4B2XA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
303
structure length
299
Chain Sequence
HHHHHHMKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 100
structure length 299
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4b2xA00
1R82A 1FO8A 3SXAA 2YCMA 4EE5A 3N9WA 1H7FA 1JV1A 2Y4JA 1VGZA 1H4DA 2D7RA 5EJZA 1G2VA 2YQHA 1NF5B 2V0KA 2OEFA 2GGQA 3USQA 4ARWA 2ICXA 1HM8A 4B42A 5C8RA 2RJ7A 2WVKA 1FG5N 2FFUA 3GUEA 4JISA 1H5RA 4FRMA 2D7IA 5C1LA 1MC3A 3OH3A 4FRAA 4B2WA 1H5SB 2YQSA 4D11C 4JD0A 1ON6A 1LL0A 1R7VA 3I0KA 1R80A 1JVGA 4K6RA 5C38A 4EE4A 4DECA 4AAWA 4B2XA 4LW3A 1LZJA 4M4KA 3SXBA 4ECMA 4ZDQA 1FWYA 2OI6A 5CQLX 2YC3A 3F1CA 1FRWA 3V0NA 1G97A 4D0ZA 4KNXA 2YQJA 2AM4A 5AJNA 2O1FA 1HM0A 4KPZA 3TZTA 1VM8A 4YS8A 1FXOA 1MP5A 4ASJA 2V0HA 3POLA 4CJ8A 4HG6A 5I1FA 4FRDA 2WVLA 4G3PA 2VS5A 3I0JA 3V0OA 4P00A 3O3PA 1NHEB 1W57A 1H3MA 5C3AA 4AYLA 1OMZA 1TW5A 1R7XA 1ZCYA 2RIXA 1I52A 3BCVA 1GQ9A 1GWWA 1GQCA 3CKNA 3SX7A 3ZF8A 1LZIA 5C4BA 2RJ1A 4CJCA 3OH2A 2CU2A 3CKVA 1YP4A 3CKQA 1MP4A 2PA4A 1QWJA 2Y6PA 3K8EA 4IRPA 1H5TA 2FY7A 4MYBA 2AESA 4FROA 2Y4MA 1VPAA 1ZJ2A 5CMHA 2RJ5A 5HS2A 2A8UA 3DUVA 2OI5A 1OMXA 4Y63A 4C2SA 1WSZA 2AECA 4KC1A 2O1HA 1LZ0A 1W55A 2FYDB 1PZYB 2AM3A 4CJBA 4HO8A 4NALA 1WVCA 2WAWA 2XWLA 1FO9A 4FREA 4Y7TA 4HO2A 4KPXA 1GX4A 3U2UA 3ST8A 1ZDGA 1ON8A 3BRKX 4L41C 1HJLA 4Y64A 1JYLA 2QKXA 2BO4A 3RSBA 3V8ZA 1QGSA 4B4GA 3T7NA 3V8YA 2P73A 3SPTA 4KC2A 4BQHA 2W0WA 1FR9A 3RMVA 5AJOA 3I0EA 3V0PA 1W77A 1TW1A 2V0JA 1INJA 2RJ4A 5C3BA 1ZJPA 3U2WA 1LL3A 3U2TA 2FYAA 3PKPA 5L6SA 1GA8A 1WT1A 4HO0A 4EVWA 5C1GA 4KT7A 2GGOA 5C4FA 5IFYA 3LW6A 3T7OA 2ICYA 2X5SA 3ZLKA 3IOIA 2DPWA 5CMGX 4B3UA 1H7TA 1H5SA 2PGYA 3Q7UA 1H5RB 3SX5A 3SXCA 1H7LA 2Y7AA 1R7UA 4D0TA 1FR8A 2VFZA 1VH1A 4FRPA 3FOQA 4HO4A 1FZWA 2APCA 2QGIA 4FRQA 1ZJ0A 1WT2A 1JYKA 3V0QA 1VZTA 2NXVA 2VXLA 3FWWA 1K4VA 4EEMA 1Z90A 4GBPA 3I0DA 4FRBA 5C4DA 3OH0A 5C36A 5CMIA 1ZCUA 3NGWA 5C1HA 1VGWA 3JUKA 1G95A 4EEGA 4AC3A 2AH9A 2RJ0A 2YESA 1ZHJA 1S4OA 4HO3A 4NAIA 2WVMA 3D8VA 2VXMA 2I5EA 2X60A 2Q4JA 2XWNA 3HL3A 3U2XA 1H4CA 2MZBA 3I0HA 5C4EA 4UEGA 2V0IA 5C48A 3USRA 5J49A 1EYRA 1ZI3A 2O1GA 1VICA 2RITA 2OI7A 4R7PA 3OKRA 5C49A 1ZJOA 3R3IA 1TZFA 1S4PA 3D98A 4IRQA 2D0JA 3IOHA 3OAMA 3U0YA 2VSHA 2RJ6A 3EE5A 1IIMA 4XWIA 4KXOA 2X5ZA 2XMEA 2XMHA 1NQIB 1VZUA 2VS3A 1H5SC 2AGDA 1G3LA 5FYEA 3U2VA 5EIYA 4HO5A 4M28A 1FXJA 4BMAA 5CMFX 3QVBA 1QG8A 2Z87A 1O23B 2VS4A 4KQLA 4Y6NA 1VH3A 5DDTA 3D5NA 1SS9A 5AJPA 2ZU8A 4D48A 1ZI1A 2JCJA 5IDTA 3V90A 1V82A 4HO9A 4Y7FA 5CQPA 4Y7VA 3ZGGA 1G93A 1H7HA 2AM5A 4EE3A 1FOAA 4FRLA 4B5BA 3CGXA 3SX8A 1ZDFA 2RJ9A 3I0FA 1XHBA 4FQWA 1ZI4A 1WT0A 4EEOA 4B4MA 3V91A 2JCKA 2FYBA 5FU8A 4M2AA 3KIAA 2AE7A 1GX0A 1VGTA 3I0CA 3OH1A 1JVDA 4G87A 1LL2A 3PKQA 5FUHA 4M2BA 1JV3A 3Q80A 1LZ7A 2XWMA 4J18A 2VSIA 2UX8A 3F1YA 1H7GA 4G3QA 4HO6A 4KNRA 3DK5A 1ZCTA 5FU0A 5FV9A 3SXEA 3V0MA 1NKHB 2PX7A 2FFVA 3CKJA 5CQNX 1VGUA 3JUJA 1ZIZA 3E26A 1G8OA 2BO8A 1O0RA 1ZJ1A 2RIYA 2E8BA 5BXCA 3V0LA 1OQMB 1VZXA 5JQQA 4FCUA 3PNNA 3Q4SA 3OGZA 2VD4A 3CKOA 1ZCVA 1TVYA 1QGQA 1R7YA 3ZGFA 4MNDA 5DDVA 3K8DA 1ZI5A 4Y62A 2P6WA 4DDZA 3SX3A 3I0IX 3ZLLA 1R7TA 2OEGA 1ZJ3A 4Y6UA 1G9RA 1S4NA 4AYJA 2BO6A 4Y7UA 1G23A 2JCOA 4HOCA 3R2WA 2FYCB 4P02A 4FRHA 4KRVA 3T7MA 1G1LA 2WE9A 4G3SA 1WT3A 1H7EA 2Z86A 1YP3A 3DJ4A 2RJ8A 1YP2A 1NWGB 3E25A 3TQDA 2WGZA 1H7QA 1E5KA 1YROB 3IOJA 1XZ6A 5C3DA 1LVWA 1EZIA 4HCQA 5FTSA 2E3DA 2Y4LA 3SXGA 2I5KA 5CMJA 1O7OA 4ASYA 4E1KA 3CU0A 4B4BA 2ZU7A 4Y7GA 2YQCA 4D11A 2W0VA 5C47A 3OC9A 4KC4A 4LW6A 1H5SD 4NANA 1GWVA 2V0LA 1KWSA 1MP3A 1NMMB 1H5TB 1INIA 1R81A 1PZTA 1FGGA 3OH4A 2YC5A 4DE7A 4FCEA 3I0LA 2ZU9A 2I7BA 1FGXA 3RMWA 5L6VA 2PGVA 1HM9A 1HJJA 3U0XA 2QH5A 2Y4KA 5CQOA 1H4EA 3SXDA 2P72A 4NAKA 3JTJA 4Y9XA 2X65A 5C4CA 1V83A 4CVHA 2JCLA 1V84A 1HV9A 2RIZA 2WEEA 3I0GA 5EJ1A 1O7QA 1G0RA 5CQMX 5IDSA 2A8WA 5FTVA 1IINA 4EEAA 2BO7A
