2WVMA

H309a mutant of mannosyl-3-phosphoglycerate synthase from thermus thermophilus hb27 in complex with gdp-alpha-d-mannose and mg(ii)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
391
structure length
375
Chain Sequence
MRLEIPNHTERFGVVRLHEVQRILELDSGRVRDESPAVGLRRLDDADLRDVLEQTAIVVPTRNERLKLLEGVLSGIPHEALILVASNSSPDRFQMERDLLEEFAHLTERPALIFHQKDPALAEALRAGGYPHPIGEDGLVRSGKAEGMILALVFAALSGRRYVGFIDADNYFPGAVWEYVRAYAAGFLMAKTPFAMVRILWRVVFRRYGRVSERNNRALNQLIGGVSGFETDVVKTANAGEHAMSLGLALRLPLASGYAVEPQELVSLLELYGGVFPLEDEEVLQHGVEIFQIETRNPALHENKGDEHIRDMLLACLATVYHSKLATEEVRQSVLEELQAAEEPPPPVLYPPLSSLDLQAVRKALRGHFSRFRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MANNOSYL-3-PHOSPHOGLYCERATE SYNTHASE
publication title Structural Analysis of Thermus Thermophilus Hb27 Mannosyl-3-Phosphoglycerate Synthase Provides Evidence for a Second Catalytic Metal Ion and New Insight Into the Retaining Mechanism of Glycosyltransferases.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 129
structure length 375
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.4.1.217: Mannosyl-3-phosphoglycerate synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09488 Osmo_MPGsynth Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2wvmA00
1W55A 2VS4A 1S4PA 1JV3A 2YQCA 1H7QA 1G3LA 1FWYA 1W77A 1HJLA 1GX4A 1FG5N 2OEFA 2X5SA 3SX8A 2BO7A 5C38A 3PNNA 3JTJA 5EJ1A 3ZLLA 4FCEA 4B2XA 2RIYA 3CKVA 1G95A 1S4OA 3OKRA 5L6SA 1V83A 3PKQA 4BQHA 3SXDA 3I0FA 3D5NA 1H5TA 1FO8A 3ZLKA 2RJ6A 1H5TB 3JUKA 1MP4A 1JVDA 1JV1A 2ICYA 3E26A 2RJ8A 4Y7FA 3D8VA 4NANA 4C2SA 3EE5A 4B42A 4G3QA 5CMHA 4KNXA 1WT3A 2V0HA 4BMAA 4CJ8A 2P6WA 3TQDA 4FRMA 5CMJA 2ZU7A 1O7OA 1QGQA 1PZTA 4XWIA 1TZFA 4Y7GA 4HO2A 1ON8A 2FYDB 1FGXA 1ZJ2A 2BO6A 2AM3A 4KC4A 1O0RA 2CU2A 1H7EA 1R7YA 1H5SD 2V0KA 4HO0A 4KT7A 3T7NA 2OI6A 3N9WA 2DPWA 4Y63A 4B2WA 2RJ5A 3Q80A 2AM5A 3U2XA 5C3AA 1ZCTA 2FFUA 3F1CA 1FOAA 1VH1A 2RJ9A 5CMFX 3DK5A 1NQIB 5C4FA 4EE3A 3SX3A 2GGQA 1EZIA 2E8BA 1ZJ3A 2WGZA 1QG8A 4GBPA 1ON6A 1R7VA 1H5RA 4Y6NA 3K8DA 3LW6A 3V0LA 3E25A 2UX8A 1GX0A 5C48A 3OH2A 1INIA 4KXOA 3SXBA 4B4GA 4NALA 1QGSA 2Y4KA 1HM0A 4AYJA 4HO3A 1TW5A 2WEEA 5DDTA 4HG6A 3F1YA 2JCJA 3I0EA 5CQMX 1ZI5A 2A8WA 3KIAA 4EEAA 2X65A 1VICA 1FGGA 2XWMA 2FFVA 3SXAA 2AESA 3U2TA 2JCOA 1W57A 4Y6UA 1I52A 1G0RA 4YS8A 4FREA 4FRPA 1LL3A 4HO5A 4M28A 2Y4JA 3SXCA 1Z90A 4DE7A 1V82A 4D11A 5EJZA 4EE5A 4DDZA 3V0MA 5JQQA 3RMWA 4FRLA 1G2VA 3CGXA 2W0VA 1ZIZA 3ST8A 2D0JA 4NAKA 2QGIA 4KPXA 1FXJA 2BO4A 3IOIA 5C4EA 5FTVA 4G3SA 1VZUA 3GUEA 2YQHA 1H4EA 3RMVA 2W0WA 2OEGA 2APCA 2E3DA 5FV9A 2OI5A 1H5SA 2V0JA 4P02A 1MP5A 1H5SB 2WVMA 1OQMB 1ZDFA 3NGWA 4AC3A 2VXMA 4B4BA 3U2WA 1NKHB 4ASJA 1E5KA 3V91A 4FRAA 2PGVA 3I0KA 3SX7A 2YQSA 3V8ZA 3R2WA 4D0ZA 5I1FA 3V90A 4Y7UA 5CQLX 2D7IA 4D11C 2Y4LA 5DDVA 2RJ4A 3DJ4A 3JUJA 4FRHA 5C1LA 3CKNA 4ECMA 1NWGB 2YESA 3QVBA 4B5BA 5CMGX 3D98A 4EEOA 3FOQA 3ZF8A 1IINA 4LW6A 2FYAA 1XZ6A 1ZCUA 2YC3A 1XHBA 2V0IA 1K4VA 2AE7A 1ZI1A 3T7OA 4Y7TA 1VPAA 2ZU8A 2ZU9A 3K8EA 1GWVA 1TW1A 1YP3A 3V0PA 1NF5B 2PGYA 5C36A 1G8OA 5IFYA 5HS2A 1ZJPA 4Y62A 1R80A 3CU0A 4M4KA 5CQPA 3OC9A 1VZTA 4G3PA 3HL3A 1LZJA 1WT1A 1MC3A 1ZCVA 1JVGA 3USRA 1HJJA 3I0GA 3SXGA 2VSHA 3DUVA 1O23B 1FZWA 2Y4MA 4AAWA 2JCKA 2AGDA 1VZXA 1WVCA 4P00A 4EE4A 2XMEA 3T7MA 3R3IA 2VS5A 2X60A 3SXEA 5EIYA 3V8YA 1JYLA 1H7GA 1S4NA 3RSBA 3U2UA 2AM4A 3CKOA 5C49A 4AYLA 2GGOA 2Y7AA 2YCMA 4J18A 5C47A 2FYBA 4B4MA 3U2VA 2XMHA 2RITA 1FR9A 5AJOA 1GQCA 1VGZA 4KC2A 5C4CA 1R7XA 3ZGFA 3TZTA 2AECA 2WE9A 5BXCA 1YP4A 1LZIA 4K6RA 1FR8A 3BRKX 2D7RA 3ZGGA 2ICXA 2RJ7A 4UEGA 2PX7A 5AJPA 2XWLA 3SPTA 1ZCYA 2QH5A 4EEGA 2JCLA 