; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  3N2K A;  5FJ4 C;  5FYE A;  4YJ2 B;  1VHA A;  5FNV A;  3N2K B;  3CME F;  3V7E A;  1W5E A;  4KNR A;  5FNV B;  3VYS C;  1U43 A;  1VQO F;  2F9Z C;  2IAF A;  1JYK A;  1MP4 A;  3IOJ A;  1QGS A;  5DDV A;  5JVD A;  2PGY A;  3CPW F;  2BTQ B;  1EYR A;  2B33 A;  3RE3 A;  1IIM A;  1R7X A;  3M84 A;  3FFM A;  1O0R A;  1S4N A;  4Y7F A;  2QKX A;  4O4H B;  4FCE A;  4NAI A;  3USQ A;  3JAW B;  5KX5 A;  2YES A;  5C8R A;  3BCV A;  5L6S A;  4E1K A;  3FD6 A;  3D98 A;  2JCO A;  3MCQ A;  5IYZ B;  2UX8 A;  3RYH B;  5FU0 A;  3I0H A;  5IYZ A;  1YIT F;  1VK3 A;  1H47 A;  1G0R A;  1HM0 A;  1V82 A;  4R40 B;  1GX4 A;  2GGO A;  3I0C A;  3ZGF A;  5C4E A;  1NMM B;  2D7I A;  2GVI A;  3CKV A;  2CZW A;  4ARW A;  2KTV A;  3VI6 A;  3WGN A;  1OFU A;  3SX7 A;  3HKD A;  5CMJ A;  3CCR F;  3I7T A;  3NMU C;  3V0Q A;  2KTU A;  3HJW C;  5FUH A;  1ZJP A;  2EWC A;  4RQO A;  3LWP C;  4EE3 A;  3OH4 A;  2RJ1 A;  1VQM F;  1ZJ0 A;  4X20 A;  3CGX A;  4D0T A;  4X20 B;  4X1I B;  1VQN F;  4DEC A;  3RYI B;  5GAP K;  5HXU A;  2ZAU A;  3ERN A;  4RHA A;  4X1I A;  2I5K A;  5C3B A;  1NWG B;  3KIA A;  3U2V A;  3U0Y A;  3LWQ C;  3FD5 A;  3TD4 A;  2PA4 A;  3CU0 A;  1H7T A;  2RHO A;  1R7U A;  4I50 B;  1G8O A;  3SX8 A;  3JAM M;  4FRQ A;  1YP3 A;  3WJR A;  1NQ3 A;  3NK7 A;  2FYA A;  1VGT A;  1ZDF A;  2ZU7 A;  4C4W C;  1U40 A;  1GO0 A;  1MP5 A;  1EZI A;  5EIB C;  1VH3 A;  4KT7 A;  4JIS A;  3RA6 A;  5G4U C;  1VZU A;  3C9S A;  5EIB D;  4B62 A;  1E5K A;  3CCL F;  3VTI C;  1TW5 A;  5EB0 A;  1VQK F;  2X5S A;  1UFY A;  4Y9X A;  4Y6N A;  1Z5V A;  4O4I A;  4XCQ A;  1VQ4 F;  1ZI4 A;  4L41 C;  4YS8 A;  4DDZ A;  3DDN A;  3K12 A;  3QUW A;  4Y7G A;  3F0F A;  4O4I B;  5C48 A;  4EE5 A;  5MN4 A;  4BVT A;  4IHJ A;  3E26 A;  2X65 A;  4HCQ A;  1OMX A;  1GQC A;  2V0J A;  3IKF A;  2P6W A;  4PWT A;  5IDT A;  1FOA A;  1GX0 A;  1ODE A;  5JCO A;  3VOA A;  4EB6 A;  4O2A B;  1YJW F;  1S72 F;  3I0L A;  1SA0 A;  2Z01 A;  1W42 A;  1H5S D;  2ZU8 A;  3CCM F;  4EB6 B;  4X1Y B;  4O2A A;  5J2T A;  2CU2 A;  5LA6 A;  2Y4K A;  5LOV A;  4HO8 A;  3U2U A;  4BMA A;  1H5S C;  1ZWZ A;  2BO1 A;  4X1Y A;  5J2T B;  1T0K B;  1QG8 A;  1QWJ A;  2AH9 A;  4K6R