chains in the Genus database with same CATH superfamily
1R82A 1FO8A 3SXAA 2YCMA 4EE5A 3N9WA 1H7FA 1JV1A 2Y4JA 1VGZA 1H4DA 2D7RA 5EJZA 1G2VA 2YQHA 1NF5B 2V0KA 2OEFA 2GGQA 3USQA 4ARWA 2ICXA 1HM8A 4B42A 5C8RA 2RJ7A 2WVKA 1FG5N 2FFUA 3GUEA 4JISA 1H5RA 4FRMA 2D7IA 5C1LA 1MC3A 3OH3A 2VK9A 4FRAA 4B2WA 1H5SB 2YQSA 4D11C 4JD0A 1ON6A 1LL0A 1R7VA 3I0KA 1R80A 1JVGA 4K6RA 5C38A 4EE4A 4DECA 4AAWA 4B2XA 4LW3A 1LZJA 4FIXA 4M4KA 4MIXA 4Q7CA 3SXBA 4ECMA 4ZDQA 1FWYA 2OI6A 5CQLX 2YC3A 3F1CA 1FRWA 3V0NA 1G97A 4D0ZA 4KNXA 2YQJA 2AM4A 5AJNA 2O1FA 1HM0A 4KPZA 3TZTA 1VM8A 4YS8A 1FXOA 1MP5A 4ASJA 2V0HA 3POLA 4CJ8A 4HG6A 5I1FA 4FRDA 2WVLA 4G3PA 2VS5A 3I0JA 3V0OA 4P00A 4FIYA 3O3PA 1NHEB 1W57A 1H3MA 5C3AA 4AYLA 1OMZA 1TW5A 1R7XA 1ZCYA 2RIXA 1I52A 3BCVA 1GQ9A 1GWWA 1GQCA 3CKNA 3SX7A 3ZF8A 1LZIA 5C4BA 2RJ1A 4CJCA 3OH2A 2J0BA 2CU2A 3CKVA 1YP4A 3CKQA 1MP4A 2PA4A 1QWJA 2Y6PA 3K8EA 4IRPA 1H5TA 2FY7A 4MYBA 2AESA 4FROA 2Y4MA 1VPAA 1ZJ2A 5CMHA 2RJ5A 5HS2A 2A8UA 3DUVA 2OI5A 1OMXA 4Y63A 4C2SA 1WSZA 2AECA 4KC1A 2O1HA 1LZ0A 1W55A 2FYDB 1PZYB 2AM3A 4CJBA 4HO8A 4NALA 1WVCA 2WAWA 2XWLA 1FO9A 4FREA 4Y7TA 4HO2A 4KPXA 1GX4A 3U2UA 3ST8A 1ZDGA 1ON8A 3BRKX 4L41C 1HJLA 4Y64A 5D92A 1JYLA 2QKXA 2BO4A 3RSBA 3V8ZA 1QGSA 4B4GA 3T7NA 3V8YA 2P73A 3SPTA 4KC2A 4BQHA 2W0WA 1FR9A 3RMVA 5AJOA 3I0EA 3V0PA 1W77A 1TW1A 2V0JA 1INJA 2RJ4A 5C3BA 1ZJPA 3U2WA 1LL3A 3U2TA 2FYAA 3PKPA 5L6SA 1GA8A 1WT1A 4HO0A 4O6NA 4EVWA 5C1GA 4KT7A 2GGOA 5C4FA 5IFYA 3LW6A 3T7OA 2ICYA 5D91A 2X5SA 3ZLKA 3IOIA 2DPWA 5CMGX 4B3UA 1H7TA 1H5SA 2PGYA 3Q7UA 1H5RB 3SX5A 3SXCA 1H7LA 2Y7AA 1R7UA 4D0TA 1FR8A 2VFZA 1VH1A 4FRPA 3FOQA 4HO4A 1FZWA 2APCA 2QGIA 4FRQA 1ZJ0A 1WT2A 1JYKA 3V0QA 1VZTA 2NXVA 2VXLA 3FWWA 1K4VA 4EEMA 1Z90A 4GBPA 3I0DA 4FRBA 5C4DA 3OH0A 5C36A 5CMIA 1ZCUA 3NGWA 5C1HA 1VGWA 3JUKA 1G95A 4EEGA 4AC3A 2AH9A 2RJ0A 2YESA 1ZHJA 1S4OA 4HO3A 4NAIA 2WVMA 3D8VA 2VXMA 2I5EA 2X60A 2Q4JA 2XWNA 3HL3A 3U2XA 1H4CA 2MZBA 3I0HA 5C4EA 4UEGA 2V0IA 5C48A 3USRA 5J49A 1EYRA 1ZI3A 2O1GA 1VICA 2RITA 2OI7A 4R7PA 3OKRA 5C49A 1ZJOA 3R3IA 1TZFA 1S4PA 3D98A 4IRQA 2D0JA 3IOHA 3OAMA 3U0YA 2VSHA 2RJ6A 3EE5A 1IIMA 4XWIA 4KXOA 2X5ZA 2XMEA 2XMHA 1NQIB 1VZUA 2VS3A 1H5SC 2AGDA 1G3LA 5FYEA 3U2VA 5EIYA 4HO5A 4M28A 1FXJA 4BMAA 5CMFX 3QVBA 1QG8A 2Z87A 1O23B 2VS4A 4KQLA 4Y6NA 1VH3A 5DDTA 3D5NA 1SS9A 5AJPA 2ZU8A 4D48A 1ZI1A 2JCJA 5IDTA 3V90A 1V82A 4HO9A 4Y7FA 5CQPA 4Y7VA 3ZGGA 1G93A 1H7HA 2AM5A 4EE3A 1FOAA 4FRLA 4B5BA 3CGXA 3SX8A 1ZDFA 2RJ9A 3I0FA 1XHBA 4FQWA 1ZI4A 1WT0A 4EEOA 4B4MA 3V91A 2JCKA 2FYBA 5FU8A 4M2AA 3KIAA 2AE7A 1GX0A 1VGTA 3I0CA 3OH1A 1JVDA 4G87A 1LL2A 3PKQA 5FUHA 4M2BA 1JV3A 3Q80A 1LZ7A 2XWMA 4J18A 2VSIA 2UX8A 3F1YA 1H7GA 4G3QA 4HO6A 4KNRA 3DK5A 1ZCTA 5FU0A 5FV9A 3SXEA 3V0MA 1NKHB 2PX7A 2FFVA 3CKJA 5CQNX 1VGUA 3JUJA 1ZIZA 3E26A 1G8OA 2BO8A 1O0RA 1ZJ1A 2RIYA 2E8BA 5BXCA 3V0LA 1OQMB 1VZXA 5JQQA 4FCUA 3PNNA 3Q4SA 3OGZA 2VD4A 3CKOA 1ZCVA 1TVYA 4O6MA 1QGQA 1R7YA 3ZGFA 4MNDA 5DDVA 3K8DA 1ZI5A 4Y62A 2P6WA 4DDZA 3SX3A 3I0IX 3ZLLA 1R7TA 2OEGA 1ZJ3A 4Y6UA 1G9RA 1S4NA 4AYJA 2BO6A 4Y7UA 1G23A 2JCOA 4HOCA 3R2WA 2FYCB 4P02A 4FRHA 4KRVA 3T7MA 1G1LA 2WE9A 4G3SA 1WT3A 