4MYBA 1VGUA 4FRQA 5C1HA 3OH1A 4M2BA 2X5ZA 4KRVA 4Y64A 3U0XA 1NMMB 2MZBA 3I0HA 1JYKA 1LL2A 5FYEA 2Q4JA 4E1KA 3OH4A 4FQWA 1ZI4A 1FRWA 2YQJA 1R7UA 4LW3A 4ARWA 4FCUA 2VXLA 4Y9XA 3I0JA 3IOJA 1ZI3A 4HO6A 1KWSA 1EYRA 2PA4A 2RIZA 1LL0A 2I7BA 2P72A 4FROA 5AJNA 2VS3A 4HOCA 3SX5A 4L41C 1VH3A 2VSIA 4B3UA 4Y7VA 2WVKA 4KQLA 4R7PA 5C3DA 2O1FA 5CQNX 5CMIA 5IDTA 5C4DA 3I0CA 2FYCB 3OH3A 1H3MA 2V0LA 4G87A 1HM9A 1SS9A 4ZDQA 1OMXA 4KPZA 1G1LA 2WVLA 1H7FA 3O3PA 1WSZA 2O1GA 1H7LA 1LZ0A 4D0TA 1H5SC 4JD0A 1ZJ0A 1H7HA 2RIXA 1G9RA 3U0YA 1G23A 4CJBA 3V0NA 1G97A 1GA8A 2WAWA 1V84A 3I0LA 3I0IX 5C3BA 2P73A 4MNDA 2Z87A 1O7QA 2AH9A 1ZJ1A 3OH0A 4D48A 4KNRA 5J49A 4IRQA 1HV9A 1GQ9A 2XWNA 3USQA 1LVWA 1FO9A 2Z86A 1WT0A 4ASYA 5CQOA 1YP2A 1FXOA 1R7TA 4HCQA 2RJ0A 5IDSA 4EEMA 2O1HA 3Q4SA 4HO4A 1VGWA 1ZHJA 3OAMA 1MP3A 5FTSA 3Q7UA 1WT2A 3PKPA 3V0QA 1ZDGA 4CVHA 1R82A 1IIMA 1NHEB 1PZYB 4KC1A 1H5RB 2BO8A 3BCVA 1VM8A 1YROB 1INJA 2A8UA 5C4BA 5C1GA 1R81A 1OMZA 1QWJA 3OGZA 1G93A 4HO8A 2VD4A 4HO9A 3IOHA 4CJCA 3V0OA 4JISA 1ZJOA 1H4CA 2I5EA 1HM8A 3CKQA 2QKXA 2OI7A 3FWWA 2YC5A 5FUHA 1GWWA 3CKJA 4M2AA 2RJ1A 1TVYA 1H7TA 2VFZA 1LZ7A 4DECA 2I5KA 2FY7A 5L6VA 3POLA 3I0DA 4FRBA 1VGTA 4EVWA 4FRDA 2NXVA 1H4DA 2Y6PA 4IRPA 5C8RA 5FU0A 4NAIA 5FU8A
chains in the Genus database with same CATH superfamily
1W55A 2VS4A 1S4PA 1JV3A 2YQCA 1H7QA 1G3LA 1FWYA 1W77A 1HJLA 1GX4A 1FG5N 4O6NA 2OEFA 2X5SA 3SX8A 2BO7A 5C38A 3PNNA 3JTJA 5EJ1A 3ZLLA 4FCEA 4B2XA 2RIYA 3CKVA 1G95A 1S4OA 3OKRA 5L6SA 1V83A 3PKQA 4BQHA 3SXDA 3I0FA 3D5NA 1H5TA 1FO8A 3ZLKA 2RJ6A 1H5TB 3JUKA 1MP4A 1JVDA 1JV1A 4Q7CA 2ICYA 3E26A 2RJ8A 4Y7FA 3D8VA 4MIXA 4NANA 5D91A 4C2SA 3EE5A 4B42A 4G3QA 5CMHA 4KNXA 1WT3A 2V0HA 4BMAA 4CJ8A 2P6WA 3TQDA 4FRMA 5CMJA 2ZU7A 1O7OA 1QGQA 1PZTA 4XWIA 1TZFA 4Y7GA 4HO2A 1ON8A 2FYDB 1FGXA 1ZJ2A 2BO6A 2AM3A 4FIYA 4KC4A 1O0RA 2CU2A 1H7EA 1R7YA 1H5SD 2V0KA 4HO0A 4KT7A 3T7NA 2OI6A 3N9WA 2DPWA 4Y63A 4B2WA 2RJ5A 3Q80A 2AM5A 3U2XA 5C3AA 1ZCTA 2FFUA 3F1CA 1FOAA 1VH1A 2RJ9A 2VK9A 5CMFX 3DK5A 1NQIB 5C4FA 4EE3A 3SX3A 2GGQA 1EZIA 2E8BA 1ZJ3A 2WGZA 1QG8A 4GBPA 1ON6A 1R7VA 1H5RA 4Y6NA 3K8DA 3LW6A 3V0LA 3E25A 2UX8A 1GX0A 5C48A 3OH2A 1INIA 4KXOA 3SXBA 4B4GA 4NALA 1QGSA 2Y4KA 1HM0A 4AYJA 4HO3A 1TW5A 2WEEA 5DDTA 4HG6A 3F1YA 2JCJA 3I0EA 5CQMX 1ZI5A 2A8WA 3KIAA 4EEAA 2X65A 1VICA 1FGGA 2XWMA 2FFVA 3SXAA 2AESA 3U2TA 2JCOA 1W57A 4Y6UA 1I52A 1G0RA 4YS8A 4FREA 4FRPA 1LL3A 4HO5A 4M28A 2Y4JA 3SXCA 1Z90A 4DE7A 1V82A 4D11A 5EJZA 4EE5A 4DDZA 4O6MA 3V0MA 5JQQA 3RMWA 4FRLA 1G2VA 3CGXA 2W0VA 1ZIZA 3ST8A 2D0JA 4NAKA 2QGIA 4KPXA 1FXJA 2BO4A 3IOIA 5C4EA 5FTVA 4G3SA 1VZUA 3GUEA 2YQHA 1H4EA 3RMVA 2W0WA 2OEGA 2APCA 2E3DA 5FV9A 2OI5A 1H5SA 2V0JA 4P02A 1MP5A 1H5SB 2WVMA 1OQMB 1ZDFA 3NGWA 4AC3A 2VXMA 4B4BA 3U2WA 1NKHB 4ASJA 1E5KA 3V91A 4FRAA 2PGVA 3I0KA 3SX7A 2YQSA 3V8ZA 3R2WA 4D0ZA 5I1FA 3V90A 4Y7UA 5CQLX 2D7IA 4D11C 2Y4LA 5DDVA 2RJ4A 3DJ4A 3JUJA 4FRHA 5C1LA 3CKNA 4ECMA 1NWGB 2YESA 3QVBA 4B5BA 5CMGX 3D98A 4EEOA 3FOQA 3ZF8A 1IINA 4LW6A 2FYAA 1XZ6A 1ZCUA 2YC3A 5D92A 1XHBA 2V0IA 1K4VA 2AE7A 1ZI1A 3T7OA 4Y7TA 1VPAA 2ZU8A 2ZU9A 3K8EA 1GWVA 1TW1A 1YP3A 3V0PA 1NF5B 2PGYA 5C36A 1G8OA 5IFYA 5HS2A 1ZJPA 4Y62A 1R80A 3CU0A 4M4KA 5CQPA 3OC9A 1VZTA 4G3PA 3HL3A 1LZJA 1WT1A 1MC3A 1ZCVA 1JVGA 3USRA 1HJJA 3I0GA 3SXGA 2VSHA 3DUVA 1O23B 1FZWA 2Y4MA 4AAWA 2JCKA 2AGDA 1VZXA 1WVCA 4P00A 4EE4A 2XMEA 3T7MA 3R3IA 2VS5A 2X60A 3SXEA 5EIYA 3V8YA 1JYLA 1H7GA 1S4NA 3RSBA 3U2UA 2AM4A 3CKOA 5C49A 2J0AA 4AYLA 2GGOA 2Y7AA 2YCMA 4J18A 5C47A 2FYBA 2C0NA 4B4MA 3U2VA 2XMHA 2RITA 1FR9A 5AJOA 1GQCA 1VGZA 4KC2A 5C4CA 1R7XA 3ZGFA 3TZTA 2AECA 2WE9A 5BXCA 1YP4A 1LZIA 