4KT7A

The crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritolsynthase from anaerococcus prevotii dsm 20548
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
227
Chain Sequence
SNAMIDGKFISAIITAAGSGLRMPYIEVGGRKVLEITLDTVSRVKEIDEIILVIRKDDEDIIKDILEKYDGNIRYVYGSTTRELSTFEGLKALDPQSELVLTHDGVRPFASEELFLKTINALRKNKAVITATKSKDTVKIIDDDMYVDFTPNRDYVYNIQTPQAFDKKLIYAMYEKYLASEFKVTDDSQLFEFFDRDEKVKVVHGEYSNIKITTQEDIIFANAYLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title The crystal structure of 4-diphosphocytidyl-2C-methyl-D-erythritolsynthase from Anaerococcus prevotii DSM 20548
rcsb
source organism Anaerococcus prevotii
molecule tags Transferase
total genus 72
structure length 227
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4kt7A00
4B3UA 1G95A 2OI6A 2BO7A 1GA8A 1ZJ1A 1JYLA 1FGGA 4M2AA 5HS2A 1ZDFA 5FU8A 5FU0A 3RMWA 4CVHA 4KXOA 4EE4A 1NKHB 3JUKA 4HCQA 3SPTA 3V0NA 2JCLA 3OH2A 4Y9XA 5J49A 1G2VA 1I52A 2OEFA 2XWMA 2JCOA 3OC9A 2V0KA 4Y6UA 2RJ8A 1FR8A 5BXCA 5C47A 1VGUA 2AM3A 1O0RA 3GUEA 4NAIA 1YROB 1FZWA 5C4CA 2RJ4A 3I0KA 1TVYA 3E25A 4Y64A 4XWIA 3SX8A 1HM8A 1S4OA 1GWWA 3Q7UA 4KC1A 4HO4A 2BO8A 2NXVA 2O1HA 2V0IA 1H4EA 4HO6A 1H5TB 5C38A 4EEOA 3R3IA 2QGIA 1XZ6A 2RJ9A 2D7RA 3V0LA 4AYJA 4LW6A 1G97A 1VPAA 2YQHA 1H5SB 3R2WA 4KRVA 2X65A 1ZHJA 5CMFX 5IFYA 2O1FA 3T7NA 1LVWA 1INJA 4ASYA 1G1LA 3T7MA 4KC4A 4Y7GA 1VICA 3V8YA 4B4MA 5CQOA 4HO0A 3POLA 1G8OA 4Y7VA 5C4EA 1ON8A 2Z86A 2FYBA 3TZTA 4B4GA 2I7BA 1H7TA 2YC3A 1FRWA 3I0IX 2I5KA 1SS9A 3SXEA 4B4BA 2V0JA 4M4KA 2PX7A 2V0HA 1VGZA 2AECA 4KC2A 4ZDQA 2D0JA 1R7VA 4R7PA 2VSHA 1OMXA 2RJ1A 2RJ7A 1ON6A 3U2VA 1LZ7A 5C48A 1MP3A 2VS4A 4HG6A 4NANA 4UEGA 3OAMA 2RIXA 3QVBA 4D0TA 1VGWA 3RSBA 3I0CA 5L6SA 1V83A 2XWNA 2I5EA 5I1FA 1FXJA 1INIA 1HJLA 2UX8A 2XMHA 4CJCA 1G23A 2E8BA 2AH9A 3EE5A 3D98A 2FYDB 5EIYA 4Y62A 4EE3A 1JVGA 2WE9A 1MP5A 5CQLX 1VH1A 5FTSA 5C3BA 5JQQA 1FOAA 2ZU7A 1H5RA 3SXBA 5FYEA 2Y4KA 5C1GA 1Z90A 1YP3A 2QKXA 3U0YA 2DPWA 2PGYA 3CKOA 2ICXA 4NAKA 4IRPA 2O1GA 2VFZA 4D48A 2OI7A 3SXAA 3RMVA 1ZI4A 3OKRA 5AJOA 1OMZA 5IDTA 5C49A 1S4PA 1WSZA 4B42A 2WEEA 4HO8A 1VZUA 2RIZA 3V0OA 3V8ZA 2BO4A 1TW5A 2CU2A 4AC3A 1FWYA 4DE7A 2V0LA 1ZI5A 3SXDA 5C1HA 3U0XA 1H5SC 4AAWA 5C4FA 1QWJA 1WT0A 4K6RA 1V82A 3DJ4A 4FRBA 1GX0A 3U2UA 1ZI1A 1TZFA 3OH1A 2P73A 1FR9A 1R80A 4FRPA 1ZCUA 1FGXA 4Y6NA 1G3LA 1HM0A 5CMIA 5DDTA 1VM8A 4CJ8A 2WAWA 2Z87A 2WVMA 3OH3A 2X5SA 3T7OA 3ZF8A 4FREA 3K8DA 4AYLA 2FY7A 4FRHA 4KT7A 4NALA 1WT1A 3I0EA 5C36A 1MP4A 2JCJA 3IOHA 4D0ZA 4G87A 2ZU9A 1JV1A 1G0RA 2JCKA 2OEGA 2YESA 3Q4SA 1ZI3A 2FFVA 2VS5A 3I0LA 2A8UA 4L41C 