1H7EA 2Z86A 1YP3A 3DJ4A 2RJ8A 1YP2A 1NWGB 3E25A 3TQDA 2WGZA 1H7QA 1E5KA 1YROB 3IOJA 1XZ6A 5C3DA 1LVWA 1EZIA 4HCQA 5FTSA 2E3DA 2Y4LA 3SXGA 2I5KA 5CMJA 1O7OA 4ASYA 2C0NA 4E1KA 3CU0A 4B4BA 2ZU7A 4Y7GA 2YQCA 4D11A 2W0VA 5C47A 3OC9A 4KC4A 4LW6A 1H5SD 2J0AA 4NANA 1GWVA 2V0LA 1KWSA 1MP3A 1NMMB 1H5TB 1INIA 1R81A 1PZTA 1FGGA 3OH4A 2YC5A 4DE7A 4FCEA 3I0LA 2ZU9A 2I7BA 1FGXA 3RMWA 5L6VA 2PGVA 1HM9A 1HJJA 3U0XA 2QH5A 2Y4KA 5CQOA 1H4EA 3SXDA 2P72A 4NAKA 3JTJA 4Y9XA 2X65A 5C4CA 1V83A 4CVHA 2JCLA 1V84A 1HV9A 2RIZA 2WEEA 3I0GA 5EJ1A 1O7QA 1G0RA 5CQMX 5IDSA 2A8WA 5FTVA 1IINA 4EEAA 2BO7A
chains in the Genus database with same CATH topology
1R82A 1FO8A 3SXAA 2YCMA 4EE5A 3N9WA 1H7FA 1JV1A 2Y4JA 1VGZA 1H4DA 2D7RA 5EJZA 1G2VA 2YQHA 1NF5B 2V0KA 2OEFA 2GGQA 3USQA 4ARWA 2ICXA 1HM8A 4B42A 5C8RA 2RJ7A 2WVKA 1FG5N 2FFUA 3GUEA 4JISA 1H5RA 4FRMA 2D7IA 5C1LA 1MC3A 3OH3A 2VK9A 4FRAA 4B2WA 1H5SB 2YQSA 4D11C 4JD0A 1ON6A 1LL0A 1R7VA 3I0KA 1R80A 1JVGA 4K6RA 5C38A 4EE4A 4DECA 4AAWA 4B2XA 4LW3A 1LZJA 4FIXA 4M4KA 4MIXA 4Q7CA 3SXBA 4ECMA 4ZDQA 1FWYA 2OI6A 5CQLX 2YC3A 3F1CA 1FRWA 3V0NA 1G97A 4D0ZA 4KNXA 2YQJA 2AM4A 5AJNA 2O1FA 1HM0A 4KPZA 3TZTA 1VM8A 4YS8A 1FXOA 1MP5A 4ASJA 2V0HA 3POLA 4CJ8A 4HG6A 5I1FA 4FRDA 2WVLA 4G3PA 2VS5A 3I0JA 3V0OA 4P00A 4FIYA 3O3PA 1NHEB 1W57A 1H3MA 5C3AA 4AYLA 1OMZA 1TW5A 1R7XA 1ZCYA 2RIXA 1I52A 3BCVA 1GQ9A 1GWWA 1GQCA 3CKNA 3SX7A 3ZF8A 1LZIA 5C4BA 2RJ1A 4CJCA 3OH2A 2J0BA 2CU2A 3CKVA 1YP4A 3CKQA 1MP4A 2PA4A 1QWJA 2Y6PA 3K8EA 4IRPA 1H5TA 2FY7A 4MYBA 2AESA 4FROA 2Y4MA 1VPAA 1ZJ2A 5CMHA 2RJ5A 5HS2A 2A8UA 3DUVA 2OI5A 1OMXA 4Y63A 4C2SA 1WSZA 2AECA 4KC1A 2O1HA 1LZ0A 1W55A 2FYDB 1PZYB 2AM3A 4CJBA 4HO8A 4NALA 1WVCA 2WAWA 2XWLA 1FO9A 4FREA 4Y7TA 4HO2A 4KPXA 1GX4A 3U2UA 3ST8A 1ZDGA 1ON8A 3BRKX 4L41C 1HJLA 4Y64A 5D92A 1JYLA 2QKXA 2BO4A 3RSBA 3V8ZA 1QGSA 4B4GA 3T7NA 3V8YA 2P73A 3SPTA 4KC2A 4BQHA 2W0WA 1FR9A 3RMVA 5AJOA 3I0EA 3V0PA 1W77A 1TW1A 2V0JA 1INJA 2RJ4A 5C3BA 1ZJPA 3U2WA 1LL3A 3U2TA 2FYAA 3PKPA 5L6SA 1GA8A 1WT1A 4HO0A 4O6NA 4EVWA 5C1GA 4KT7A 2GGOA 5C4FA 5IFYA 3LW6A 3T7OA 2ICYA 5D91A 2X5SA 3ZLKA 3IOIA 2DPWA 5CMGX 4B3UA 1H7TA 1H5SA 2PGYA 3Q7UA 1H5RB 3SX5A 3SXCA 1H7LA 2Y7AA 1R7UA 4D0TA 1FR8A 2VFZA 1VH1A 4FRPA 3FOQA 4HO4A 1FZWA 2APCA 2QGIA 4FRQA 1ZJ0A 1WT2A 1JYKA 3V0QA 1VZTA 2NXVA 2VXLA 3FWWA 1K4VA 4EEMA 1Z90A 4GBPA 3I0DA 4FRBA 5C4DA 3OH0A 5C36A 5CMIA 1ZCUA 3NGWA 5C1HA 1VGWA 3JUKA 1G95A 4EEGA 4AC3A 2AH9A 2RJ0A 2YESA 1ZHJA 1S4OA 4HO3A 4NAIA 2WVMA 3D8VA 2VXMA 2I5EA 2X60A 2Q4JA 2XWNA 3HL3A 3U2XA 1H4CA 2MZBA 3I0HA 5C4EA 4UEGA 2V0IA 5C48A 3USRA 5J49A 1EYRA 1ZI3A 2O1GA 1VICA 2RITA 2OI7A 4R7PA 3OKRA 5C49A 1ZJOA 3R3IA 1TZFA 1S4PA 3D98A 4IRQA 2D0JA 3IOHA 3OAMA 3U0YA 2VSHA 2RJ6A 3EE5A 1IIMA 4XWIA 4KXOA 2X5ZA 2XMEA 2XMHA 1NQIB 1VZUA 2VS3A 1H5SC 2AGDA 1G3LA 5FYEA 3U2VA 5EIYA 4HO5A 4M28A 1FXJA 4BMAA 5CMFX 3QVBA 1QG8A 2Z87A 1O23B 2VS4A 4KQLA 4Y6NA 1VH3A 5DDTA 3D5NA 1SS9A 5AJPA 2ZU8A 4D48A 1ZI1A 2JCJA 5IDTA 3V90A 1V82A 4HO9A 4Y7FA 5CQPA 4Y7VA 3ZGGA 1G93A 1H7HA 2AM5A 4EE3A 1FOAA 4FRLA 4B5BA 3CGXA 3SX8A 1ZDFA 2RJ9A 3I0FA 1XHBA 4FQWA 1ZI4A 1WT0A 4EEOA 4B4MA 3V91A 2JCKA 2FYBA 5FU8A 4M2AA 3KIAA 2AE7A 1GX0A 1VGTA 3I0CA 3OH1A 1JVDA 4G87A 1LL2A 3PKQA 5FUHA 4M2BA 1JV3A 3Q80A 1LZ7A 2XWMA 4J18A 2VSIA 2UX8A 3F1YA 1H7GA 4G3QA 4HO6A 4KNRA 3DK5A 1ZCTA 5FU0A 5FV9A 3SXEA 3V0MA 1NKHB 2PX7A 2FFVA 3CKJA 5CQNX 1VGUA 3JUJA 1ZIZA 3E26A 1G8OA 2BO8A 1O0RA 1ZJ1A 2RIYA 2E8BA 5BXCA 3V0LA 1OQMB 1VZXA 5JQQA 4FCUA 3PNNA 3Q4SA 3OGZA 2VD4A 3CKOA 1ZCVA 