4K6RA 1FR8A 3BRKX 2D7RA 3ZGGA 2ICXA 2RJ7A 4UEGA 2PX7A 5AJPA 2XWLA 3SPTA 1ZCYA 2QH5A 4EEGA 2JCLA 4MYBA 1VGUA 4FRQA 5C1HA 3OH1A 4M2BA 2X5ZA 4KRVA 4Y64A 3U0XA 1NMMB 2MZBA 3I0HA 1JYKA 1LL2A 5FYEA 2Q4JA 4E1KA 3OH4A 4FQWA 1ZI4A 1FRWA 2YQJA 1R7UA 4LW3A 4ARWA 4FCUA 2VXLA 4Y9XA 3I0JA 3IOJA 1ZI3A 4HO6A 1KWSA 1EYRA 2PA4A 2RIZA 1LL0A 2I7BA 2P72A 4FROA 5AJNA 2VS3A 4HOCA 3SX5A 4L41C 1VH3A 2VSIA 4B3UA 4Y7VA 2WVKA 4KQLA 4R7PA 5C3DA 2O1FA 5CQNX 5CMIA 4FIXA 5IDTA 5C4DA 3I0CA 2FYCB 3OH3A 1H3MA 2V0LA 4G87A 1HM9A 1SS9A 4ZDQA 1OMXA 4KPZA 1G1LA 2WVLA 1H7FA 3O3PA 1WSZA 2O1GA 1H7LA 1LZ0A 4D0TA 1H5SC 4JD0A 1ZJ0A 1H7HA 2RIXA 1G9RA 3U0YA 1G23A 4CJBA 3V0NA 1G97A 1GA8A 2WAWA 1V84A 3I0LA 3I0IX 5C3BA 2P73A 4MNDA 2Z87A 1O7QA 2AH9A 1ZJ1A 3OH0A 4D48A 4KNRA 5J49A 4IRQA 1HV9A 1GQ9A 2XWNA 3USQA 1LVWA 1FO9A 2Z86A 1WT0A 4ASYA 5CQOA 1YP2A 1FXOA 1R7TA 4HCQA 2RJ0A 5IDSA 4EEMA 2O1HA 3Q4SA 4HO4A 1VGWA 1ZHJA 3OAMA 1MP3A 5FTSA 3Q7UA 1WT2A 3PKPA 3V0QA 1ZDGA 4CVHA 1R82A 1IIMA 1NHEB 1PZYB 4KC1A 1H5RB 2BO8A 3BCVA 1VM8A 1YROB 1INJA 2A8UA 5C4BA 5C1GA 1R81A 1OMZA 1QWJA 3OGZA 1G93A 4HO8A 2VD4A 4HO9A 3IOHA 4CJCA 3V0OA 4JISA 1ZJOA 1H4CA 2I5EA 1HM8A 3CKQA 2QKXA 2OI7A 3FWWA 2YC5A 5FUHA 1GWWA 3CKJA 4M2AA 2RJ1A 1TVYA 1H7TA 2VFZA 1LZ7A 4DECA 2I5KA 2FY7A 5L6VA 3POLA 3I0DA 4FRBA 1VGTA 4EVWA 4FRDA 2NXVA 1H4DA 2Y6PA 4IRPA 5C8RA 5FU0A 4NAIA 5FU8A 2J0BA
chains in the Genus database with same CATH topology
1W55A 2VS4A 1S4PA 1JV3A 2YQCA 1H7QA 1G3LA 1FWYA 1W77A 1HJLA 1GX4A 1FG5N 4O6NA 2OEFA 2X5SA 3SX8A 2BO7A 5C38A 3PNNA 3JTJA 5EJ1A 3ZLLA 4FCEA 4B2XA 2RIYA 3CKVA 1G95A 1S4OA 3OKRA 5L6SA 1V83A 3PKQA 4BQHA 3SXDA 3I0FA 3D5NA 1H5TA 1FO8A 3ZLKA 2RJ6A 1H5TB 3JUKA 1MP4A 1JVDA 1JV1A 4Q7CA 2ICYA 3E26A 2RJ8A 4Y7FA 3D8VA 4MIXA 4NANA 5D91A 4C2SA 3EE5A 4B42A 4G3QA 5CMHA 4KNXA 1WT3A 2V0HA 4BMAA 4CJ8A 2P6WA 3TQDA 4FRMA 5CMJA 2ZU7A 1O7OA 1QGQA 1PZTA 4XWIA 1TZFA 4Y7GA 4HO2A 1ON8A 2FYDB 1FGXA 1ZJ2A 2BO6A 2AM3A 4FIYA 4KC4A 1O0RA 2CU2A 1H7EA 1R7YA 1H5SD 2V0KA 4HO0A 4KT7A 3T7NA 2OI6A 3N9WA 2DPWA 4Y63A 4B2WA 2RJ5A 3Q80A 2AM5A 3U2XA 5C3AA 1ZCTA 2FFUA 3F1CA 1FOAA 1VH1A 2RJ9A 2VK9A 5CMFX 3DK5A 1NQIB 5C4FA 4EE3A 3SX3A 2GGQA 1EZIA 2E8BA 1ZJ3A 2WGZA 1QG8A 4GBPA 1ON6A 1R7VA 1H5RA 4Y6NA 3K8DA 3LW6A 3V0LA 3E25A 2UX8A 1GX0A 5C48A 3OH2A 1INIA 4KXOA 3SXBA 4B4GA 4NALA 1QGSA 2Y4KA 1HM0A 4AYJA 4HO3A 1TW5A 2WEEA 5DDTA 4HG6A 3F1YA 2JCJA 3I0EA 5CQMX 1ZI5A 2A8WA 3KIAA 4EEAA 2X65A 1VICA 1FGGA 2XWMA 2FFVA 3SXAA 2AESA 3U2TA 2JCOA 1W57A 4Y6UA 1I52A 1G0RA 4YS8A 4FREA 4FRPA 1LL3A 4HO5A 4M28A 2Y4JA 3SXCA 1Z90A 4DE7A 1V82A 4D11A 5EJZA 4EE5A 4DDZA 4O6MA 3V0MA 5JQQA 3RMWA 4FRLA 1G2VA 3CGXA 2W0VA 1ZIZA 3ST8A 2D0JA 4NAKA 2QGIA 4KPXA 1FXJA 2BO4A 3IOIA 5C4EA 5FTVA 4G3SA 1VZUA 3GUEA 2YQHA 1H4EA 3RMVA 2W0WA 2OEGA 2APCA 2E3DA 5FV9A 2OI5A 1H5SA 2V0JA 4P02A 1MP5A 1H5SB 2WVMA 1OQMB 1ZDFA 3NGWA 4AC3A 2VXMA 4B4BA 3U2WA 1NKHB 4ASJA 1E5KA 3V91A 4FRAA 2PGVA 3I0KA 3SX7A 2YQSA 3V8ZA 3R2WA 4D0ZA 5I1FA 3V90A 4Y7UA 5CQLX 2D7IA 4D11C 2Y4LA 5DDVA 2RJ4A 3DJ4A 3JUJA 4FRHA 5C1LA 3CKNA 4ECMA 1NWGB 2YESA 3QVBA 4B5BA 5CMGX 3D98A 4EEOA 3FOQA 3ZF8A 1IINA 4LW6A 2FYAA 1XZ6A 1ZCUA 2YC3A 5D92A 1XHBA 2V0IA 1K4VA 2AE7A 1ZI1A 3T7OA 4Y7TA 1VPAA 2ZU8A 2ZU9A 3K8EA 1GWVA 1TW1A 1YP3A 3V0PA 1NF5B 2PGYA 5C36A 1G8OA 5IFYA 5HS2A 1ZJPA 4Y62A 1R80A 3CU0A 4M4KA 5CQPA 3OC9A 1VZTA 4G3PA 3HL3A 1LZJA 1WT1A 1MC3A 1ZCVA 1JVGA 3USRA 1HJJA 3I0GA 3SXGA 2VSHA 3DUVA 1O23B 1FZWA 2Y4MA 4AAWA 2JCKA 2AGDA 1VZXA 1WVCA 4P00A 4EE4A 2XMEA 3T7MA 3R3IA 2VS5A 2X60A 3SXEA 5EIYA 3V8YA 1JYLA 1H7GA 1S4NA 3RSBA 3U2UA 2AM4A 3CKOA 5C49A 2J0AA 4AYLA 2GGOA 2Y7AA 2YCMA 4J18A 5C47A 2FYBA 2C0NA 4B4MA 