A;  2ICX A;  4UEG A;  5AVM A;  4EEA A;  3CCQ F;  2OEF A;  2HX0 A;  2L26 A;  3J81 M;  5HP8 A;  5GIN C;  1VQ8 F;  4NAK A;  3SXE A;  4G4X A;  1ZJ2 A;  4C82 A;  5GON A;  2RJ0 A;  1T0A A;  3CPQ A;  5HY4 A;  3RA5 A;  2YYE A;  5EB1 B;  5GON B;  4DRX A;  5C49 A;  1JFF B;  1VQL F;  2QGI A;  1FZW A;  3P4E A;  2RJ5 A;  3V0M A;  3RYC B;  1NHE B;  1JFF A;  1W3E X;  4BT2 A;  1H7H A;  4O6M A;  4B2X A;  4CJ8 A;  4O4J B;  4EI9 A;  1ZCU A;  4FFB A;  3HKC B;  1X7O A;  3PNN A;  1FG5 N;  4WBN B;  4Y7V A;  2FYB A;  3HKC A;  3CC2 F;  3USR A;  5IJ0 B;  1H4C A;  3ESJ A;  1RLG A;  4HO0 A;  2Q1X A;  3CKO A;  3LWO C;  5C4D A;  3TD3 A;  4ASJ A;  3DJ4 A;  1QD9 A;  5J2U B;  2P6Y A;  2VSH A;  1RQ2 A;  4YJ3 A;  3R2W A;  3OBY A;  1LZ0 A;  3WJQ A;  3S02 A;  1JV3 A;  2X60 A;  3Q4S A;  1CK2 A;  4YJ3 B;  2HRU A;  1VQ6 F;  3WGJ A;  1LZJ A;  2OTM A;  2I7B A;  1Z90 A;  4Y64 A;  3JAS A;  3IKE A;  3OC9 A;  1IV1 A;  1IV3 A;  3KHN A;  3V0O A;  4EI7 A;  4LW3 A;  3JAS B;  3C8L A;  2NXV A;  3QHD A;  5L6V A;  4HO3 A;  1K73 H;  2Z1F A;  4G87 A;  3D00 A;  1H4E A;  1G93 A;  4O6N A;  1VQV A;  2R6R 1;  2BO4 A;  4MND A;  2O1G A;  3N9W A;  1VGZ A;  4FCU A;  2WVM A;  4NUT A;  3WJP A;  1TW1 A;  2ZU9 A;  3T80 A;  2HQS C;  1HJJ A;  1GA8 A;  1SDS A;  3S06 A;  1O7Q A;  3RMV A;  2PGV A;  2WE9 A;  3SXB A;  3VIU A;  2Y4J A;  2VAW A;  3VCZ A;  5CMH A;  4FRM A;  3C9U A;  3GTZ A;  2V0L A;  2I5E A;  2RJ7 A;  2VS4 A;  2ZOD A;  2VD4 A;  2HS0 A;  4M28 A;  1G2V A;  4G4W A;  3GHZ A;  4HO2 A;  2ZVZ A;  3G71 F;  2J0B A;  4TV8 B;  4ASY A;  3CCJ F;  3K14 A;  1H7F A;  2N48 A;  3CCV F;  3D8V A;  1Q86 H;  3D5N A;  2Q4J A;  4B2W A;  2BO6 A;  3CKJ A;  4KRV A;  3JAT B;  5HXZ A;  1VZX A;  4NAL A;  4KWE A;  2BO8 A;  1FNJ A;  3V0L A;  3HL3 A;  3IR9 A;  2P72 A;  3L7Q A;  3CMA F;  5AJO A;  2A8W A;  3MDO A;  1ZI5 A;  4FRA A;  3SXC A;  4FIY A;  3NK6 A;  3MBM A;  1W77 A;  3ZF8 A;  5G4V C;  1YIJ F;  4EEM A;  3ST8 A;  1RQ7 A;  1JYL A;  3CD6 F;  1ZJ1 A;  5KMG B;  3JUK A;  4LCK A;  2W0V A;  3FPI A;  1TZF A;  3E25 A;  3OBW A;  3N4Y A;  3V90 A;  2AM4 A;  2RHL A;  2QI2 A;  3F6M A;  3U0O A;  4KXO A;  1INI A;  5JQG A;  3DK5 A;  5CB4 A;  4Y7U A;  2RHJ A;  1VIC A;  5FTS A;  4EEG A;  2CW4 A;  