1TVYA 4O6MA 1QGQA 1R7YA 3ZGFA 4MNDA 5DDVA 3K8DA 1ZI5A 4Y62A 2P6WA 4DDZA 3SX3A 3I0IX 3ZLLA 1R7TA 2OEGA 1ZJ3A 4Y6UA 1G9RA 1S4NA 4AYJA 2BO6A 4Y7UA 1G23A 2JCOA 4HOCA 3R2WA 2FYCB 4P02A 4FRHA 4KRVA 3T7MA 1G1LA 2WE9A 4G3SA 1WT3A 1H7EA 2Z86A 1YP3A 3DJ4A 2RJ8A 1YP2A 1NWGB 3E25A 3TQDA 2WGZA 1H7QA 1E5KA 1YROB 3IOJA 1XZ6A 5C3DA 1LVWA 1EZIA 4HCQA 5FTSA 2E3DA 2Y4LA 3SXGA 2I5KA 5CMJA 1O7OA 4ASYA 2C0NA 4E1KA 3CU0A 4B4BA 2ZU7A 4Y7GA 2YQCA 4D11A 2W0VA 5C47A 3OC9A 4KC4A 4LW6A 1H5SD 2J0AA 4NANA 1GWVA 2V0LA 1KWSA 1MP3A 1NMMB 1H5TB 1INIA 1R81A 1PZTA 1FGGA 3OH4A 2YC5A 4DE7A 4FCEA 3I0LA 2ZU9A 2I7BA 1FGXA 3RMWA 5L6VA 2PGVA 1HM9A 1HJJA 3U0XA 2QH5A 2Y4KA 5CQOA 1H4EA 3SXDA 2P72A 4NAKA 3JTJA 4Y9XA 2X65A 5C4CA 1V83A 4CVHA 2JCLA 1V84A 1HV9A 2RIZA 2WEEA 3I0GA 5EJ1A 1O7QA 1G0RA 5CQMX 5IDSA 2A8WA 5FTVA 1IINA 4EEAA 2BO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R82 A;  1FO8 A;  3SXA A;  2YCM A;  4EE5 A;  3N9W A;  1H7F A;  1JV1 A;  2Y4J A;  1VGZ A;  1H4D A;  2D7R A;  5EJZ A;  1G2V A;  2YQH A;  1NF5 B;  2V0K A;  2OEF A;  2GGQ A;  3USQ A;  4ARW A;  2ICX A;  1HM8 A;  4B42 A;  5C8R A;  2RJ7 A;  2WVK A;  1FG5 N;  2FFU A;  3GUE A;  4JIS A;  1H5R A;  4FRM A;  2D7I A;  5C1L A;  1MC3 A;  3OH3 A;  4FRA A;  4B2W A;  1H5S B;  2YQS A;  4D11 C;  4JD0 A;  1ON6 A;  1LL0 A;  1R7V A;  3I0K A;  1R80 A;  1JVG A;  4K6R A;  5C38 A;  4EE4 A;  4DEC A;  4AAW A;  4B2X A;  4LW3 A;  1LZJ A;  4M4K A;  3SXB A;  4ECM A;  4ZDQ A;  1FWY A;  2OI6 A;  5CQL X;  2YC3 A;  3F1C A;  1FRW A;  3V0N A;  1G97 A;  4D0Z A;  4KNX A;  2YQJ A;  2AM4 A;  5AJN A;  2O1F A;  1HM0 A;  4KPZ A;  3TZT A;  1VM8 A;  4YS8 A;  1FXO A;  1MP5 A;  4ASJ A;  2V0H A;  3POL A;  4CJ8 A;  4HG6 A;  5I1F A;  4FRD A;  2WVL A;  4G3P A;  2VS5 A;  3I0J A;  3V0O A;  4P00 A;  3O3P A;  1NHE B;  1W57 A;  1H3M A;  5C3A A;  4AYL A;  1OMZ A;  1TW5 A;  1R7X A;  1ZCY A;  2RIX A;  1I52 A;  3BCV A;  1GQ9 A;  1GWW A;  1GQC A;  3CKN A;  3SX7 A;  3ZF8 A;  1LZI A;  5C4B A;  2RJ1 A;  4CJC A;  3OH2 A;  2CU2 A;  3CKV A;  1YP4 A;  3CKQ A;  1MP4 A;  2PA4 A;  1QWJ A;  2Y6P A;  3K8E A;  4IRP A;  1H5T A;  2FY7 A;  4MYB A;  2AES A;  4FRO A;  2Y4M A;  1VPA A;  1ZJ2 A;  5CMH A;  2RJ5 A;  5HS2 A;  2A8U A;  3DUV A;  2OI5 A;  1OMX A;  4Y63 A;  4C2S A;  1WSZ A;  2AEC A;  4KC1 A;  2O1H A;  1LZ0 A;  1W55 A;  2FYD B;  1PZY B;  2AM3 A;  4CJB A;  4HO8 A;  4NAL A;  1WVC A;  2WAW A;  2XWL A;  1FO9 A;  4FRE A;  4Y7T A;  4HO2 A;  4KPX A;  1GX4 A;  3U2U A;  3ST8 A;  1ZDG A;  1ON8 A;  3BRK X;  4L41 C;  1HJL A;  4Y64 A;  1JYL A;  2QKX A;  2BO4 A;  3RSB A;  3V8Z A;  1QGS A;  4B4G A;  3T7N A;  3V8Y A;  2P73 A;  3SPT A;  4KC2 A;  4BQH A;  2W0W A;  1FR9 A;  3RMV A;  5AJO A;  3I0E A;  3V0P A;  1W77 A;  1TW1 A;  2V0J A;  1INJ A;  2RJ4 A;  5C3B A;  1ZJP A;  3U2W A;  1LL3 A;  3U2T A;  2FYA A;  3PKP A;  5L6S A;  1GA8 A;  1WT1 A;  4HO0 A;  4EVW A;  5C1G A;  4KT7 A;  2GGO A;  5C4F A;  5IFY A;  3LW6 A;  3T7O A;  2ICY A;  2X5S A;  3ZLK A;  3IOI A;  2DPW A;  5CMG X;  4B3U A;  1H7T A;  1H5S A;  2PGY A;  3Q7U A;  1H5R B;  3SX5 A;  3SXC A;  1H7L A;  2Y7A A;  1R7U A;  4D0T A;  1FR8 A;  2VFZ A;  1VH1 A;  4FRP A;  3FOQ A;  4HO4 A;  1FZW A;  2APC A;  2QGI A;  4FRQ A;  1ZJ0 A;  1WT2 A;  1JYK A;  3V0Q A;  1VZT A;  2NXV A;  2VXL A;  3FWW A;  1K4V A;  4EEM A;  1Z90 A;  4GBP A;  3I0D A;  4FRB A;  5C4D A;  3OH0 A;  5C36 A;  5CMI A;  1ZCU A;  3NGW A;  5C1H A;  1VGW A;  3JUK A;  1G95 A;  4EEG A;  4AC3 A;  2AH9 A;  2RJ0 A;  2YES A;  1ZHJ A;  1S4O A;  