1FXOA 4YS8A 3F1YA 3V0PA 4Y63A 2W0VA 5EJ1A 2OI5A 1R7TA 4IRQA 1VZTA 1H7QA 1QGQA 1WT3A 2FFUA 1GQ9A 4G3PA 2MZBA 2VSIA 4HO3A 2Y7AA 1K4VA 2XMEA 4EEGA 4B2XA 5C4DA 5CMJA 1PZTA 4GBPA 5AJNA 2AE7A 4FCUA 4FRMA 1IINA 1XHBA 1ZJ3A 3SXGA 2QH5A 1FG5N 3CKVA 5L6VA 1LZIA 5C8RA 4EE5A 3CU0A 1H7LA 1LL3A 2WVLA 3V0MA 5C1LA 3PKQA 1QGSA 3SX3A 2P6WA 1R7UA 1VZXA 4EEMA 4BMAA 1HJJA 1O7OA 4KNXA 3IOIA 3V90A 5C4BA 1VH3A 4KPXA 1LL2A 2A8WA 4KNRA 1NWGB 1NHEB 1G93A 4ASJA 1V84A 3I0FA 3JUJA 4J18A 3F1CA 3E26A 1O7QA 4ARWA 2VS3A 3LW6A 1E5KA 4EEAA 5CQPA 4D11C 3D8VA 2GGOA 3PNNA 5FV9A 1MC3A 5C3AA 1KWSA 1ZJPA 3CKNA 4DDZA 3K8EA 2VXMA 4M28A 4KQLA 3ZGGA 3O3PA 4D11A 1H5RB 1FO8A 5CMGX 1H7GA 4HO9A 2D7IA 3TQDA 4HO2A 1WVCA 2Q4JA 1H5TA 3IOJA 1EZIA 2ICYA 1GQCA 2X60A 3ZGFA 1WT2A 4EVWA 3OGZA 2GGQA 4FRQA 1R7YA 2AM4A 4LW3A 1H7HA 2VD4A 2APCA 1H5SA 2WGZA 4FROA 5CQMX 4Y7UA 1ZJ2A 3OH4A 4FCEA 2Y4MA 1GX4A 1JV3A 1H7EA 4G3SA 3FOQA 1FO9A 1IIMA 3ZLLA 1ZCYA 4BQHA 2X5ZA 4JISA 5AJPA 2ZU8A 4ECMA 4MYBA 3OH0A 2YQSA 1YP4A 1YP2A 1ZCVA 5DDVA 2Y6PA 4Y7TA 5FUHA 1PZYB 1R81A 2YC5A 3I0DA 1NQIB 2YCMA 4FRDA 1ZJ0A 5C3DA 1H5SD 1NMMB 3SX7A 2RJ0A 4C2SA 3JTJA 3DUVA 3PKPA 3USQA 1ZDGA 3U2XA 2WVKA 2YQCA 1QG8A 3USRA 3NGWA 1LZ0A 4G3QA 1HV9A 1HM9A 2RITA 2PGVA 3I0GA 5CMHA 3V91A 3BRKX 4FRLA 4B5BA 2BO6A 1R7XA 3SX5A 1W77A 3CKQA 1GWVA 1LZJA 3D5NA 2PA4A 4DECA 5FTVA 3DK5A 2Y4LA 1H3MA 3N9WA 2P72A 1W55A 4KPZA 4Y7FA 3CKJA 4B2WA 1W57A 2Y4JA 1JYKA 4HO5A 3U2WA 3U2TA 1H7FA 2RIYA 2W0WA 1S4NA 2AM5A 1H4CA 1ZCTA 3I0HA 1JVDA 5IDSA 4MNDA 1O23B 3KIAA 4P00A 1LL0A 4P02A 2RJ6A 3BCVA 1EYRA 4JD0A 2XWLA 4FQWA 5CQNX 1NF5B 1H4DA 3V0QA 1ZIZA 2FYAA 1R82A 4E1KA 2AGDA 1ZJOA 1G9RA 2FYCB 1VGTA 3HL3A 4M2BA 4FRAA 3SXCA 3ST8A 1OQMB 1TW1A 3I0JA 5EJZA 3Q80A 2VXLA 2E3DA 2YQJA 3ZLKA 4CJBA 4HOCA 2RJ5A 3CGXA 3FWWA 2AESA
chains in the Genus database with same CATH superfamily
4B3UA 1G95A 2OI6A 2BO7A 1GA8A 1ZJ1A 1JYLA 1FGGA 4M2AA 5HS2A 1ZDFA 5FU8A 5FU0A 3RMWA 4CVHA 4KXOA 4EE4A 1NKHB 3JUKA 4HCQA 3SPTA 3V0NA 2JCLA 3OH2A 4Y9XA 5J49A 1G2VA 1I52A 2OEFA 2XWMA 2JCOA 3OC9A 2V0KA 4Y6UA 2RJ8A 1FR8A 5BXCA 5C47A 1VGUA 2AM3A 1O0RA 3GUEA 4NAIA 1YROB 1FZWA 5C4CA 2RJ4A 3I0KA 1TVYA 3E25A 4Y64A 4MIXA 4XWIA 4O6MA 3SX8A 1HM8A 1S4OA 1GWWA 3Q7UA 4KC1A 4HO4A 2BO8A 2NXVA 2O1HA 2V0IA 1H4EA 4HO6A 1H5TB 5C38A 4EEOA 3R3IA 2QGIA 1XZ6A 2RJ9A 2D7RA 3V0LA 4AYJA 4LW6A 1G97A 1VPAA 2YQHA 1H5SB 3R2WA 4KRVA 2X65A 1ZHJA 5CMFX 5IFYA 2O1FA 3T7NA 1LVWA 1INJA 4ASYA 1G1LA 3T7MA 4KC4A 4Y7GA 1VICA 3V8YA 4B4MA 5CQOA 4HO0A 3POLA 1G8OA 4Y7VA 5C4EA 1ON8A 2Z86A 2FYBA 3TZTA 4B4GA 2I7BA 1H7TA 2YC3A 1FRWA 3I0IX 2I5KA 1SS9A 3SXEA 