3U2VA 2XMHA 2RITA 1FR9A 5AJOA 1GQCA 1VGZA 4KC2A 5C4CA 1R7XA 3ZGFA 3TZTA 2AECA 2WE9A 5BXCA 1YP4A 1LZIA 4K6RA 1FR8A 3BRKX 2D7RA 3ZGGA 2ICXA 2RJ7A 4UEGA 2PX7A 5AJPA 2XWLA 3SPTA 1ZCYA 2QH5A 4EEGA 2JCLA 4MYBA 1VGUA 4FRQA 5C1HA 3OH1A 4M2BA 2X5ZA 4KRVA 4Y64A 3U0XA 1NMMB 2MZBA 3I0HA 1JYKA 1LL2A 5FYEA 2Q4JA 4E1KA 3OH4A 4FQWA 1ZI4A 1FRWA 2YQJA 1R7UA 4LW3A 4ARWA 4FCUA 2VXLA 4Y9XA 3I0JA 3IOJA 1ZI3A 4HO6A 1KWSA 1EYRA 2PA4A 2RIZA 1LL0A 2I7BA 2P72A 4FROA 5AJNA 2VS3A 4HOCA 3SX5A 4L41C 1VH3A 2VSIA 4B3UA 4Y7VA 2WVKA 4KQLA 4R7PA 5C3DA 2O1FA 5CQNX 5CMIA 4FIXA 5IDTA 5C4DA 3I0CA 2FYCB 3OH3A 1H3MA 2V0LA 4G87A 1HM9A 1SS9A 4ZDQA 1OMXA 4KPZA 1G1LA 2WVLA 1H7FA 3O3PA 1WSZA 2O1GA 1H7LA 1LZ0A 4D0TA 1H5SC 4JD0A 1ZJ0A 1H7HA 2RIXA 1G9RA 3U0YA 1G23A 4CJBA 3V0NA 1G97A 1GA8A 2WAWA 1V84A 3I0LA 3I0IX 5C3BA 2P73A 4MNDA 2Z87A 1O7QA 2AH9A 1ZJ1A 3OH0A 4D48A 4KNRA 5J49A 4IRQA 1HV9A 1GQ9A 2XWNA 3USQA 1LVWA 1FO9A 2Z86A 1WT0A 4ASYA 5CQOA 1YP2A 1FXOA 1R7TA 4HCQA 2RJ0A 5IDSA 4EEMA 2O1HA 3Q4SA 4HO4A 1VGWA 1ZHJA 3OAMA 1MP3A 5FTSA 3Q7UA 1WT2A 3PKPA 3V0QA 1ZDGA 4CVHA 1R82A 1IIMA 1NHEB 1PZYB 4KC1A 1H5RB 2BO8A 3BCVA 1VM8A 1YROB 1INJA 2A8UA 5C4BA 5C1GA 1R81A 1OMZA 1QWJA 3OGZA 1G93A 4HO8A 2VD4A 4HO9A 3IOHA 4CJCA 3V0OA 4JISA 1ZJOA 1H4CA 2I5EA 1HM8A 3CKQA 2QKXA 2OI7A 3FWWA 2YC5A 5FUHA 1GWWA 3CKJA 4M2AA 2RJ1A 1TVYA 1H7TA 2VFZA 1LZ7A 4DECA 2I5KA 2FY7A 5L6VA 3POLA 3I0DA 4FRBA 1VGTA 4EVWA 4FRDA 2NXVA 1H4DA 2Y6PA 4IRPA 5C8RA 5FU0A 4NAIA 5FU8A 2J0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W55 A;  2VS4 A;  1S4P A;  1JV3 A;  2YQC A;  1H7Q A;  1G3L A;  1FWY A;  1W77 A;  1HJL A;  1GX4 A;  1FG5 N;  2OEF A;  2X5S A;  3SX8 A;  2BO7 A;  5C38 A;  3PNN A;  3JTJ A;  5EJ1 A;  3ZLL A;  4FCE A;  4B2X A;  2RIY A;  3CKV A;  1G95 A;  1S4O A;  3OKR A;  5L6S A;  1V83 A;  3PKQ A;  4BQH A;  3SXD A;  3I0F A;  3D5N A;  1H5T A;  1FO8 A;  3ZLK A;  2RJ6 A;  1H5T B;  3JUK A;  1MP4 A;  1JVD A;  1JV1 A;  2ICY A;  3E26 A;  2RJ8 A;  4Y7F A;  3D8V A;  4NAN A;  4C2S A;  3EE5 A;  4B42 A;  4G3Q A;  5CMH A;  4KNX A;  1WT3 A;  2V0H A;  4BMA A;  4CJ8 A;  2P6W A;  3TQD A;  4FRM A;  5CMJ A;  2ZU7 A;  1O7O A;  1QGQ A;  1PZT A;  4XWI A;  1TZF A;  4Y7G A;  4HO2 A;  1ON8 A;  2FYD B;  1FGX A;  1ZJ2 A;  2BO6 A;  2AM3 A;  4KC4 A;  1O0R A;  2CU2 A;  1H7E A;  1R7Y A;  1H5S D;  2V0K A;  4HO0 A;  4KT7 A;  3T7N A;  2OI6 A;  3N9W A;  2DPW A;  4Y63 A;  4B2W A;  2RJ5 A;  3Q80 A;  2AM5 A;  3U2X A;  5C3A A;  1ZCT A;  2FFU A;  3F1C A;  1FOA A;  1VH1 A;  2RJ9 A;  5CMF X;  3DK5 A;  1NQI B;  5C4F A;  4EE3 A;  3SX3 A;  2GGQ A;  1EZI A;  2E8B A;  1ZJ3 A;  2WGZ A;  1QG8 A;  4GBP A;  1ON6 A;  1R7V A;  1H5R A;  4Y6N A;  3K8D A;  3LW6 A;  3V0L A;  3E25 A;  2UX8 A;  1GX0 A;  5C48 A;  3OH2 A;  1INI A;  4KXO A;  3SXB A;  4B4G A;  4NAL A;  1QGS A;  2Y4K A;  1HM0 A;  4AYJ A;  4HO3 A;  1TW5 A;  2WEE A;  5DDT A;  4HG6 A;  3F1Y A;  2JCJ A;  3I0E A;  5CQM X;  1ZI5 A;  2A8W A;  3KIA A;  4EEA A;  2X65 A;  1VIC A;  1FGG A;  2XWM A;  2FFV A;  3SXA A;  2AES A;  3U2T A;  2JCO A;  1W57 A;  4Y6U A;  1I52 A;  1G0R A;  4YS8 A;  4FRE A;  4FRP A;  1LL3 A;  4HO5 A;  4M28 A;  2Y4J A;  3SXC A;  1Z90 A;  4DE7 A;  1V82 A;  4D11 A;  5EJZ A;  4EE5 A;  4DDZ A;  3V0M A;  5JQQ A;  3RMW A;  4FRL A;  1G2V A;  3CGX A;  2W0V A;  1ZIZ A;  3ST8 A;  2D0J A;  4NAK A;  2QGI A;  4KPX A;  1FXJ A;  2BO4 A;  3IOI A;  5C4E A;  5FTV A;  4G3S A;  1VZU A;  3GUE A;  2YQH A;  1H4E A;  3RMV A;  2W0W A;  2OEG A;  2APC A;  2E3D A;  5FV9 A;  2OI5 A;  1H5S A;  2V0J A;  4P02 A;  1MP5 A;  1H5S B;  2WVM A;  1OQM B;  1ZDF A;  3NGW A;  4AC3 A;  2VXM A;  4B4B A;  3U2W A;  1NKH