5EYP A;  1PF5 A;  2HRY A;  3N2G B;  2LCA A;  1FSZ A;  4YJ2 A;  3JTJ A;  5EIY A;  2ALE A;  1XHB A;  1Z5W A;  2RB9 A;  3M1X A;  3G4S F;  2WVK A;  1GX1 A;  3CYP B;  3Q8H A;  3I0K A;  1KNK A;  4U39 A;  2DYY A;  1HV9 A;  4M2B A;  3O3P A;  5ITZ B;  2HP3 A;  1JVD A;  3CXC F;  1LL2 A;  2GGQ A;  5CMF X;  1WT1 A;  4C81 A;  4HO6 A;  5FU8 A;  1VGW A;  1DBF A;  1RLU A;  2VK9 A;  4Q7C A;  2QEX F;  5CA0 A;  2UZH A;  2I6D A;  3JAW A;  5KX5 B;  2MZB A;  4BT3 A;  4KPZ A;  3SPT A;  3JCM M;  4TUY B;  1FR8 A;  3CC7 F;  3CKN A;  4R7P A;  1R1M A;  1W59 A;  1X25 A;  3IEQ A;  2J0A A;  3FWW A;  4BVS A;  1Q7Y H;  4HO5 A;  3ZGG A;  3TQD A;  5CQP A;  4KC2 A;  3SIV A;  2APC A;  5EAZ A;  4ERH A;  4BW0 B;  4LW6 A;  2WAW A;  4X1K A;  3ZO8 A;  2XME A;  2Z86 A;  1H5T B;  3HKD B;  1QU9 A;  3BRK X;  1H7M A;  1H5T A;  2AMT A;  4ZHW A;  1O23 B;  2VXM A;  1PXW A;  2Y4M A;  3V0P A;  3LME A;  5CMG X;  1VQ5 F;  4KPX A;  1U3L A;  3UT5 A;  4HG6 A;  2YC5 A;  5C4C A;  1IPA A;  4TV9 B;  2OEG A;  2VS3 A;  1FFX B;  4M8I A;  1WT2 A;  1FO8 A;  5FLX M;  1W5F A;  4TV9 A;  1RA4 A;  4EVW A;  1FFX A;  1W5B A;  3I0F A;  1S4P A;  3JAL A;  4KC1 A;  3GUE A;  4G88 A;  1X7P A;  2R75 1;  1WSZ A;  3ON1 A;  2H8E A;  1ON8 A;  5IJ9 A;  2GLZ A;  2XWN A;  1R82 A;  2OI5 A;  3C9R A;  2VAM A;  3KE1 A;  4KC4 A;  2AE7 A;  3VOB A;  4I55 A;  1YP4 A;  3CKQ A;  3K8D A;  3POL A;  1ZCY A;  3U2X A;  4AC3 A;  4BVQ A;  1YQN A;  4I55 B;  3CCE F;  4B4B A;  1IV2 A;  3S0Y A;  2WGZ A;  1M90 H;  3WGK A;  2Y4L A;  1H4D A;  1CLI A;  2FYC B;  1KNJ A;  4G4Y A;  4B42 A;  1OAP A;  1KC8 H;  3E22 A;  3CB2 A;  5EO3 A;  1FXO A;  1IIN A;  1HM9 A;  3QVB A;  3E22 B;  5AJP A;  4MIX A;  1ON6 A;  3Q7U A;  1W55 A;  4O2B B;  3I56 F;  4BY9 D;  3OKR A;  2BTU A;  2WAL A;  2PMP A;  2JCK A;  2HP0 B;  4ZHV A;  2RIX A;  5C3D A;  4O2B A;  3SXG A;  5FV9 A;  4BVR A;  1H5R A;  1U3P A;  4ZHQ A;  2H6L A;  5C8Y B;  1R81 A;  3NGW A;  5CA1 B;  5C1H A;  4ECM A;  5BMV B;  2QA4 F;  5CA1 A;  3T7O A;  2AM5 A;  1VH1 A;  4CJB A;  4BT6 A;  5BMV A;  2RHH A;  1H5S B;  1HJL A;  2AIZ P;  1NF5 B;  2FFU A;  4LNU A;  3E20 B;  3F1Y A;  3D01 A;  3CG6 A;  1H5S A;  1MP3 A;  2O1F A;  5C4F A;  4DE7 A;  3HKB A;  3IEW A;  1XV2 A;  5I1F