4B4BA 2V0JA 4M4KA 2PX7A 2V0HA 1VGZA 2AECA 4KC2A 4ZDQA 2D0JA 1R7VA 4R7PA 2VSHA 1OMXA 2RJ1A 2RJ7A 1ON6A 3U2VA 1LZ7A 5C48A 1MP3A 2VS4A 4HG6A 4NANA 4UEGA 3OAMA 2RIXA 3QVBA 4D0TA 1VGWA 3RSBA 3I0CA 5L6SA 1V83A 2XWNA 2I5EA 5I1FA 1FXJA 1INIA 1HJLA 2UX8A 2XMHA 4CJCA 1G23A 2E8BA 2AH9A 3EE5A 3D98A 2FYDB 5EIYA 4Y62A 4EE3A 1JVGA 2WE9A 1MP5A 4O6NA 5CQLX 1VH1A 5FTSA 5C3BA 5JQQA 2C0NA 1FOAA 2ZU7A 1H5RA 3SXBA 5FYEA 2Y4KA 5C1GA 1Z90A 1YP3A 2QKXA 3U0YA 2DPWA 2PGYA 3CKOA 2ICXA 4NAKA 4IRPA 2O1GA 2VFZA 4D48A 2OI7A 3SXAA 3RMVA 1ZI4A 3OKRA 5AJOA 1OMZA 5IDTA 5C49A 1S4PA 1WSZA 4B42A 2WEEA 4HO8A 1VZUA 2RIZA 3V0OA 3V8ZA 2BO4A 1TW5A 2CU2A 4AC3A 1FWYA 4DE7A 2V0LA 1ZI5A 3SXDA 5C1HA 3U0XA 1H5SC 4AAWA 5C4FA 1QWJA 1WT0A 4K6RA 1V82A 3DJ4A 4FRBA 1GX0A 3U2UA 1ZI1A 1TZFA 3OH1A 2P73A 1FR9A 1R80A 4FRPA 1ZCUA 1FGXA 4Y6NA 1G3LA 1HM0A 5CMIA 5DDTA 1VM8A 4CJ8A 2WAWA 2Z87A 2WVMA 3OH3A 2X5SA 3T7OA 3ZF8A 4FREA 3K8DA 4AYLA 2FY7A 4FRHA 4KT7A 4NALA 1WT1A 3I0EA 5C36A 1MP4A 2JCJA 3IOHA 4D0ZA 4G87A 2ZU9A 1JV1A 1G0RA 2JCKA 2OEGA 2YESA 3Q4SA 1ZI3A 2FFVA 2VS5A 3I0LA 2A8UA 4L41C 1FXOA 4YS8A 3F1YA 3V0PA 2J0AA 4Y63A 2W0VA 5EJ1A 2OI5A 1R7TA 4IRQA 1VZTA 1H7QA 1QGQA 1WT3A 2FFUA 1GQ9A 4G3PA 2MZBA 2VSIA 5D91A 4HO3A 2Y7AA 1K4VA 2XMEA 4EEGA 4B2XA 5C4DA 5CMJA 1PZTA 4GBPA 5AJNA 2AE7A 4FCUA 4FRMA 1IINA 1XHBA 1ZJ3A 3SXGA 2QH5A 4Q7CA 1FG5N 3CKVA 5L6VA 1LZIA 5D92A 5C8RA 4EE5A 3CU0A 1H7LA 1LL3A 2WVLA 3V0MA 5C1LA 3PKQA 1QGSA 3SX3A 2P6WA 1R7UA 1VZXA 4EEMA 4BMAA 1HJJA 1O7OA 4KNXA 3IOIA 3V90A 5C4BA 1VH3A 4KPXA 1LL2A 2A8WA 4KNRA 1NWGB 1NHEB 1G93A 4ASJA 1V84A 3I0FA 3JUJA 4J18A 3F1CA 3E26A 1O7QA 4ARWA 2VS3A 3LW6A 1E5KA 4EEAA 5CQPA 4D11C 3D8VA 2GGOA 3PNNA 5FV9A 1MC3A 5C3AA 1KWSA 1ZJPA 3CKNA 4DDZA 3K8EA 2VXMA 4M28A 4KQLA 3ZGGA 3O3PA 4D11A 1H5RB 1FO8A 5CMGX 1H7GA 4HO9A 2D7IA 3TQDA 4HO2A 1WVCA 2Q4JA 1H5TA 3IOJA 1EZIA 2ICYA 1GQCA 2X60A 3ZGFA 1WT2A 4EVWA 3OGZA 2GGQA 4FRQA 1R7YA 2AM4A 4LW3A 1H7HA 2VD4A 2APCA 1H5SA 2WGZA 4FROA 5CQMX 4Y7UA 1ZJ2A 3OH4A 4FCEA 2Y4MA 1GX4A 1JV3A 2VK9A 1H7EA 4G3SA 3FOQA 1FO9A 1IIMA 3ZLLA 1ZCYA 4BQHA 2X5ZA 4JISA 5AJPA 2ZU8A 4ECMA 4MYBA 3OH0A 2YQSA 1YP4A 1YP2A 1ZCVA 5DDVA 2Y6PA 4Y7TA 5FUHA 1PZYB 1R81A 2YC5A 3I0DA 1NQIB 2YCMA 4FRDA 1ZJ0A 5C3DA 1H5SD 1NMMB 3SX7A 2RJ0A 4C2SA 3JTJA 3DUVA 3PKPA 3USQA 1ZDGA 3U2XA 2WVKA 2YQCA 1QG8A 3USRA 3NGWA 1LZ0A 4G3QA 1HV9A 1HM9A 2RITA 2PGVA 3I0GA 5CMHA 3V91A 3BRKX 4FRLA 4B5BA 2BO6A 1R7XA 3SX5A 1W77A 3CKQA 1GWVA 1LZJA 3D5NA 2PA4A 4DECA 5FTVA 3DK5A 2Y4LA 1H3MA 3N9WA 2P72A 1W55A 4FIXA 4KPZA 4Y7FA 3CKJA 4B2WA 1W57A 2Y4JA 1JYKA 4HO5A 4FIYA 3U2TA 3U2WA 1H7FA 2RIYA 2W0WA 1S4NA 2AM5A 1H4CA 1ZCTA 3I0HA 1JVDA 5IDSA 4MNDA 1O23B 3KIAA 4P00A 1LL0A 4P02A 2RJ6A 3BCVA 1EYRA 4JD0A 2XWLA 4FQWA 5CQNX 1NF5B 1H4DA 3V0QA 1ZIZA 2FYAA 1R82A 4E1KA 2AGDA 1ZJOA 2J0BA 1G9RA 2FYCB 1VGTA 3HL3A 4M2BA 4FRAA 3SXCA 3ST8A 1OQMB 1TW1A 3I0JA 5EJZA 3Q80A 2VXLA 2E3DA 2YQJA 3ZLKA 4CJBA 4HOCA 2RJ5A 3CGXA 3FWWA 2AESA