B;  4ASJ A;  1E5K A;  3V91 A;  4FRA A;  2PGV A;  3I0K A;  3SX7 A;  2YQS A;  3V8Z A;  3R2W A;  4D0Z A;  5I1F A;  3V90 A;  4Y7U A;  5CQL X;  2D7I A;  4D11 C;  2Y4L A;  5DDV A;  2RJ4 A;  3DJ4 A;  3JUJ A;  4FRH A;  5C1L A;  3CKN A;  4ECM A;  1NWG B;  2YES A;  3QVB A;  4B5B A;  5CMG X;  3D98 A;  4EEO A;  3FOQ A;  3ZF8 A;  1IIN A;  4LW6 A;  2FYA A;  1XZ6 A;  1ZCU A;  2YC3 A;  1XHB A;  2V0I A;  1K4V A;  2AE7 A;  1ZI1 A;  3T7O A;  4Y7T A;  1VPA A;  2ZU8 A;  2ZU9 A;  3K8E A;  1GWV A;  1TW1 A;  1YP3 A;  3V0P A;  1NF5 B;  2PGY A;  5C36 A;  1G8O A;  5IFY A;  5HS2 A;  1ZJP A;  4Y62 A;  1R80 A;  3CU0 A;  4M4K A;  5CQP A;  3OC9 A;  1VZT A;  4G3P A;  3HL3 A;  1LZJ A;  1WT1 A;  1MC3 A;  1ZCV A;  1JVG A;  3USR A;  1HJJ A;  3I0G A;  3SXG A;  2VSH A;  3DUV A;  1O23 B;  1FZW A;  2Y4M A;  4AAW A;  2JCK A;  2AGD A;  1VZX A;  1WVC A;  4P00 A;  4EE4 A;  2XME A;  3T7M A;  3R3I A;  2VS5 A;  2X60 A;  3SXE A;  5EIY A;  3V8Y A;  1JYL A;  1H7G A;  1S4N A;  3RSB A;  3U2U A;  2AM4 A;  3CKO A;  5C49 A;  4AYL A;  2GGO A;  2Y7A A;  2YCM A;  4J18 A;  5C47 A;  2FYB A;  4B4M A;  3U2V A;  2XMH A;  2RIT A;  1FR9 A;  5AJO A;  1GQC A;  1VGZ A;  4KC2 A;  5C4C A;  1R7X A;  3ZGF A;  3TZT A;  2AEC A;  2WE9 A;  5BXC A;  1YP4 A;  1LZI A;  4K6R A;  1FR8 A;  3BRK X;  2D7R A;  3ZGG A;  2ICX A;  2RJ7 A;  4UEG A;  2PX7 A;  5AJP A;  2XWL A;  3SPT A;  1ZCY A;  2QH5 A;  4EEG A;  2JCL A;  4MYB A;  1VGU A;  4FRQ A;  5C1H A;  3OH1 A;  4M2B A;  2X5Z A;  4KRV A;  4Y64 A;  3U0X A;  1NMM B;  2MZB A;  3I0H A;  1JYK A;  1LL2 A;  5FYE A;  2Q4J A;  4E1K A;  3OH4 A;  4FQW A;  1ZI4 A;  1FRW A;  2YQJ A;  1R7U A;  4LW3 A;  4ARW A;  4FCU A;  2VXL A;  4Y9X A;  3I0J A;  3IOJ A;  1ZI3 A;  4HO6 A;  1KWS A;  1EYR A;  2PA4 A;  2RIZ A;  1LL0 A;  2I7B A;  2P72 A;  4FRO A;  5AJN A;  2VS3 A;  4HOC A;  3SX5 A;  4L41 C;  1VH3 A;  2VSI A;  4B3U A;  4Y7V A;  2WVK A;  4KQL A;  4R7P A;  5C3D A;  2O1F A;  5CQN X;  5CMI A;  5IDT A;  5C4D A;  3I0C A;  2FYC B;  3OH3 A;  1H3M A;  2V0L A;  4G87 A;  1HM9 A;  1SS9 A;  4ZDQ A;  1OMX A;  4KPZ A;  1G1L A;  2WVL A;  1H7F A;  3O3P A;  1WSZ A;  2O1G A;  1H7L A;  1LZ0 A;  4D0T A;  1H5S C;  4JD0 A;  1ZJ0 A;  1H7H A;  2RIX A;  1G9R A;  3U0Y A;  1G23 A;  4CJB A;  3V0N A;  1G97 A;  1GA8 A;  2WAW A;  1V84 A;  3I0L A;  3I0I X;  5C3B A;  2P73 A;  4MND A;  2Z87 A;  1O7Q A;  2AH9 A;  1ZJ1 A;  3OH0 A;  4D48 A;  4KNR A;  5J49 A;  4IRQ A;  1HV9 A;  1GQ9 A;  2XWN A;  3USQ A;  1LVW A;  1FO9 A;  2Z86 A;  1WT0 A;  4ASY A;  5CQO A;  1YP2 A;  1FXO A;  1R7T A;  4HCQ A;  2RJ0 A;  5IDS A;  4EEM A;  2O1H A;  3Q4S A;  4HO4 A;  1VGW A;  1ZHJ A;  3OAM A;  1MP3 A;  5FTS A;  3Q7U A;  1WT2 A;  3PKP A;  3V0Q A;  1ZDG A;  4CVH A;  1R82 A;  1IIM A;  1NHE B;  1PZY B;  4KC1 A;  1H5R B;  2BO8 A;  3BCV A;  1VM8 A;  1YRO B;  1INJ A;  2A8U A;  5C4B A;  5C1G A;  1R81 A;  1OMZ A;  1QWJ A;  3OGZ A;  1G93 A;  4HO8 A;  2VD4 A;  4HO9 A;  3IOH A;  4CJC A;  3V0O A;  4JIS A;  1ZJO A;  1H4C A;  2I5E A;  1HM8 A;  3CKQ A;  2QKX A;  2OI7 A;  3FWW A;  2YC5 A;  5FUH A;  1GWW A;  3CKJ A;  4M2A A;  2RJ1 A;  1TVY A;  1H7T A;  2VFZ A;  1LZ7 A;  4DEC A;  2I5K A;  2FY7 A;  5L6V A;  3POL A;  3I0D A;  4FRB A;  1VGT A;  4EVW A;  4FRD A;  2NXV A;  1H4D A;  2Y6P A;  4IRP A;  5C8R A;  5FU0 A;  4NAI A;  5FU8 A; 
#chains in the Genus database with same CATH topology