A;  1QVG F;  1WVC A;  2RIT A;  2PX7 A;  2V0K A;  4U3J A;  5CQL X;  1UI9 A;  2DPW A;  2NMU A;  3B6N A;  3HKE A;  3PLA C;  2IG8 A;  2KG4 A;  2BO7 A;  4FRP A;  3VYU C;  3HKE B;  1W58 1;  1G3L A;  1R7V A;  5EWR A;  3RMW A;  4DRX B;  2X5Z A;  2CVL A;  2GZL A;  3N4Z A;  3IOH A;  4ZDQ A;  1Q82 H;  2LBW A;  1FNK A;  2Z1T A;  5B8F A;  2OTL F;  1J7H A;  1Q8R A;  1QAH A;  4O4J A;  1SZQ A;  3K2X A;  2E3D A;  1ZJO A;  4X3M A;  4FFB B;  2H8C A;  3LYB A;  3LWV C;  1HM8 A;  4C2S A;  5EZY A;  2CWJ A;  1G97 A;  1YHQ F;  4O4L A;  5EZY B;  1DT9 A;  3VYT C;  4Y63 A;  1JN1 A;  3F0G A;  4BT5 A;  3OW2 F;  1GWV A;  4FQW A;  5CQM X;  4O4L B;  3OON A;  5IJ0 A;  5C3A A;  5JQQ A;  4EI8 A;  1COM A;  2PHN A;  2VAP A;  1H7Q A;  4G3P A;  2IQQ A;  1R7Y A;  3PAF A;  5D91 A;  1H48 A;  5MN6 A;  1VQ7 F;  2XWL A;  4C8I A;  3J80 M;  2OI7 A;  3CYQ A;  5JVD B;  1FO9 A;  2RJ9 A;  4B5C A;  2AES A;  1KWS A;  3V8Z A;  5JH7 B;  5EJZ A;  2VGM A;  3F0D A;  2ZVY A;  5JH7 A;  4O4H A;  3ZP7 A;  2CSL A;  2DT4 A;  1KQS F;  4KQL A;  1GZ0 A;  4EE4 A;  3AGK A;  4CVH A;  2FGY A;  3IMP A;  2XMH A;  1H7G A;  3RYH A;  3V3T A;  3KJK A;  4ZK7 A;  1VQP F;  1YRO B;  3WXM B;  2V0H A;  4HO9 A;  1NMU B;  2HS3 A;  4I4T A;  1FRW A;  4NWO B;  5CQN X;  1G23 A;  1FR9 A;  1W40 A;  3LFO A;  1OQM B;  4I4T B;  1W2B F;  2QTP A;  4G4V A;  1VPA A;  4ZOL A;  5MN5 A;  2AM3 A;  3EE5 A;  3CCS F;  2K1S A;  2FC3 A;  4HO4 A;  1IV4 A;  1ZIZ A;  4ZOL B;  3OH3 A;  2XWM A;  1TVY A;  3SXD A;  1LL3 A;  2RIZ A;  1ONI A;  2VS5 A;  2W8B C;  2RJ6 A;  3U2T A;  3R3I A;  5C4B A;  2AEC A;  5FTV A;  4B4G A;  1FXJ A;  4IRP A;  4KNX A;  3T7N A;  3CCU F;  1V84 A;  1K9M H;  3K0T A;  3MCA B;  3RYI A;  1E7K A;  2OTJ F;  4Y62 A;  5AJN A;  3JAT A;  1XHO A;  2OI6 A;  2JCJ A;  2ICY A;  4Y7T A;  5IFY A;  4C8E A;  2UYN A;  5CQO A;  3P10 A;  3HAX D;  1W41 A;  1XRG A;  2FYD B;  2RJ8 A;  2UYN B;  4FRE A;  4BQH A;  2CHS A;  4I50 A;  3WGM A;  4DXD A;  3DUV A;  3JUJ A;  2CHT A;  4CJC A;  5HY0 A;  3LDT A;  2YQC A;  1S4O A;  4D0Z A;  1OMZ A;  1I52 A;  1PZT A;  1KD1 H;  3OH2 A;  3OH0 A;  4BT7 A;  1GWW A;  4MYB A;  3SXA A;  1YJN F;  3JVH A;  2D7R A;  3PKQ A;  1TVK B;  1QGQ A;  2YXZ A;  5CB4 B;  1YI2 F;  3FOQ A;  