chains in the Genus database with same CATH topology
4B3UA 1G95A 2OI6A 2BO7A 1GA8A 1ZJ1A 1JYLA 1FGGA 4M2AA 5HS2A 1ZDFA 5FU8A 5FU0A 3RMWA 4CVHA 4KXOA 4EE4A 1NKHB 3JUKA 4HCQA 3SPTA 3V0NA 2JCLA 3OH2A 4Y9XA 5J49A 1G2VA 1I52A 2OEFA 2XWMA 2JCOA 3OC9A 2V0KA 4Y6UA 2RJ8A 1FR8A 5BXCA 5C47A 1VGUA 2AM3A 1O0RA 3GUEA 4NAIA 1YROB 1FZWA 5C4CA 2RJ4A 3I0KA 1TVYA 3E25A 4Y64A 4MIXA 4XWIA 4O6MA 3SX8A 1HM8A 1S4OA 1GWWA 3Q7UA 4KC1A 4HO4A 2BO8A 2NXVA 2O1HA 2V0IA 1H4EA 4HO6A 1H5TB 5C38A 4EEOA 3R3IA 2QGIA 1XZ6A 2RJ9A 2D7RA 3V0LA 4AYJA 4LW6A 1G97A 1VPAA 2YQHA 1H5SB 3R2WA 4KRVA 2X65A 1ZHJA 5CMFX 5IFYA 2O1FA 3T7NA 1LVWA 1INJA 4ASYA 1G1LA 3T7MA 4KC4A 4Y7GA 1VICA 3V8YA 4B4MA 5CQOA 4HO0A 3POLA 1G8OA 4Y7VA 5C4EA 1ON8A 2Z86A 2FYBA 3TZTA 4B4GA 2I7BA 1H7TA 2YC3A 1FRWA 3I0IX 2I5KA 1SS9A 3SXEA 4B4BA 2V0JA 4M4KA 2PX7A 2V0HA 1VGZA 2AECA 4KC2A 4ZDQA 2D0JA 1R7VA 4R7PA 2VSHA 1OMXA 2RJ1A 2RJ7A 1ON6A 3U2VA 1LZ7A 5C48A 1MP3A 2VS4A 4HG6A 4NANA 4UEGA 3OAMA 2RIXA 3QVBA 4D0TA 1VGWA 3RSBA 3I0CA 5L6SA 1V83A 2XWNA 2I5EA 5I1FA 1FXJA 1INIA 1HJLA 2UX8A 2XMHA 4CJCA 1G23A 2E8BA 2AH9A 3EE5A 3D98A 2FYDB 5EIYA 4Y62A 4EE3A 1JVGA 2WE9A 1MP5A 4O6NA 5CQLX 1VH1A 5FTSA 5C3BA 5JQQA 2C0NA 1FOAA 2ZU7A 1H5RA 3SXBA 5FYEA 2Y4KA 5C1GA 1Z90A 1YP3A 2QKXA 3U0YA 2DPWA 2PGYA 3CKOA 2ICXA 4NAKA 4IRPA 2O1GA 2VFZA 4D48A 2OI7A 3SXAA 3RMVA 1ZI4A 3OKRA 5AJOA 1OMZA 5IDTA 5C49A 1S4PA 1WSZA 4B42A 2WEEA 4HO8A 1VZUA 2RIZA 3V0OA 3V8ZA 2BO4A 1TW5A 2CU2A 4AC3A 1FWYA 4DE7A 2V0LA 1ZI5A 3SXDA 5C1HA 3U0XA 1H5SC 4AAWA 5C4FA 1QWJA 1WT0A 4K6RA 1V82A 3DJ4A 4FRBA 1GX0A 3U2UA 1ZI1A 1TZFA 3OH1A 2P73A 1FR9A 1R80A 4FRPA 1ZCUA 1FGXA 4Y6NA 1G3LA 1HM0A 5CMIA 5DDTA 1VM8A 4CJ8A 2WAWA 2Z87A 2WVMA 3OH3A 2X5SA 3T7OA 3ZF8A 4FREA 3K8DA 4AYLA 2FY7A 4FRHA 4KT7A 4NALA 1WT1A 3I0EA 5C36A 1MP4A 2JCJA 3IOHA 4D0ZA 4G87A 2ZU9A 1JV1A 1G0RA 2JCKA 2OEGA 2YESA 3Q4SA 1ZI3A 2FFVA 2VS5A 3I0LA 2A8UA 4L41C 1FXOA 4YS8A 3F1YA 3V0PA 2J0AA 4Y63A 2W0VA 5EJ1A 2OI5A 1R7TA 4IRQA 1VZTA 1H7QA 1QGQA 1WT3A 2FFUA 1GQ9A 4G3PA 2MZBA 2VSIA 5D91A 4HO3A 2Y7AA 1K4VA 2XMEA 4EEGA 4B2XA 5C4DA 5CMJA 1PZTA 4GBPA 5AJNA 2AE7A 4FCUA 4FRMA 1IINA 1XHBA 1ZJ3A 3SXGA 2QH5A 4Q7CA 1FG5N 3CKVA 5L6VA 1LZIA 5D92A 5C8RA 4EE5A 3CU0A 1H7LA 1LL3A 2WVLA 3V0MA 5C1LA 3PKQA 1QGSA 3SX3A 2P6WA 1R7UA 1VZXA 