 1W55 A;  2VS4 A;  1S4P A;  1JV3 A;  2YQC A;  1H7Q A;  1G3L A;  1FWY A;  1W77 A;  1HJL A;  1GX4 A;  1FG5 N;  4O6N A;  2OEF A;  2X5S A;  3SX8 A;  2BO7 A;  5C38 A;  3PNN A;  3JTJ A;  5EJ1 A;  3ZLL A;  4FCE A;  4B2X A;  2RIY A;  3CKV A;  1G95 A;  1S4O A;  3OKR A;  5L6S A;  1V83 A;  3PKQ A;  4BQH A;  3SXD A;  3I0F A;  3D5N A;  1H5T A;  1FO8 A;  3ZLK A;  2RJ6 A;  1H5T B;  3JUK A;  1MP4 A;  1JVD A;  1JV1 A;  4Q7C A;  2ICY A;  3E26 A;  2RJ8 A;  4Y7F A;  3D8V A;  4MIX A;  4NAN A;  5D91 A;  4C2S A;  3EE5 A;  4B42 A;  4G3Q A;  5CMH A;  4KNX A;  1WT3 A;  2V0H A;  4BMA A;  4CJ8 A;  2P6W A;  3TQD A;  4FRM A;  5CMJ A;  2ZU7 A;  1O7O A;  1QGQ A;  1PZT A;  4XWI A;  1TZF A;  4Y7G A;  4HO2 A;  1ON8 A;  2FYD B;  1FGX A;  1ZJ2 A;  2BO6 A;  2AM3 A;  4FIY A;  4KC4 A;  1O0R A;  2CU2 A;  1H7E A;  1R7Y A;  1H5S D;  2V0K A;  4HO0 A;  4KT7 A;  3T7N A;  2OI6 A;  3N9W A;  2DPW A;  4Y63 A;  4B2W A;  2RJ5 A;  3Q80 A;  2AM5 A;  3U2X A;  5C3A A;  1ZCT A;  2FFU A;  3F1C A;  1FOA A;  1VH1 A;  2RJ9 A;  2VK9 A;  5CMF X;  3DK5 A;  1NQI B;  5C4F A;  4EE3 A;  3SX3 A;  2GGQ A;  1EZI A;  2E8B A;  1ZJ3 A;  2WGZ A;  1QG8 A;  4GBP A;  1ON6 A;  1R7V A;  1H5R A;  4Y6N A;  3K8D A;  3LW6 A;  3V0L A;  3E25 A;  2UX8 A;  1GX0 A;  5C48 A;  3OH2 A;  1INI A;  4KXO A;  3SXB A;  4B4G A;  4NAL A;  1QGS A;  2Y4K A;  1HM0 A;  4AYJ A;  4HO3 A;  1TW5 A;  2WEE A;  5DDT A;  4HG6 A;  3F1Y A;  2JCJ A;  3I0E A;  5CQM X;  1ZI5 A;  2A8W A;  3KIA A;  4EEA A;  2X65 A;  1VIC A;  1FGG A;  2XWM A;  2FFV A;  3SXA A;  2AES A;  3U2T A;  2JCO A;  1W57 A;  4Y6U A;  1I52 A;  1G0R A;  4YS8 A;  4FRE A;  4FRP A;  1LL3 A;  4HO5 A;  4M28 A;  2Y4J A;  3SXC A;  1Z90 A;  4DE7 A;  1V82 A;  4D11 A;  5EJZ A;  4EE5 A;  4DDZ A;  4O6M A;  3V0M A;  5JQQ A;  3RMW A;  4FRL A;  1G2V A;  3CGX A;  2W0V A;  1ZIZ A;  3ST8 A;  2D0J A;  4NAK A;  2QGI A;  4KPX A;  1FXJ A;  2BO4 A;  3IOI A;  5C4E A;  5FTV A;  4G3S A;  1VZU A;  3GUE A;  2YQH A;  1H4E A;  3RMV A;  2W0W A;  2OEG A;  2APC A;  2E3D A;  5FV9 A;  2OI5 A;  1H5S A;  2V0J A;  4P02 A;  1MP5 A;  1H5S B;  2WVM A;  1OQM B;  1ZDF A;  3NGW A;  4AC3 A;  2VXM A;  4B4B A;  3U2W A;  1NKH B;  4ASJ A;  1E5K A;  3V91 A;  4FRA A;  2PGV A;  3I0K A;  3SX7 A;  2YQS A;  3V8Z A;  3R2W A;  4D0Z A;  5I1F A;  3V90 A;  4Y7U A;  5CQL X;  2D7I A;  4D11 C;  2Y4L A;  5DDV A;  2RJ4 A;  3DJ4 A;  3JUJ A;  4FRH A;  5C1L A;  3CKN A;  4ECM A;  1NWG B;  2YES A;  3QVB A;  4B5B A;  5CMG X;  3D98 A;  4EEO A;  3FOQ A;  3ZF8 A;  1IIN A;  4LW6 A;  2FYA A;  1XZ6 A;  1ZCU A;  2YC3 A;  5D92 A;  1XHB A;  2V0I A;  1K4V A;  2AE7 A;  1ZI1 A;  3T7O A;  4Y7T A;  1VPA A;  2ZU8 A;  2ZU9 A;  3K8E A;  1GWV A;  1TW1 A;  1YP3 A;  3V0P A;  1NF5 B;  2PGY A;  5C36 A;  1G8O A;  5IFY A;  5HS2 A;  1ZJP A;  4Y62 A;  1R80 A;  3CU0 A;  4M4K A;  5CQP A;  3OC9 A;  1VZT A;  4G3P A;  3HL3 A;  1LZJ A;  1WT1 A;  1MC3 A;  1ZCV A;  1JVG A;  3USR A;  1HJJ A;  3I0G A;  3SXG A;  2VSH A;  3DUV A;  1O23 B;  1FZW A;  2Y4M A;  4AAW A;  2JCK A;  2AGD A;  1VZX A;  1WVC A;  4P00 A;  4EE4 A;  2XME A;  3T7M A;  3R3I A;  2VS5 A;  2X60 A;  3SXE A;  5EIY A;  3V8Y A;  1JYL A;  1H7G A;  1S4N A;  3RSB A;  3U2U A;  2AM4 A;  3CKO A;  5C49 A;  2J0A A;  4AYL A;  2GGO A;  2Y7A A;  2YCM A;  4J18 A;  5C47 A;  2FYB A;  2C0N A;  4B4M A;  3U2V A;  2XMH A;  2RIT A;  1FR9 A;  5AJO A;  1GQC A;  1VGZ A;  4KC2 A;  5C4C A;  1R7X A;  3ZGF A;  3TZT A;  2AEC A;  2WE9 A;  5BXC A;  1YP4 A;  1LZI A;  4K6R A;  1FR8 A;  3BRK X;  2D7R A;  3ZGG A;  2ICX A;  2RJ7 A;  4UEG A;  2PX7 A;  5AJP A;  2XWL A;  3SPT A;  1ZCY A;  2QH5 A;  4EEG A;  2JCL A;  4MYB A;  1VGU A;  4FRQ A;  5C1H A;  3OH1 A;  4M2B A;  2X5Z A;  4KRV A;  4Y64 A;  3U0X A;  1NMM B;  2MZB A;  3I0H A;  1JYK A;  1LL2 A;  5FYE A;  2Q4J A;  4E1K A;  3OH4 A;  4FQW A;  1ZI4 A;  1FRW A;  2YQJ A;  1R7U A;  4LW3 A;  4ARW A;  4FCU A;  2VXL A;  4Y9X A;  3I0J