1TVK A;  2LBX A;  3F0E A;  1N8R H;  2YQS A;  3F1C A;  3I0G A;  5GIO C;  4FRL A;  4F6R B;  3N2G A;  3E1Y A;  2AGD A;  4AYJ A;  1K8A H;  4F6R A;  3VO8 A;  1JJ2 F;  4G4Z A;  3GYQ A;  3K8E A;  4HOC A;  1G9R A;  2Z1U A;  4B4M A;  5A2Q M;  3ZLL A;  1XZ6 A;  4IHJ B;  5GAN K;  1VGU A;  4HNA A;  5DCV A;  2WEE A;  1W57 A;  3CC4 F;  1SS9 A;  5ITZ A;  1W5A A;  1V83 A;  4HNA B;  3I0E A;  5C1G A;  2BTO A;  4FIX A;  1H3M A;  4JD0 A;  1JD1 A;  1PZY B;  1GQ9 A;  2V9Y A;  3SX5 A;  1QVF F;  3JAR B;  3BYQ A;  1H7E A;  3I0J A;  5CA0 B;  1SA0 B;  1JVG A;  3T7M A;  3TD5 A;  4E6E A;  5HY1 A;  3WPX A;  3JAR A;  3OAM A;  5J49 A;  5LA6 B;  4TUY A;  5LOV B;  3MQW A;  3J7A R;  2VSI A;  3KJJ A;  2QH5 A;  1FGG A;  1LZI A;  2HVY D;  2Z1E A;  3ZLK A;  2HS4 A;  1YJ9 F;  2C0N A;  3U2W A;  3OH1 A;  3S0H A;  3I0I X;  4G3Q A;  5D92 A;  4M2A A;  1LZ7 A;  4X1K B;  2RIY A;  1WT3 A;  3PKP A;  1LL0 A;  2LBT A;  4B46 A;  3RYC A;  3TZT A;  3LW6 A;  2JNB A;  4BT4 A;  2YCM A;  3SX3 A;  3ELC A;  4P00 A;  2YQH A;  3V91 A;  4AYL A;  3I55 F;  4FRD A;  2AIF A;  2MQE A;  3D54 A;  2A8U A;  3UT5 B;  4WBN A;  4ZHY B;  5HY2 A;  5GIP C;  1ZCT A;  3I0D A;  1X52 A;  2VXY A;  1M1K H;  1ZI1 A;  3I3F A;  4G3S A;  1WT0 A;  3R0P A;  2VFZ A;  4FRH A;  3JAL B;  2Y6P A;  4D48 A;  1JV1 A;  1ZI3 A;  3C9T A;  5IJ9 B;  1FWY A;  2WVL A;  4B5B A;  2VGN A;  2UYK A;  3RYF B;  5HWE A;  5J2U A;  1TUB A;  2ZF8 A;  3S03 A;  5IT9 M;  3Q80 A;  3RSB A;  5C38 A;  3RYF A;  1TUB B;  3DC2 A;  2D0J A;  2FY7 A;  5LP6 A;  4C8G A;  5LYJ A;  3VMF B;  5LP6 B;  1FGX A;  3JAK B;  1O7O A;  5LYJ B;  1INJ A;  3WGL A;  4IRQ A;  5BXC A;  5C1L A;  2V0I A;  3JAK A;  2G9I A;  3WPW A;  3O85 A;  3ZOP A;  3V4D A;  1NKH B;  3M4S A;  1ZDG A;  3V7Q A;  1ZHJ A;  1YGY A;  5C47 A;  1GO1 A;  4AAW A;  5DDT A;  3EOR A;  3HWU A;  2HP0 A;  1ZJ3 A;  5IDS A;  2O1H A;  3IOI A;  2VXL A;  1H5R B;  5C8Y A;  4ZHQ B;  1NJI H;  4FRB A;  4TZZ A;  1R7T A;  3U0X A;  1YP2 A;  2JCL A;  1ZCV A;  2ZOV A;  4XWI A;  4NAN A;  2I6R A;  4IIJ B;  2Z87 A;  3ZP4 A;  3P0Z A;  2YC3 A;  4TV8 A;  3NVI B;  4LNU B;  4IIJ A;  5EJ1 A;  1VQ9 F;  1VZT A;  4NQ3 A;  3KIZ A;  4EEO A;  5HP7 A;  1NQI B;  3NVK E;  2YQJ A;  4D11 C;  1VH8 A;  1G95 A;  