4HO3 A;  4NAI A;  2WVM A;  3D8V A;  2VXM A;  2I5E A;  2X60 A;  2Q4J A;  2XWN A;  3HL3 A;  3U2X A;  1H4C A;  2MZB A;  3I0H A;  5C4E A;  4UEG A;  2V0I A;  5C48 A;  3USR A;  5J49 A;  1EYR A;  1ZI3 A;  2O1G A;  1VIC A;  2RIT A;  2OI7 A;  4R7P A;  3OKR A;  5C49 A;  1ZJO A;  3R3I A;  1TZF A;  1S4P A;  3D98 A;  4IRQ A;  2D0J A;  3IOH A;  3OAM A;  3U0Y A;  2VSH A;  2RJ6 A;  3EE5 A;  1IIM A;  4XWI A;  4KXO A;  2X5Z A;  2XME A;  2XMH A;  1NQI B;  1VZU A;  2VS3 A;  1H5S C;  2AGD A;  1G3L A;  5FYE A;  3U2V A;  5EIY A;  4HO5 A;  4M28 A;  1FXJ A;  4BMA A;  5CMF X;  3QVB A;  1QG8 A;  2Z87 A;  1O23 B;  2VS4 A;  4KQL A;  4Y6N A;  1VH3 A;  5DDT A;  3D5N A;  1SS9 A;  5AJP A;  2ZU8 A;  4D48 A;  1ZI1 A;  2JCJ A;  5IDT A;  3V90 A;  1V82 A;  4HO9 A;  4Y7F A;  5CQP A;  4Y7V A;  3ZGG A;  1G93 A;  1H7H A;  2AM5 A;  4EE3 A;  1FOA A;  4FRL A;  4B5B A;  3CGX A;  3SX8 A;  1ZDF A;  2RJ9 A;  3I0F A;  1XHB A;  4FQW A;  1ZI4 A;  1WT0 A;  4EEO A;  4B4M A;  3V91 A;  2JCK A;  2FYB A;  5FU8 A;  4M2A A;  3KIA A;  2AE7 A;  1GX0 A;  1VGT A;  3I0C A;  3OH1 A;  1JVD A;  4G87 A;  1LL2 A;  3PKQ A;  5FUH A;  4M2B A;  1JV3 A;  3Q80 A;  1LZ7 A;  2XWM A;  4J18 A;  2VSI A;  2UX8 A;  3F1Y A;  1H7G A;  4G3Q A;  4HO6 A;  4KNR A;  3DK5 A;  1ZCT A;  5FU0 A;  5FV9 A;  3SXE A;  3V0M A;  1NKH B;  2PX7 A;  2FFV A;  3CKJ A;  5CQN X;  1VGU A;  3JUJ A;  1ZIZ A;  3E26 A;  1G8O A;  2BO8 A;  1O0R A;  1ZJ1 A;  2RIY A;  2E8B A;  5BXC A;  3V0L A;  1OQM B;  1VZX A;  5JQQ A;  4FCU A;  3PNN A;  3Q4S A;  3OGZ A;  2VD4 A;  3CKO A;  1ZCV A;  1TVY A;  1QGQ A;  1R7Y A;  3ZGF A;  4MND A;  5DDV A;  3K8D A;  1ZI5 A;  4Y62 A;  2P6W A;  4DDZ A;  3SX3 A;  3I0I X;  3ZLL A;  1R7T A;  2OEG A;  1ZJ3 A;  4Y6U A;  1G9R A;  1S4N A;  4AYJ A;  2BO6 A;  4Y7U A;  1G23 A;  2JCO A;  4HOC A;  3R2W A;  2FYC B;  4P02 A;  4FRH A;  4KRV A;  3T7M A;  1G1L A;  2WE9 A;  4G3S A;  1WT3 A;  1H7E A;  2Z86 A;  1YP3 A;  3DJ4 A;  2RJ8 A;  1YP2 A;  1NWG B;  3E25 A;  3TQD A;  2WGZ A;  1H7Q A;  1E5K A;  1YRO B;  3IOJ A;  1XZ6 A;  5C3D A;  1LVW A;  1EZI A;  4HCQ A;  5FTS A;  2E3D A;  2Y4L A;  3SXG A;  2I5K A;  5CMJ A;  1O7O A;  4ASY A;  4E1K A;  3CU0 A;  4B4B A;  2ZU7 A;  4Y7G A;  2YQC A;  4D11 A;  2W0V A;  5C47 A;  3OC9 A;  4KC4 A;  4LW6 A;  1H5S D;  4NAN A;  1GWV A;  2V0L A;  1KWS A;  1MP3 A;  1NMM B;  1H5T B;  1INI A;  1R81 A;  1PZT A;  1FGG A;  3OH4 A;  2YC5 A;  4DE7 A;  4FCE A;  3I0L A;  2ZU9 A;  2I7B A;  1FGX A;  3RMW A;  5L6V A;  2PGV A;  1HM9 A;  1HJJ A;  3U0X A;  2QH5 A;  2Y4K A;  5CQO A;  1H4E A;  3SXD A;  2P72 A;  4NAK A;  3JTJ A;  4Y9X A;  2X65 A;  5C4C A;  1V83 A;  4CVH A;  2JCL A;  1V84 A;  1HV9 A;  2RIZ A;  2WEE A;  3I0G A;  5EJ1 A;  1O7Q A;  1G0R A;  5CQM X;  5IDS A;  2A8W A;  5FTV A;  1IIN A;  4EEA A;  2BO7 A; 
#chains in the Genus database with same CATH topology
 1R82 A;  1FO8 A;  3SXA A;  2YCM A;  4EE5 A;  3N9W A;  1H7F A;  1JV1 A;  2Y4J A;  1VGZ A;  1H4D A;  2D7R A;  5EJZ A;  1G2V A;  2YQH A;  1NF5 B;  2V0K A;  2OEF A;  2GGQ A;  3USQ A;  4ARW A;  2ICX A;  1HM8 A;  4B42 A;  5C8R A;  2RJ7 A;  2WVK A;  1FG5 N;  2FFU A;  3GUE A;  4JIS A;  1H5R A;  4FRM A;  2D7I A;  5C1L A;  1MC3 A;  3OH3 A;  2VK9 A;  4FRA A;  4B2W A;  1H5S B;  2YQS A;  4D11 C;  4JD0 A;  1ON6 A;  1LL0 A;  1R7V A;  3I0K A;  1R80 A;  1JVG A;  4K6R A;  5C38 A;  4EE4 A;  4DEC A;  4AAW A;  4B2X A;  4LW3 A;  1LZJ A;  4FIX A;  4M4K A;  4MIX A;  4Q7C A;  3SXB A;  4ECM A;  4ZDQ A;  1FWY A;  2OI6 A;  5CQL X;  2YC3 