A;  3IOJ A;  1ZI3 A;  4HO6 A;  1KWS A;  1EYR A;  2PA4 A;  2RIZ A;  1LL0 A;  2I7B A;  2P72 A;  4FRO A;  5AJN A;  2VS3 A;  4HOC A;  3SX5 A;  4L41 C;  1VH3 A;  2VSI A;  4B3U A;  4Y7V A;  2WVK A;  4KQL A;  4R7P A;  5C3D A;  2O1F A;  5CQN X;  5CMI A;  4FIX A;  5IDT A;  5C4D A;  3I0C A;  2FYC B;  3OH3 A;  1H3M A;  2V0L A;  4G87 A;  1HM9 A;  1SS9 A;  4ZDQ A;  1OMX A;  4KPZ A;  1G1L A;  2WVL A;  1H7F A;  3O3P A;  1WSZ A;  2O1G A;  1H7L A;  1LZ0 A;  4D0T A;  1H5S C;  4JD0 A;  1ZJ0 A;  1H7H A;  2RIX A;  1G9R A;  3U0Y A;  1G23 A;  4CJB A;  3V0N A;  1G97 A;  1GA8 A;  2WAW A;  1V84 A;  3I0L A;  3I0I X;  5C3B A;  2P73 A;  4MND A;  2Z87 A;  1O7Q A;  2AH9 A;  1ZJ1 A;  3OH0 A;  4D48 A;  4KNR A;  5J49 A;  4IRQ A;  1HV9 A;  1GQ9 A;  2XWN A;  3USQ A;  1LVW A;  1FO9 A;  2Z86 A;  1WT0 A;  4ASY A;  5CQO A;  1YP2 A;  1FXO A;  1R7T A;  4HCQ A;  2RJ0 A;  5IDS A;  4EEM A;  2O1H A;  3Q4S A;  4HO4 A;  1VGW A;  1ZHJ A;  3OAM A;  1MP3 A;  5FTS A;  3Q7U A;  1WT2 A;  3PKP A;  3V0Q A;  1ZDG A;  4CVH A;  1R82 A;  1IIM A;  1NHE B;  1PZY B;  4KC1 A;  1H5R B;  2BO8 A;  3BCV A;  1VM8 A;  1YRO B;  1INJ A;  2A8U A;  5C4B A;  5C1G A;  1R81 A;  1OMZ A;  1QWJ A;  3OGZ A;  1G93 A;  4HO8 A;  2VD4 A;  4HO9 A;  3IOH A;  4CJC A;  3V0O A;  4JIS A;  1ZJO A;  1H4C A;  2I5E A;  1HM8 A;  3CKQ A;  2QKX A;  2OI7 A;  3FWW A;  2YC5 A;  5FUH A;  1GWW A;  3CKJ A;  4M2A A;  2RJ1 A;  1TVY A;  1H7T A;  2VFZ A;  1LZ7 A;  4DEC A;  2I5K A;  2FY7 A;  5L6V A;  3POL A;  3I0D A;  4FRB A;  1VGT A;  4EVW A;  4FRD A;  2NXV A;  1H4D A;  2Y6P A;  4IRP A;  5C8R A;  5FU0 A;  4NAI A;  5FU8 A;  2J0B A; 
#chains in the Genus database with same CATH homology
 1W55 A;  2VS4 A;  1S4P A;  1JV3 A;  2YQC A;  1H7Q A;  1G3L A;  1FWY A;  1W77 A;  1HJL A;  1GX4 A;  1FG5 N;  4O6N A;  2OEF A;  2X5S A;  3SX8 A;  2BO7 A;  5C38 A;  3PNN A;  3JTJ A;  5EJ1 A;  3ZLL A;  4FCE A;  4B2X A;  2RIY A;  3CKV A;  1G95 A;  1S4O A;  3OKR A;  5L6S A;  1V83 A;  3PKQ A;  4BQH A;  3SXD A;  3I0F A;  3D5N A;  1H5T A;  1FO8 A;  3ZLK A;  2RJ6 A;  1H5T B;  3JUK A;  1MP4 A;  1JVD A;  1JV1 A;  4Q7C A;  2ICY A;  3E26 A;  2RJ8 A;  4Y7F A;  3D8V A;  4MIX A;  4NAN A;  5D91 A;  4C2S A;  3EE5 A;  4B42 A;  4G3Q A;  5CMH A;  4KNX A;  1WT3 A;  2V0H A;  4BMA A;  4CJ8 A;  2P6W A;  3TQD A;  4FRM A;  5CMJ A;  2ZU7 A;  1O7O A;  1QGQ A;  1PZT A;  4XWI A;  1TZF A;  4Y7G A;  4HO2 A;  1ON8 A;  2FYD B;  1FGX A;  1ZJ2 A;  2BO6 A;  2AM3 A;  4FIY A;  4KC4 A;  1O0R A;  2CU2 A;  1H7E A;  1R7Y A;  1H5S D;  2V0K A;  4HO0 A;  4KT7 A;  3T7N A;  2OI6 A;  3N9W A;  2DPW A;  4Y63 A;  4B2W A;  2RJ5 A;  3Q80 A;  2AM5 A;  3U2X A;  5C3A A;  1ZCT A;  2FFU A;  3F1C A;  1FOA A;  1VH1 A;  2RJ9 A;  2VK9 A;  5CMF X;  3DK5 A;  1NQI B;  5C4F A;  4EE3 A;  3SX3 A;  2GGQ A;  1EZI A;  2E8B A;  1ZJ3 A;  2WGZ A;  1QG8 A;  4GBP A;  1ON6 A;  1R7V A;  1H5R A;  4Y6N A;  3K8D A;  3LW6 A;  3V0L A;  3E25 A;  2UX8 A;  1GX0 A;  5C48 A;  3OH2 A;  1INI A;  4KXO A;  3SXB A;  4B4G A;  4NAL A;  1QGS A;  2Y4K A;  1HM0 A;  4AYJ A;  4HO3 A;  1TW5 A;  2WEE A;  5DDT A;  4HG6 A;  3F1Y A;  2JCJ A;  3I0E A;  5CQM X;  1ZI5 A;  2A8W A;  3KIA A;  4EEA A;  2X65 A;  1VIC A;  1FGG A;  2XWM A;  2FFV A;  3SXA A;  2AES A;  3U2T A;  2JCO A;  1W57 A;  4Y6U A;  1I52 A;  1G0R A;  4YS8 A;  4FRE A;  4FRP A;  1LL3 A;  4HO5 A;  4M28 A;  2Y4J A;  3SXC A;  1Z90 A;  4DE7 A;  1V82 A;  4D11 A;  5EJZ A;  4EE5 A;  4DDZ A;  4O6M A;  3V0M A;  5JQQ A;  3RMW A;  4FRL A;  1G2V A;  3CGX A;  2W0V A;  1ZIZ A;  3ST8 A;  2D0J A;  4NAK A;  2QGI A;  4KPX A;  1FXJ A;  2BO4 A;  3IOI A;  5C4E A;  5FTV A;  4G3S A;  1VZU A;  