3HKB B;  1JY8 A;  1LVW A;  2RJ4 A;  3SIU A;  1K4V A;  4P02 A;  5LXT A;  1R80 A;  2OHW A;  5JCO C;  4U3J B;  1MC3 A;  3V8Y A;  4D11 A;  1XBI A;  5LXT B;  2OZB A;  2E8B A;  2UYP A;  3OGZ A;  3HTN A;  2W0W A;  4B3U A;  2Y7A A;  3V0N A;  4M4K A;  2Q1Y A;  3S0W A;  3G6E F;  4GBP A;  4B45 A;  3LWR C;  1VM8 A;  2FFV A;  4FRO A;  5C36 A;  5KMG A;  4Y6U A;  3FBA A;  1Q81 H;  2UYJ A;  1G1L A;  4X3L A;  2KGW A;  3QTY A;  5LP6 C;  2P73 A;  5JQG B;  5CMI A;  1CN7 A;  4ZI7 B;  5HS2 A;  1H7L A;  4J18 A;  5EYP B; 
#chains in the Genus database with same CATH homology
 5FYE A;  1VHA A;  4KNR A;  1U43 A;  1JYK A;  1MP4 A;  3IOJ A;  1QGS A;  5DDV A;  2PGY A;  1EYR A;  3RE3 A;  1IIM A;  1R7X A;  1O0R A;  1S4N A;  4Y7F A;  2QKX A;  4FCE A;  4NAI A;  3USQ A;  5L6S A;  2YES A;  5C8R A;  3BCV A;  4E1K A;  3D98 A;  2JCO A;  2UX8 A;  5FU0 A;  3I0H A;  1G0R A;  1H47 A;  1HM0 A;  1V82 A;  1GX4 A;  2GGO A;  3I0C A;  3ZGF A;  5C4E A;  1NMM B;  2D7I A;  3CKV A;  4ARW A;  3SX7 A;  5CMJ A;  5FUH A;  1ZJP A;  4EE3 A;  3OH4 A;  2RJ1 A;  1ZJ0 A;  3CGX A;  4D0T A;  4DEC A;  3ERN A;  2I5K A;  5C3B A;  1NWG B;  3KIA A;  3U2V A;  3U0Y A;  3CU0 A;  2PA4 A;  1H7T A;  1R7U A;  1G8O A;  3SX8 A;  4FRQ A;  1YP3 A;  2FYA A;  1VGT A;  1ZDF A;  2ZU7 A;  1U40 A;  1MP5 A;  1EZI A;  1VH3 A;  4KT7 A;  4JIS A;  1VZU A;  1E5K A;  1TW5 A;  4AYL A;  2X5S A;  3V0Q A;  4Y9X A;  4YS8 A;  4Y6N A;  1ZI4 A;  4L41 C;  4DDZ A;  4Y7G A;  5C48 A;  3F0F A;  4EE5 A;  3E26 A;  2X65 A;  4HCQ A;  1OMX A;  1GQC A;  2V0J A;  3IKF A;  2P6W A;  5IDT A;  1FOA A;  1GX0 A;  3I0L A;  1H5S D;  3U2U A;  4BMA A;  2CU2 A;  2Y4K A;  5C49 A;  4HO8 A;  1H5S C;  4K6R A;  1QG8 A;  1QWJ A;  2AH9 A;  4UEG A;  4EEA A;  2ICX A;  2OEF A;  4NAK A;  3SXE A;  1ZJ2 A;  4C82 A;  2RJ0 A;  1T0A A;  3V0M A;  2RJ5 A;  2QGI A;  1FZW A;  1NHE B;  1H7H A;  4O6M A;  4CJ8 A;  1ZCU A;  3PNN A;  1FG5 N;  4Y7V A;  2FYB A;  3USR A;  1H4C A;  3ESJ A;  4HO0 A;  3CKO A;  5C4D A;  4ASJ A;  3DJ4 A;  2VSH A;  3T7N A;  3V0L A;  3R2W A;  1LZ0 A;  3Q4S A;  2X60 A;  1JV3 A;  4Y64 A;  1LZJ A;  2I7B A;  1Z90 A;  3IKE A;  3OC9 A;  1IV1 A;  1IV3 A;  3V0O A;  4LW3 A;  2NXV A;  5L6V A;  3QHD A;  4HO3 A;  4G87 A;  1H4E