4EEMA 4BMAA 1HJJA 1O7OA 4KNXA 3IOIA 3V90A 5C4BA 1VH3A 4KPXA 1LL2A 2A8WA 4KNRA 1NWGB 1NHEB 1G93A 4ASJA 1V84A 3I0FA 3JUJA 4J18A 3F1CA 3E26A 1O7QA 4ARWA 2VS3A 3LW6A 1E5KA 4EEAA 5CQPA 4D11C 3D8VA 2GGOA 3PNNA 5FV9A 1MC3A 5C3AA 1KWSA 1ZJPA 3CKNA 4DDZA 3K8EA 2VXMA 4M28A 4KQLA 3ZGGA 3O3PA 4D11A 1H5RB 1FO8A 5CMGX 1H7GA 4HO9A 2D7IA 3TQDA 4HO2A 1WVCA 2Q4JA 1H5TA 3IOJA 1EZIA 2ICYA 1GQCA 2X60A 3ZGFA 1WT2A 4EVWA 3OGZA 2GGQA 4FRQA 1R7YA 2AM4A 4LW3A 1H7HA 2VD4A 2APCA 1H5SA 2WGZA 4FROA 5CQMX 4Y7UA 1ZJ2A 3OH4A 4FCEA 2Y4MA 1GX4A 1JV3A 2VK9A 1H7EA 4G3SA 3FOQA 1FO9A 1IIMA 3ZLLA 1ZCYA 4BQHA 2X5ZA 4JISA 5AJPA 2ZU8A 4ECMA 4MYBA 3OH0A 2YQSA 1YP4A 1YP2A 1ZCVA 5DDVA 2Y6PA 4Y7TA 5FUHA 1PZYB 1R81A 2YC5A 3I0DA 1NQIB 2YCMA 4FRDA 1ZJ0A 5C3DA 1H5SD 1NMMB 3SX7A 2RJ0A 4C2SA 3JTJA 3DUVA 3PKPA 3USQA 1ZDGA 3U2XA 2WVKA 2YQCA 1QG8A 3USRA 3NGWA 1LZ0A 4G3QA 1HV9A 1HM9A 2RITA 2PGVA 3I0GA 5CMHA 3V91A 3BRKX 4FRLA 4B5BA 2BO6A 1R7XA 3SX5A 1W77A 3CKQA 1GWVA 1LZJA 3D5NA 2PA4A 4DECA 5FTVA 3DK5A 2Y4LA 1H3MA 3N9WA 2P72A 1W55A 4FIXA 4KPZA 4Y7FA 3CKJA 4B2WA 1W57A 2Y4JA 1JYKA 4HO5A 4FIYA 3U2TA 3U2WA 1H7FA 2RIYA 2W0WA 1S4NA 2AM5A 1H4CA 1ZCTA 3I0HA 1JVDA 5IDSA 4MNDA 1O23B 3KIAA 4P00A 1LL0A 4P02A 2RJ6A 3BCVA 1EYRA 4JD0A 2XWLA 4FQWA 5CQNX 1NF5B 1H4DA 3V0QA 1ZIZA 2FYAA 1R82A 4E1KA 2AGDA 1ZJOA 2J0BA 1G9RA 2FYCB 1VGTA 3HL3A 4M2BA 4FRAA 3SXCA 3ST8A 1OQMB 1TW1A 3I0JA 5EJZA 3Q80A 2VXLA 2E3DA 2YQJA 3ZLKA 4CJBA 4HOCA 2RJ5A 3CGXA 3FWWA 2AESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3U A;  1G95 A;  2OI6 A;  2BO7 A;  1GA8 A;  1ZJ1 A;  1JYL A;  1FGG A;  4M2A A;  5HS2 A;  1ZDF A;  5FU8 A;  5FU0 A;  3RMW A;  4CVH A;  4KXO A;  4EE4 A;  1NKH B;  3JUK A;  4HCQ A;  3SPT A;  3V0N A;  2JCL A;  3OH2 A;  4Y9X A;  5J49 A;  1G2V A;  1I52 A;  2OEF A;  2XWM A;  2JCO A;  3OC9 A;  2V0K A;  4Y6U A;  2RJ8 A;  1FR8 A;  5BXC A;  5C47 A;  1VGU A;  2AM3 A;  1O0R A;  3GUE A;  4NAI A;  1YRO B;  1FZW A;  5C4C A;  2RJ4 A;  3I0K A;  1TVY A;  3E25 A;  4Y64 A;  4XWI A;  3SX8 A;  1HM8 A;  1S4O A;  1GWW A;  3Q7U A;  4KC1 A;  4HO4 A;  2BO8 A;  2NXV A;  2O1H A;  2V0I A;  1H4E A;  4HO6 A;  1H5T B;  5C38 A;  4EEO A;  3R3I A;  2QGI A;  1XZ6 A;  2RJ9 A;  2D7R A;  3V0L A;  4AYJ A;  4LW6 A;  1G97 A;  1VPA A;  2YQH A;  1H5S B;  3R2W A;  4KRV A;  2X65 A;  1ZHJ A;  5CMF X;  5IFY A;  2O1F A;  3T7N A;  1LVW A;  1INJ A;  4ASY A;  1G1L A;  3T7M A;  4KC4 A;  4Y7G A;  1VIC A;  3V8Y A;  4B4M A;  5CQO A;  4HO0 A;  3POL A;  1G8O A;  4Y7V A;  5C4E A;  1ON8 A;  2Z86 A;  2FYB A;  3TZT A;  4B4G A;  2I7B A;  1H7T A;  2YC3 A;  1FRW A;  3I0I X;  2I5K A;  