3GUE A;  2YQH A;  1H4E A;  3RMV A;  2W0W A;  2OEG A;  2APC A;  2E3D A;  5FV9 A;  2OI5 A;  1H5S A;  2V0J A;  4P02 A;  1MP5 A;  1H5S B;  2WVM A;  1OQM B;  1ZDF A;  3NGW A;  4AC3 A;  2VXM A;  4B4B A;  3U2W A;  1NKH B;  4ASJ A;  1E5K A;  3V91 A;  4FRA A;  2PGV A;  3I0K A;  3SX7 A;  2YQS A;  3V8Z A;  3R2W A;  4D0Z A;  5I1F A;  3V90 A;  4Y7U A;  5CQL X;  2D7I A;  4D11 C;  2Y4L A;  5DDV A;  2RJ4 A;  3DJ4 A;  3JUJ A;  4FRH A;  5C1L A;  3CKN A;  4ECM A;  1NWG B;  2YES A;  3QVB A;  4B5B A;  5CMG X;  3D98 A;  4EEO A;  3FOQ A;  3ZF8 A;  1IIN A;  4LW6 A;  2FYA A;  1XZ6 A;  1ZCU A;  2YC3 A;  5D92 A;  1XHB A;  2V0I A;  1K4V A;  2AE7 A;  1ZI1 A;  3T7O A;  4Y7T A;  1VPA A;  2ZU8 A;  2ZU9 A;  3K8E A;  1GWV A;  1TW1 A;  1YP3 A;  3V0P A;  1NF5 B;  2PGY A;  5C36 A;  1G8O A;  5IFY A;  5HS2 A;  1ZJP A;  4Y62 A;  1R80 A;  3CU0 A;  4M4K A;  5CQP A;  3OC9 A;  1VZT A;  4G3P A;  3HL3 A;  1LZJ A;  1WT1 A;  1MC3 A;  1ZCV A;  1JVG A;  3USR A;  1HJJ A;  3I0G A;  3SXG A;  2VSH A;  3DUV A;  1O23 B;  1FZW A;  2Y4M A;  4AAW A;  2JCK A;  2AGD A;  1VZX A;  1WVC A;  4P00 A;  4EE4 A;  2XME A;  3T7M A;  3R3I A;  2VS5 A;  2X60 A;  3SXE A;  5EIY A;  3V8Y A;  1JYL A;  1H7G A;  1S4N A;  3RSB A;  3U2U A;  2AM4 A;  3CKO A;  5C49 A;  2J0A A;  4AYL A;  2GGO A;  2Y7A A;  2YCM A;  4J18 A;  5C47 A;  2FYB A;  2C0N A;  4B4M A;  3U2V A;  2XMH A;  2RIT A;  1FR9 A;  5AJO A;  1GQC A;  1VGZ A;  4KC2 A;  5C4C A;  1R7X A;  3ZGF A;  3TZT A;  2AEC A;  2WE9 A;  5BXC A;  1YP4 A;  1LZI A;  4K6R A;  1FR8 A;  3BRK X;  2D7R A;  3ZGG A;  2ICX A;  2RJ7 A;  4UEG A;  2PX7 A;  5AJP A;  2XWL A;  3SPT A;  1ZCY A;  2QH5 A;  4EEG A;  2JCL A;  4MYB A;  1VGU A;  4FRQ A;  5C1H A;  3OH1 A;  4M2B A;  2X5Z A;  4KRV A;  4Y64 A;  3U0X A;  1NMM B;  2MZB A;  3I0H A;  1JYK A;  1LL2 A;  5FYE A;  2Q4J A;  4E1K A;  3OH4 A;  4FQW A;  1ZI4 A;  1FRW A;  2YQJ A;  1R7U A;  4LW3 A;  4ARW A;  4FCU A;  2VXL A;  4Y9X A;  3I0J A;  3IOJ A;  1ZI3 A;  4HO6 A;  1KWS A;  1EYR A;  2PA4 A;  2RIZ A;  1LL0 A;  2I7B A;  2P72 A;  4FRO A;  5AJN A;  2VS3 A;  4HOC A;  3SX5 A;  4L41 C;  1VH3 A;  2VSI A;  4B3U A;  4Y7V A;  2WVK A;  4KQL A;  4R7P A;  5C3D A;  2O1F A;  5CQN X;  5CMI A;  4FIX A;  5IDT A;  5C4D A;  3I0C A;  2FYC B;  3OH3 A;  1H3M A;  2V0L A;  4G87 A;  1HM9 A;  1SS9 A;  4ZDQ A;  1OMX A;  4KPZ A;  1G1L A;  2WVL A;  1H7F A;  3O3P A;  1WSZ A;  2O1G A;  1H7L A;  1LZ0 A;  4D0T A;  1H5S C;  4JD0 A;  1ZJ0 A;  1H7H A;  2RIX A;  1G9R A;  3U0Y A;  1G23 A;  4CJB A;  3V0N A;  1G97 A;  1GA8 A;  2WAW A;  1V84 A;  3I0L A;  3I0I X;  5C3B A;  2P73 A;  4MND A;  2Z87 A;  1O7Q A;  2AH9 A;  1ZJ1 A;  3OH0 A;  4D48 A;  4KNR A;  5J49 A;  4IRQ A;  1HV9 A;  1GQ9 A;  2XWN A;  3USQ A;  1LVW A;  1FO9 A;  2Z86 A;  1WT0 A;  4ASY A;  5CQO A;  1YP2 A;  1FXO A;  1R7T A;  4HCQ A;  2RJ0 A;  5IDS A;  4EEM A;  2O1H A;  3Q4S A;  4HO4 A;  1VGW A;  1ZHJ A;  3OAM A;  1MP3 A;  5FTS A;  3Q7U A;  1WT2 A;  3PKP A;  3V0Q A;  1ZDG A;  4CVH A;  1R82 A;  1IIM A;  1NHE B;  1PZY B;  4KC1 A;  1H5R B;  2BO8 A;  3BCV A;  1VM8 A;  1YRO B;  1INJ A;  2A8U A;  5C4B A;  5C1G A;  1R81 A;  1OMZ A;  1QWJ A;  3OGZ A;  1G93 A;  4HO8 A;  2VD4 A;  4HO9 A;  3IOH A;  4CJC A;  3V0O A;  4JIS A;  1ZJO A;  1H4C A;  2I5E A;  1HM8 A;  3CKQ A;  2QKX A;  2OI7 A;  3FWW A;  2YC5 A;  5FUH A;  1GWW A;  3CKJ A;  4M2A A;  2RJ1 A;  1TVY A;  1H7T A;  2VFZ A;  1LZ7 A;  4DEC A;  2I5K A;  2FY7 A;  5L6V A;  3POL A;  3I0D A;  4FRB A;  1VGT A;  4EVW A;  4FRD A;  2NXV A;  1H4D A;  2Y6P A;  4IRP A;  5C8R A;  5FU0 A;  4NAI A;  5FU8 A;  2J0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...