A;  1G93 A;  2BO4 A;  4MND A;  2O1G A;  3N9W A;  1VGZ A;  4FCU A;  2WVM A;  1TW1 A;  2ZU9 A;  3T80 A;  1HJJ A;  1GA8 A;  1O7Q A;  3RMV A;  2PGV A;  2WE9 A;  3SXB A;  2Y4J A;  5CMH A;  4FRM A;  2V0L A;  2I5E A;  2RJ7 A;  4M28 A;  2VD4 A;  1G2V A;  4HO2 A;  3GHZ A;  2J0B A;  4ASY A;  1H7F A;  3K14 A;  3D8V A;  4B2W A;  3D5N A;  2Q4J A;  5C3D A;  2BO6 A;  3CKJ A;  4KRV A;  4NAL A;  1VZX A;  2BO8 A;  3HL3 A;  2P72 A;  2A8W A;  3SXC A;  1ZI5 A;  4FRA A;  4FIY A;  3MBM A;  1W77 A;  3ZF8 A;  4EEM A;  3ST8 A;  1JYL A;  1ZJ1 A;  3JUK A;  2W0V A;  3FPI A;  1TZF A;  3E25 A;  2AM4 A;  3F6M A;  4KXO A;  5FTS A;  1INI A;  3DK5 A;  4EEG A;  1VIC A;  3JTJ A;  5EIY A;  1XHB A;  3I0K A;  2WVK A;  1GX1 A;  3Q8H A;  1KNK A;  1HV9 A;  4M2B A;  3O3P A;  1JVD A;  1LL2 A;  2GGQ A;  5CMF X;  1WT1 A;  4C81 A;  4HO6 A;  5FU8 A;  1VGW A;  2VK9 A;  4Q7C A;  2UZH A;  2MZB A;  4KPZ A;  3SPT A;  1FR8 A;  3CKN A;  4R7P A;  3IEQ A;  2J0A A;  3FWW A;  4HO5 A;  3ZGG A;  3TQD A;  5CQP A;  4KC2 A;  2APC A;  4LW6 A;  2WAW A;  2XME A;  2Z86 A;  1H5T B;  3BRK X;  1H5T A;  2AMT A;  1O23 B;  2VXM A;  2Y4M A;  3V0P A;  5CMG X;  4KPX A;  1U3L A;  4HG6 A;  2YC5 A;  5C4C A;  2VS3 A;  2OEG A;  1WT2 A;  1FO8 A;  4EVW A;  3I0F A;  4Y7T A;  1S4P A;  4KC1 A;  3GUE A;  1WSZ A;  1ON8 A;  2XWN A;  1R82 A;  2OI5 A;  3KE1 A;  4KC4 A;  2AE7 A;  1YP4 A;  3CKQ A;  3K8D A;  3POL A;  1ZCY A;  3U2X A;  4AC3 A;  4B4B A;  1YQN A;  1IV2 A;  2WGZ A;  2Y4L A;  1H4D A;  2FYC B;  1KNJ A;  4B42 A;  1FXO A;  1IIN A;  1HM9 A;  3QVB A;  5AJP A;  4MIX A;  1ON6 A;  3Q7U A;  1W55 A;  4O6N A;  3OKR A;  2JCK A;  2PMP A;  2RIX A;  3SXG A;  5FV9 A;  1H5R A;  1U3P A;  1R81 A;  3NGW A;  5C1H A;  4ECM A;  3T7O A;  2AM5 A;  1VH1 A;  4CJB A;  1HJL A;  1H5S B;  2FFU A;  1NF5 B;  3F1Y A;  1H5S A;  1MP3 A;  2O1F A;  5C4F A;  4DE7 A;  3IEW A;  5I1F A;  1WVC A;  2RIT A;  2PX7 A;  2V0K A;  5CQL X;  2DPW A;  3B6N A;  4FRP A;  2BO7 A;  1G3L A;  1R7V A;  3RMW A;  2X5Z A;  3IOH A;  2GZL A;  4ZDQ A;  5B8F A;  2E3D A;  3K2X A;  1ZJO A;  4C2S A;  1HM8 A;  1G97 A;  4Y7U A;  4Y63 A;  5AJO A;  3F0G A;  1JN1 A;  4FQW A;  1GWV A;  5CQM X;  5C3A A;  5JQQ A;  1H7Q A;  4G3P A;  1R7Y A;  5D91 A;  