A;  3F1C A;  1FRW A;  3V0N A;  1G97 A;  4D0Z A;  4KNX A;  2YQJ A;  2AM4 A;  5AJN A;  2O1F A;  1HM0 A;  4KPZ A;  3TZT A;  1VM8 A;  4YS8 A;  1FXO A;  1MP5 A;  4ASJ A;  2V0H A;  3POL A;  4CJ8 A;  4HG6 A;  5I1F A;  4FRD A;  2WVL A;  4G3P A;  2VS5 A;  3I0J A;  3V0O A;  4P00 A;  4FIY A;  3O3P A;  1NHE B;  1W57 A;  1H3M A;  5C3A A;  4AYL A;  1OMZ A;  1TW5 A;  1R7X A;  1ZCY A;  2RIX A;  1I52 A;  3BCV A;  1GQ9 A;  1GWW A;  1GQC A;  3CKN A;  3SX7 A;  3ZF8 A;  1LZI A;  5C4B A;  2RJ1 A;  4CJC A;  3OH2 A;  2J0B A;  2CU2 A;  3CKV A;  1YP4 A;  3CKQ A;  1MP4 A;  2PA4 A;  1QWJ A;  2Y6P A;  3K8E A;  4IRP A;  1H5T A;  2FY7 A;  4MYB A;  2AES A;  4FRO A;  2Y4M A;  1VPA A;  1ZJ2 A;  5CMH A;  2RJ5 A;  5HS2 A;  2A8U A;  3DUV A;  2OI5 A;  1OMX A;  4Y63 A;  4C2S A;  1WSZ A;  2AEC A;  4KC1 A;  2O1H A;  1LZ0 A;  1W55 A;  2FYD B;  1PZY B;  2AM3 A;  4CJB A;  4HO8 A;  4NAL A;  1WVC A;  2WAW A;  2XWL A;  1FO9 A;  4FRE A;  4Y7T A;  4HO2 A;  4KPX A;  1GX4 A;  3U2U A;  3ST8 A;  1ZDG A;  1ON8 A;  3BRK X;  4L41 C;  1HJL A;  4Y64 A;  5D92 A;  1JYL A;  2QKX A;  2BO4 A;  3RSB A;  3V8Z A;  1QGS A;  4B4G A;  3T7N A;  3V8Y A;  2P73 A;  3SPT A;  4KC2 A;  4BQH A;  2W0W A;  1FR9 A;  3RMV A;  5AJO A;  3I0E A;  3V0P A;  1W77 A;  1TW1 A;  2V0J A;  1INJ A;  2RJ4 A;  5C3B A;  1ZJP A;  3U2W A;  1LL3 A;  3U2T A;  2FYA A;  3PKP A;  5L6S A;  1GA8 A;  1WT1 A;  4HO0 A;  4O6N A;  4EVW A;  5C1G A;  4KT7 A;  2GGO A;  5C4F A;  5IFY A;  3LW6 A;  3T7O A;  2ICY A;  5D91 A;  2X5S A;  3ZLK A;  3IOI A;  2DPW A;  5CMG X;  4B3U A;  1H7T A;  1H5S A;  2PGY A;  3Q7U A;  1H5R B;  3SX5 A;  3SXC A;  1H7L A;  2Y7A A;  1R7U A;  4D0T A;  1FR8 A;  2VFZ A;  1VH1 A;  4FRP A;  3FOQ A;  4HO4 A;  1FZW A;  2APC A;  2QGI A;  4FRQ A;  1ZJ0 A;  1WT2 A;  1JYK A;  3V0Q A;  1VZT A;  2NXV A;  2VXL A;  3FWW A;  1K4V A;  4EEM A;  1Z90 A;  4GBP A;  3I0D A;  4FRB A;  5C4D A;  3OH0 A;  5C36 A;  5CMI A;  1ZCU A;  3NGW A;  5C1H A;  1VGW A;  3JUK A;  1G95 A;  4EEG A;  4AC3 A;  2AH9 A;  2RJ0 A;  2YES A;  1ZHJ A;  1S4O A;  4HO3 A;  4NAI A;  2WVM A;  3D8V A;  2VXM A;  2I5E A;  2X60 A;  2Q4J A;  2XWN A;  3HL3 A;  3U2X A;  1H4C A;  2MZB A;  3I0H A;  5C4E A;  4UEG A;  2V0I A;  5C48 A;  3USR A;  5J49 A;  1EYR A;  1ZI3 A;  2O1G A;  1VIC A;  2RIT A;  2OI7 A;  4R7P A;  3OKR A;  5C49 A;  1ZJO A;  3R3I A;  1TZF A;  1S4P A;  3D98 A;  4IRQ A;  2D0J A;  3IOH A;  3OAM A;  3U0Y A;  2VSH A;  2RJ6 A;  3EE5 A;  1IIM A;  4XWI A;  4KXO A;  2X5Z A;  2XME A;  2XMH A;  1NQI B;  1VZU A;  2VS3 A;  1H5S C;  2AGD A;  1G3L A;  5FYE A;  3U2V A;  5EIY A;  4HO5 A;  4M28 A;  1FXJ A;  4BMA A;  5CMF X;  3QVB A;  1QG8 A;  2Z87 A;  1O23 B;  2VS4 A;  4KQL A;  4Y6N A;  1VH3 A;  5DDT A;  3D5N A;  1SS9 A;  5AJP A;  2ZU8 A;  4D48 A;  1ZI1 A;  2JCJ A;  5IDT A;  3V90 A;  1V82 A;  4HO9 A;  4Y7F A;  5CQP A;  4Y7V A;  3ZGG A;  1G93 A;  1H7H A;  2AM5 A;  4EE3 A;  1FOA A;  4FRL A;  4B5B A;  3CGX A;  3SX8 A;  1ZDF A;  2RJ9 A;  3I0F A;  1XHB A;  4FQW A;  1ZI4 A;  1WT0 A;  4EEO A;  4B4M A;  3V91 A;  2JCK A;  2FYB A;  5FU8 A;  4M2A A;  3KIA A;  2AE7 A;  1GX0 A;  1VGT A;  3I0C A;  3OH1 A;  1JVD A;  4G87 A;  1LL2 A;  3PKQ A;  5FUH A;  4M2B A;  1JV3 A;  3Q80 A;  1LZ7 A;  2XWM A;  4J18 A;  2VSI A;  2UX8 A;  3F1Y A;  1H7G A;  4G3Q A;  4HO6 A;  4KNR A;  3DK5 A;  1ZCT A;  5FU0 A;  5FV9 A;  3SXE A;  3V0M A;  1NKH B;  2PX7 A;  2FFV A;  3CKJ A;  5CQN X;  1VGU A;  3JUJ A;  1ZIZ A;  3E26 A;  1G8O A;  2BO8 A;  1O0R A;  1ZJ1 A;  2RIY A;  2E8B