1SS9 A;  3SXE A;  4B4B A;  2V0J A;  4M4K A;  2PX7 A;  2V0H A;  1VGZ A;  2AEC A;  4KC2 A;  4ZDQ A;  2D0J A;  1R7V A;  4R7P A;  2VSH A;  1OMX A;  2RJ1 A;  2RJ7 A;  1ON6 A;  3U2V A;  1LZ7 A;  5C48 A;  1MP3 A;  2VS4 A;  4HG6 A;  4NAN A;  4UEG A;  3OAM A;  2RIX A;  3QVB A;  4D0T A;  1VGW A;  3RSB A;  3I0C A;  5L6S A;  1V83 A;  2XWN A;  2I5E A;  5I1F A;  1FXJ A;  1INI A;  1HJL A;  2UX8 A;  2XMH A;  4CJC A;  1G23 A;  2E8B A;  2AH9 A;  3EE5 A;  3D98 A;  2FYD B;  5EIY A;  4Y62 A;  4EE3 A;  1JVG A;  2WE9 A;  1MP5 A;  5CQL X;  1VH1 A;  5FTS A;  5C3B A;  5JQQ A;  1FOA A;  2ZU7 A;  1H5R A;  3SXB A;  5FYE A;  2Y4K A;  5C1G A;  1Z90 A;  1YP3 A;  2QKX A;  3U0Y A;  2DPW A;  2PGY A;  3CKO A;  2ICX A;  4NAK A;  4IRP A;  2O1G A;  2VFZ A;  4D48 A;  2OI7 A;  3SXA A;  3RMV A;  1ZI4 A;  3OKR A;  5AJO A;  1OMZ A;  5IDT A;  5C49 A;  1S4P A;  1WSZ A;  4B42 A;  2WEE A;  4HO8 A;  1VZU A;  2RIZ A;  3V0O A;  3V8Z A;  2BO4 A;  1TW5 A;  2CU2 A;  4AC3 A;  1FWY A;  4DE7 A;  2V0L A;  1ZI5 A;  3SXD A;  5C1H A;  3U0X A;  1H5S C;  4AAW A;  5C4F A;  1QWJ A;  1WT0 A;  4K6R A;  1V82 A;  3DJ4 A;  4FRB A;  1GX0 A;  3U2U A;  1ZI1 A;  1TZF A;  3OH1 A;  2P73 A;  1FR9 A;  1R80 A;  4FRP A;  1ZCU A;  1FGX A;  4Y6N A;  1G3L A;  1HM0 A;  5CMI A;  5DDT A;  1VM8 A;  4CJ8 A;  2WAW A;  2Z87 A;  2WVM A;  3OH3 A;  2X5S A;  3T7O A;  3ZF8 A;  4FRE A;  3K8D A;  4AYL A;  2FY7 A;  4FRH A;  4KT7 A;  4NAL A;  1WT1 A;  3I0E A;  5C36 A;  1MP4 A;  2JCJ A;  3IOH A;  4D0Z A;  4G87 A;  2ZU9 A;  1JV1 A;  1G0R A;  2JCK A;  2OEG A;  2YES A;  3Q4S A;  1ZI3 A;  2FFV A;  2VS5 A;  3I0L A;  2A8U A;  4L41 C;  1FXO A;  4YS8 A;  3F1Y A;  3V0P A;  4Y63 A;  2W0V A;  5EJ1 A;  2OI5 A;  1R7T A;  4IRQ A;  1VZT A;  1H7Q A;  1QGQ A;  1WT3 A;  2FFU A;  1GQ9 A;  4G3P A;  2MZB A;  2VSI A;  4HO3 A;  2Y7A A;  1K4V A;  2XME A;  4EEG A;  4B2X A;  5C4D A;  5CMJ A;  1PZT A;  4GBP A;  5AJN A;  2AE7 A;  4FCU A;  4FRM A;  1IIN A;  1XHB A;  1ZJ3 A;  3SXG A;  2QH5 A;  1FG5 N;  3CKV A;  5L6V A;  1LZI A;  5C8R A;  4EE5 A;  3CU0 A;  1H7L A;  1LL3 A;  2WVL A;  3V0M A;  5C1L A;  3PKQ A;  1QGS A;  3SX3 A;  2P6W A;  1R7U A;  1VZX A;  4EEM A;  4BMA A;  1HJJ A;  1O7O A;  4KNX A;  3IOI A;  3V90 A;  5C4B A;  1VH3 A;  4KPX A;  1LL2 A;  2A8W A;  4KNR A;  1NWG B;  1NHE B;  1G93 A;  4ASJ A;  1V84 A;  3I0F A;  3JUJ A;  4J18 A;  3F1C A;  3E26 A;  1O7Q A;  4ARW A;  2VS3 A;  3LW6 A;  1E5K A;  4EEA A;  5CQP A;  4D11 C;  3D8V A;  2GGO A;  3PNN A;  5FV9 A;  1MC3 A;  5C3A A;  1KWS A;  1ZJP A;  3CKN A;  4DDZ A;  3K8E A;  2VXM A;  4M28 A;  4KQL A;  3ZGG A;  3O3P A;  