1H48 A;  2XWL A;  4C8I A;  2OI7 A;  1FO9 A;  2RJ9 A;  2AES A;  1KWS A;  3V8Z A;  5EJZ A;  3F0D A;  4KQL A;  4EE4 A;  4CVH A;  2XMH A;  1H7G A;  4HO9 A;  1YRO B;  2V0H A;  1FRW A;  5CQN X;  1G23 A;  1FR9 A;  1VPA A;  1OQM B;  2VS4 A;  2ZU8 A;  3EE5 A;  2AM3 A;  3SXA A;  4HO4 A;  1IV4 A;  1ZIZ A;  3OH3 A;  2XWM A;  1TVY A;  3SXD A;  1LL3 A;  2RIZ A;  2VS5 A;  3U2T A;  2RJ6 A;  3R3I A;  5C4B A;  2AEC A;  5FTV A;  4B4G A;  1FXJ A;  4IRP A;  4KNX A;  1V84 A;  4Y62 A;  5AJN A;  2OI6 A;  2JCJ A;  2ICY A;  5IFY A;  4C8E A;  5CQO A;  3P10 A;  2FYD B;  2RJ8 A;  4BQH A;  4FRE A;  3JUJ A;  3DUV A;  4CJC A;  2YQC A;  1S4O A;  4D0Z A;  1OMZ A;  1I52 A;  1PZT A;  3OH2 A;  3OH0 A;  1GWW A;  4MYB A;  3JVH A;  2D7R A;  3PKQ A;  1QGQ A;  3FOQ A;  3F0E A;  3F1C A;  2YQS A;  3I0G A;  4FRL A;  2AGD A;  4AYJ A;  3K8E A;  4HOC A;  1G9R A;  4B4M A;  3ZLL A;  1XZ6 A;  1VGU A;  2WEE A;  1W57 A;  1SS9 A;  1V83 A;  3I0E A;  5C1G A;  4B2X A;  4FIX A;  1H3M A;  4JD0 A;  1PZY B;  1GQ9 A;  3SX5 A;  1H7E A;  3I0J A;  3T7M A;  1JVG A;  3V90 A;  5J49 A;  3OAM A;  2VSI A;  2QH5 A;  1FGG A;  1LZI A;  3ZLK A;  2C0N A;  3U2W A;  3OH1 A;  3I0I X;  4G3Q A;  5D92 A;  4M2A A;  1LZ7 A;  2RIY A;  1WT3 A;  3PKP A;  1LL0 A;  3TZT A;  3LW6 A;  2YCM A;  3SX3 A;  3ELC A;  4P00 A;  2YQH A;  3V91 A;  4FRD A;  2A8U A;  1ZCT A;  3I0D A;  1ZI1 A;  4G3S A;  1WT0 A;  2VFZ A;  4FRH A;  4D48 A;  2Y6P A;  1JV1 A;  1ZI3 A;  1FWY A;  2WVL A;  4B5B A;  3Q80 A;  3RSB A;  5C38 A;  2D0J A;  2FY7 A;  4C8G A;  1FGX A;  1O7O A;  1INJ A;  4IRQ A;  5BXC A;  5C1L A;  2V0I A;  1NKH B;  1ZDG A;  1ZHJ A;  5C47 A;  4AAW A;  5DDT A;  3EOR A;  1ZJ3 A;  5IDS A;  2O1H A;  3IOI A;  2VXL A;  1H5R B;  4FRB A;  1R7T A;  3U0X A;  1YP2 A;  2JCL A;  1ZCV A;  4XWI A;  4NAN A;  2Z87 A;  3P0Z A;  2YC3 A;  5EJ1 A;  1VZT A;  4EEO A;  1NQI B;  2YQJ A;  4D11 C;  1VH8 A;  1G95 A;  1JY8 A;  1LVW A;  2RJ4 A;  1K4V A;  4P02 A;  1R80 A;  3V8Y A;  4D11 A;  1MC3 A;  2E8B A;  3OGZ A;  2W0W A;  4B3U A;  2Y7A A;  3V0N A;  4M4K A;  4GBP A;  1VM8 A;  2FFV A;  4FRO A;  5C36 A;  4Y6U A;  3FBA A;  1G1L A;  2P73 A;  5CMI A;  5HS2 A;  1H7L A;  4J18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...