A;  5BXC A;  3V0L A;  1OQM B;  1VZX A;  5JQQ A;  4FCU A;  3PNN A;  3Q4S A;  3OGZ A;  2VD4 A;  3CKO A;  1ZCV A;  1TVY A;  4O6M A;  1QGQ A;  1R7Y A;  3ZGF A;  4MND A;  5DDV A;  3K8D A;  1ZI5 A;  4Y62 A;  2P6W A;  4DDZ A;  3SX3 A;  3I0I X;  3ZLL A;  1R7T A;  2OEG A;  1ZJ3 A;  4Y6U A;  1G9R A;  1S4N A;  4AYJ A;  2BO6 A;  4Y7U A;  1G23 A;  2JCO A;  4HOC A;  3R2W A;  2FYC B;  4P02 A;  4FRH A;  4KRV A;  3T7M A;  1G1L A;  2WE9 A;  4G3S A;  1WT3 A;  1H7E A;  2Z86 A;  1YP3 A;  3DJ4 A;  2RJ8 A;  1YP2 A;  1NWG B;  3E25 A;  3TQD A;  2WGZ A;  1H7Q A;  1E5K A;  1YRO B;  3IOJ A;  1XZ6 A;  5C3D A;  1LVW A;  1EZI A;  4HCQ A;  5FTS A;  2E3D A;  2Y4L A;  3SXG A;  2I5K A;  5CMJ A;  1O7O A;  4ASY A;  2C0N A;  4E1K A;  3CU0 A;  4B4B A;  2ZU7 A;  4Y7G A;  2YQC A;  4D11 A;  2W0V A;  5C47 A;  3OC9 A;  4KC4 A;  4LW6 A;  1H5S D;  2J0A A;  4NAN A;  1GWV A;  2V0L A;  1KWS A;  1MP3 A;  1NMM B;  1H5T B;  1INI A;  1R81 A;  1PZT A;  1FGG A;  3OH4 A;  2YC5 A;  4DE7 A;  4FCE A;  3I0L A;  2ZU9 A;  2I7B A;  1FGX A;  3RMW A;  5L6V A;  2PGV A;  1HM9 A;  1HJJ A;  3U0X A;  2QH5 A;  2Y4K A;  5CQO A;  1H4E A;  3SXD A;  2P72 A;  4NAK A;  3JTJ A;  4Y9X A;  2X65 A;  5C4C A;  1V83 A;  4CVH A;  2JCL A;  1V84 A;  1HV9 A;  2RIZ A;  2WEE A;  3I0G A;  5EJ1 A;  1O7Q A;  1G0R A;  5CQM X;  5IDS A;  2A8W A;  5FTV A;  1IIN A;  4EEA A;  2BO7 A; 
#chains in the Genus database with same CATH homology
 1R82 A;  1FO8 A;  3SXA A;  2YCM A;  4EE5 A;  3N9W A;  1H7F A;  1JV1 A;  2Y4J A;  1VGZ A;  1H4D A;  2D7R A;  5EJZ A;  1G2V A;  2YQH A;  1NF5 B;  2V0K A;  2OEF A;  2GGQ A;  3USQ A;  4ARW A;  2ICX A;  1HM8 A;  4B42 A;  5C8R A;  2RJ7 A;  2WVK A;  1FG5 N;  2FFU A;  3GUE A;  4JIS A;  1H5R A;  4FRM A;  2D7I A;  5C1L A;  1MC3 A;  3OH3 A;  2VK9 A;  4FRA A;  4B2W A;  1H5S B;  2YQS A;  4D11 C;  4JD0 A;  1ON6 A;  1LL0 A;  1R7V A;  3I0K A;  1R80 A;  1JVG A;  4K6R A;  5C38 A;  4EE4 A;  4DEC A;  4AAW A;  4B2X A;  4LW3 A;  1LZJ A;  4FIX A;  4M4K A;  4MIX A;  4Q7C A;  3SXB A;  4ECM A;  4ZDQ A;  1FWY A;  2OI6 A;  5CQL X;  2YC3 A;  3F1C A;  1FRW A;  3V0N A;  1G97 A;  4D0Z A;  4KNX A;  2YQJ A;  2AM4 A;  5AJN A;  2O1F A;  1HM0 A;  4KPZ A;  3TZT A;  1VM8 A;  4YS8 A;  1FXO A;  1MP5 A;  4ASJ A;  2V0H A;  3POL A;  4CJ8 A;  4HG6 A;  5I1F A;  4FRD A;  2WVL A;  4G3P A;  2VS5 A;  3I0J A;  3V0O A;  4P00 A;  4FIY A;  3O3P A;  1NHE B;  1W57 A;  1H3M A;  5C3A A;  4AYL A;  1OMZ A;  1TW5 A;  1R7X A;  1ZCY A;  2RIX A;  1I52 A;  3BCV A;  1GQ9 A;  1GWW A;  1GQC A;  3CKN A;  3SX7 A;  3ZF8 A;  1LZI A;  5C4B A;  2RJ1 A;  4CJC A;  3OH2 A;  2J0B A;  2CU2 A;  3CKV A;  1YP4 A;  3CKQ A;  1MP4 A;  2PA4 A;  1QWJ A;  2Y6P A;  3K8E A;  4IRP A;  1H5T A;  2FY7 A;  4MYB A;  2AES A;  4FRO A;  2Y4M A;  1VPA A;  1ZJ2 A;  5CMH A;  2RJ5 A;  5HS2 A;  2A8U A;  3DUV A;  2OI5 A;  1OMX A;  4Y63 A;  4C2S A;  1WSZ A;  2AEC A;  4KC1 A;  2O1H A;  1LZ0 A;  1W55 A;  2FYD B;  1PZY B;  2AM3 A;  4CJB A;  4HO8 A;  4NAL A;  1WVC A;  2WAW A;  2XWL A;  1FO9 A;  4FRE A;  4Y7T A;  4HO2 A;  4KPX A;  1GX4 A;  3U2U A;  3ST8 A;  1ZDG A;  1ON8 A;  3BRK X;  4L41 C;  1HJL A;  4Y64 A;  5D92 A;  1JYL A;  2QKX A;  2BO4 A;  3RSB A;  3V8Z A;  1QGS A;  4B4G A;  3T7N A;  3V8Y A;  2P73 A;  3SPT A;  4KC2 A;  4BQH A;  2W0W A;  1FR9 A;  3RMV A;  5AJO A;  3I0E A;  3V0P A;  1W77 A;  1TW1 A;  2V0J A;  1INJ A;  2RJ4 A;  5C3B A;  1ZJP A;  3U2W A;  1LL3 A;  3U2T A;  2FYA A;  3PKP A;  5L6S A;  1GA8 A;  1WT1 A;  4HO0 A;  4O6N A;  4EVW A;  5C1G