4D11 A;  1H5R B;  1FO8 A;  5CMG X;  1H7G A;  4HO9 A;  2D7I A;  3TQD A;  4HO2 A;  1WVC A;  2Q4J A;  1H5T A;  3IOJ A;  1EZI A;  2ICY A;  1GQC A;  2X60 A;  3ZGF A;  1WT2 A;  4EVW A;  3OGZ A;  2GGQ A;  4FRQ A;  1R7Y A;  2AM4 A;  4LW3 A;  1H7H A;  2VD4 A;  2APC A;  1H5S A;  2WGZ A;  4FRO A;  5CQM X;  4Y7U A;  1ZJ2 A;  3OH4 A;  4FCE A;  2Y4M A;  1GX4 A;  1JV3 A;  1H7E A;  4G3S A;  3FOQ A;  1FO9 A;  1IIM A;  3ZLL A;  1ZCY A;  4BQH A;  2X5Z A;  4JIS A;  5AJP A;  2ZU8 A;  4ECM A;  4MYB A;  3OH0 A;  2YQS A;  1YP4 A;  1YP2 A;  1ZCV A;  5DDV A;  2Y6P A;  4Y7T A;  5FUH A;  1PZY B;  1R81 A;  2YC5 A;  3I0D A;  1NQI B;  2YCM A;  4FRD A;  1ZJ0 A;  5C3D A;  1H5S D;  1NMM B;  3SX7 A;  2RJ0 A;  4C2S A;  3JTJ A;  3DUV A;  3PKP A;  3USQ A;  1ZDG A;  3U2X A;  2WVK A;  2YQC A;  1QG8 A;  3USR A;  3NGW A;  1LZ0 A;  4G3Q A;  1HV9 A;  1HM9 A;  2RIT A;  2PGV A;  3I0G A;  5CMH A;  3V91 A;  3BRK X;  4FRL A;  4B5B A;  2BO6 A;  1R7X A;  3SX5 A;  1W77 A;  3CKQ A;  1GWV A;  1LZJ A;  3D5N A;  2PA4 A;  4DEC A;  5FTV A;  3DK5 A;  2Y4L A;  1H3M A;  3N9W A;  2P72 A;  1W55 A;  4KPZ A;  4Y7F A;  3CKJ A;  4B2W A;  1W57 A;  2Y4J A;  1JYK A;  4HO5 A;  3U2W A;  3U2T A;  1H7F A;  2RIY A;  2W0W A;  1S4N A;  2AM5 A;  1H4C A;  1ZCT A;  3I0H A;  1JVD A;  5IDS A;  4MND A;  1O23 B;  3KIA A;  4P00 A;  1LL0 A;  4P02 A;  2RJ6 A;  3BCV A;  1EYR A;  4JD0 A;  2XWL A;  4FQW A;  5CQN X;  1NF5 B;  1H4D A;  3V0Q A;  1ZIZ A;  2FYA A;  1R82 A;  4E1K A;  2AGD A;  1ZJO A;  1G9R A;  2FYC B;  1VGT A;  3HL3 A;  4M2B A;  4FRA A;  3SXC A;  3ST8 A;  1OQM B;  1TW1 A;  3I0J A;  5EJZ A;  3Q80 A;  2VXL A;  2E3D A;  2YQJ A;  3ZLK A;  4CJB A;  4HOC A;  2RJ5 A;  3CGX A;  3FWW A;  2AES A; 
#chains in the Genus database with same CATH topology
 4B3U A;  1G95 A;  2OI6 A;  2BO7 A;  1GA8 A;  1ZJ1 A;  1JYL A;  1FGG A;  4M2A A;  5HS2 A;  1ZDF A;  5FU8 A;  5FU0 A;  3RMW A;  4CVH A;  4KXO A;  4EE4 A;  1NKH B;  3JUK A;  4HCQ A;  3SPT A;  3V0N A;  2JCL A;  3OH2 A;  4Y9X A;  5J49 A;  1G2V A;  1I52 A;  2OEF A;  2XWM A;  2JCO A;  3OC9 A;  2V0K A;  4Y6U A;  2RJ8 A;  1FR8 A;  5BXC A;  5C47 A;  1VGU A;  2AM3 A;  1O0R A;  3GUE A;  4NAI A;  1YRO B;  1FZW A;  5C4C A;  2RJ4 A;  3I0K A;  1TVY A;  3E25 A;  4Y64 A;  4MIX A;  4XWI A;  4O6M A;  3SX8 A;  1HM8 A;  1S4O A;  1GWW A;  3Q7U A;  4KC1 A;  4HO4 A;  2BO8 A;  2NXV A;  2O1H A;  2V0I A;  1H4E A;  4HO6 A;  1H5T B;  5C38 A;  4EEO A;  3R3I A;  2QGI A;  1XZ6 A;  2RJ9 A;  2D7R A;  3V0L A;  4AYJ A;  4LW6 A;  1G97 A;  1VPA A;  2YQH A;  1H5S B;  3R2W A;  4KRV A;  2X65 A;  1ZHJ A;  5CMF X;  5IFY