A;  4KT7 A;  2GGO A;  5C4F A;  5IFY A;  3LW6 A;  3T7O A;  2ICY A;  5D91 A;  2X5S A;  3ZLK A;  3IOI A;  2DPW A;  5CMG X;  4B3U A;  1H7T A;  1H5S A;  2PGY A;  3Q7U A;  1H5R B;  3SX5 A;  3SXC A;  1H7L A;  2Y7A A;  1R7U A;  4D0T A;  1FR8 A;  2VFZ A;  1VH1 A;  4FRP A;  3FOQ A;  4HO4 A;  1FZW A;  2APC A;  2QGI A;  4FRQ A;  1ZJ0 A;  1WT2 A;  1JYK A;  3V0Q A;  1VZT A;  2NXV A;  2VXL A;  3FWW A;  1K4V A;  4EEM A;  1Z90 A;  4GBP A;  3I0D A;  4FRB A;  5C4D A;  3OH0 A;  5C36 A;  5CMI A;  1ZCU A;  3NGW A;  5C1H A;  1VGW A;  3JUK A;  1G95 A;  4EEG A;  4AC3 A;  2AH9 A;  2RJ0 A;  2YES A;  1ZHJ A;  1S4O A;  4HO3 A;  4NAI A;  2WVM A;  3D8V A;  2VXM A;  2I5E A;  2X60 A;  2Q4J A;  2XWN A;  3HL3 A;  3U2X A;  1H4C A;  2MZB A;  3I0H A;  5C4E A;  4UEG A;  2V0I A;  5C48 A;  3USR A;  5J49 A;  1EYR A;  1ZI3 A;  2O1G A;  1VIC A;  2RIT A;  2OI7 A;  4R7P A;  3OKR A;  5C49 A;  1ZJO A;  3R3I A;  1TZF A;  1S4P A;  3D98 A;  4IRQ A;  2D0J A;  3IOH A;  3OAM A;  3U0Y A;  2VSH A;  2RJ6 A;  3EE5 A;  1IIM A;  4XWI A;  4KXO A;  2X5Z A;  2XME A;  2XMH A;  1NQI B;  1VZU A;  2VS3 A;  1H5S C;  2AGD A;  1G3L A;  5FYE A;  3U2V A;  5EIY A;  4HO5 A;  4M28 A;  1FXJ A;  4BMA A;  5CMF X;  3QVB A;  1QG8 A;  2Z87 A;  1O23 B;  2VS4 A;  4KQL A;  4Y6N A;  1VH3 A;  5DDT A;  3D5N A;  1SS9 A;  5AJP A;  2ZU8 A;  4D48 A;  1ZI1 A;  2JCJ A;  5IDT A;  3V90 A;  1V82 A;  4HO9 A;  4Y7F A;  5CQP A;  4Y7V A;  3ZGG A;  1G93 A;  1H7H A;  2AM5 A;  4EE3 A;  1FOA A;  4FRL A;  4B5B A;  3CGX A;  3SX8 A;  1ZDF A;  2RJ9 A;  3I0F A;  1XHB A;  4FQW A;  1ZI4 A;  1WT0 A;  4EEO A;  4B4M A;  3V91 A;  2JCK A;  2FYB A;  5FU8 A;  4M2A A;  3KIA A;  2AE7 A;  1GX0 A;  1VGT A;  3I0C A;  3OH1 A;  1JVD A;  4G87 A;  1LL2 A;  3PKQ A;  5FUH A;  4M2B A;  1JV3 A;  3Q80 A;  1LZ7 A;  2XWM A;  4J18 A;  2VSI A;  2UX8 A;  3F1Y A;  1H7G A;  4G3Q A;  4HO6 A;  4KNR A;  3DK5 A;  1ZCT A;  5FU0 A;  5FV9 A;  3SXE A;  3V0M A;  1NKH B;  2PX7 A;  2FFV A;  3CKJ A;  5CQN X;  1VGU A;  3JUJ A;  1ZIZ A;  3E26 A;  1G8O A;  2BO8 A;  1O0R A;  1ZJ1 A;  2RIY A;  2E8B A;  5BXC A;  3V0L A;  1OQM B;  1VZX A;  5JQQ A;  4FCU A;  3PNN A;  3Q4S A;  3OGZ A;  2VD4 A;  3CKO A;  1ZCV A;  1TVY A;  4O6M A;  1QGQ A;  1R7Y A;  3ZGF A;  4MND A;  5DDV A;  3K8D A;  1ZI5 A;  4Y62 A;  2P6W A;  4DDZ A;  3SX3 A;  3I0I X;  3ZLL A;  1R7T A;  2OEG A;  1ZJ3 A;  4Y6U A;  1G9R A;  1S4N A;  4AYJ A;  2BO6 A;  4Y7U A;  1G23 A;  2JCO A;  4HOC A;  3R2W A;  2FYC B;  4P02 A;  4FRH A;  4KRV A;  3T7M A;  1G1L A;  2WE9 A;  4G3S A;  1WT3 A;  1H7E A;  2Z86 A;  1YP3 A;  3DJ4 A;  2RJ8 A;  1YP2 A;  1NWG B;  3E25 A;  3TQD A;  2WGZ A;  1H7Q A;  1E5K A;  1YRO B;  3IOJ A;  1XZ6 A;  5C3D A;  1LVW A;  1EZI A;  4HCQ A;  5FTS A;  2E3D A;  2Y4L A;  3SXG A;  2I5K A;  5CMJ A;  1O7O A;  4ASY A;  2C0N A;  4E1K A;  3CU0 A;  4B4B A;  2ZU7 A;  4Y7G A;  2YQC A;  4D11 A;  2W0V A;  5C47 A;  3OC9 A;  4KC4 A;  4LW6 A;  1H5S D;  2J0A A;  4NAN A;  1GWV A;  2V0L A;  1KWS A;  1MP3 A;  1NMM B;  1H5T B;  1INI A;  1R81 A;  1PZT A;  1FGG A;  3OH4 A;  2YC5 A;  4DE7 A;  4FCE A;  3I0L A;  2ZU9 A;  2I7B A;  1FGX A;  3RMW A;  5L6V A;  2PGV A;  1HM9 A;  1HJJ A;  3U0X A;  2QH5 A;  2Y4K A;  5CQO A;  1H4E A;  3SXD A;  2P72 A;  4NAK A;  3JTJ A;  4Y9X A;  2X65 A;  5C4C A;  1V83 A;  4CVH A;  2JCL A;  1V84 A;  1HV9 A;  2RIZ A;  2WEE A;  3I0G A;  5EJ1 A;  1O7Q A;  1G0R A;  5CQM X;  5IDS A;  2A8W A;  5FTV A;  1IIN A;  4EEA A;  2BO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...