A;  2O1F A;  3T7N A;  1LVW A;  1INJ A;  4ASY A;  1G1L A;  3T7M A;  4KC4 A;  4Y7G A;  1VIC A;  3V8Y A;  4B4M A;  5CQO A;  4HO0 A;  3POL A;  1G8O A;  4Y7V A;  5C4E A;  1ON8 A;  2Z86 A;  2FYB A;  3TZT A;  4B4G A;  2I7B A;  1H7T A;  2YC3 A;  1FRW A;  3I0I X;  2I5K A;  1SS9 A;  3SXE A;  4B4B A;  2V0J A;  4M4K A;  2PX7 A;  2V0H A;  1VGZ A;  2AEC A;  4KC2 A;  4ZDQ A;  2D0J A;  1R7V A;  4R7P A;  2VSH A;  1OMX A;  2RJ1 A;  2RJ7 A;  1ON6 A;  3U2V A;  1LZ7 A;  5C48 A;  1MP3 A;  2VS4 A;  4HG6 A;  4NAN A;  4UEG A;  3OAM A;  2RIX A;  3QVB A;  4D0T A;  1VGW A;  3RSB A;  3I0C A;  5L6S A;  1V83 A;  2XWN A;  2I5E A;  5I1F A;  1FXJ A;  1INI A;  1HJL A;  2UX8 A;  2XMH A;  4CJC A;  1G23 A;  2E8B A;  2AH9 A;  3EE5 A;  3D98 A;  2FYD B;  5EIY A;  4Y62 A;  4EE3 A;  1JVG A;  2WE9 A;  1MP5 A;  4O6N A;  5CQL X;  1VH1 A;  5FTS A;  5C3B A;  5JQQ A;  2C0N A;  1FOA A;  2ZU7 A;  1H5R A;  3SXB A;  5FYE A;  2Y4K A;  5C1G A;  1Z90 A;  1YP3 A;  2QKX A;  3U0Y A;  2DPW A;  2PGY A;  3CKO A;  2ICX A;  4NAK A;  4IRP A;  2O1G A;  2VFZ A;  4D48 A;  2OI7 A;  3SXA A;  3RMV A;  1ZI4 A;  3OKR A;  5AJO A;  1OMZ A;  5IDT A;  5C49 A;  1S4P A;  1WSZ A;  4B42 A;  2WEE A;  4HO8 A;  1VZU A;  2RIZ A;  3V0O A;  3V8Z A;  2BO4 A;  1TW5 A;  2CU2 A;  4AC3 A;  1FWY A;  4DE7 A;  2V0L A;  1ZI5 A;  3SXD A;  5C1H A;  3U0X A;  1H5S C;  4AAW A;  5C4F A;  1QWJ A;  1WT0 A;  4K6R A;  1V82 A;  3DJ4 A;  4FRB A;  1GX0 A;  3U2U A;  1ZI1 A;  1TZF A;  3OH1 A;  2P73 A;  1FR9 A;  1R80 A;  4FRP A;  1ZCU A;  1FGX A;  4Y6N A;  1G3L A;  1HM0 A;  5CMI A;  5DDT A;  1VM8 A;  4CJ8 A;  2WAW A;  2Z87 A;  2WVM A;  3OH3 A;  2X5S A;  3T7O A;  3ZF8 A;  4FRE A;  3K8D A;  4AYL A;  2FY7 A;  4FRH A;  4KT7 A;  4NAL A;  1WT1 A;  3I0E A;  5C36 A;  1MP4 A;  2JCJ A;  3IOH A;  4D0Z A;  4G87 A;  2ZU9 A;  1JV1 A;  1G0R A;  2JCK A;  2OEG A;  2YES A;  3Q4S A;  1ZI3 A;  2FFV A;  2VS5 A;  3I0L A;  2A8U A;  4L41 C;  1FXO A;  4YS8 A;  3F1Y A;  3V0P A;  2J0A A;  4Y63 A;  2W0V A;  5EJ1 A;  2OI5 A;  1R7T A;  4IRQ A;  1VZT A;  1H7Q A;  1QGQ A;  1WT3 A;  2FFU A;  1GQ9 A;  4G3P A;  2MZB A;  2VSI A;  5D91 A;  4HO3 A;  2Y7A A;  1K4V A;  2XME A;  4EEG A;  4B2X A;  5C4D A;  5CMJ A;  1PZT A;  4GBP A;  5AJN A;  2AE7 A;  4FCU A;  4FRM A;  1IIN A;  1XHB A;  1ZJ3 A;  3SXG A;  2QH5 A;  4Q7C A;  1FG5 N;  3CKV A;  5L6V A;  1LZI A;  5D92 A;  5C8R A;  4EE5 A;  3CU0 A;  1H7L A;  1LL3 A;  2WVL A;  3V0M A;  5C1L A;  3PKQ A;  1QGS A;  3SX3 A;  2P6W A;  1R7U A;  1VZX A;  4EEM A;  4BMA A;  1HJJ A;  1O7O A;  4KNX A;  3IOI A;  3V90 A;  5C4B A;  1VH3 A;  4KPX A;  1LL2 A;  2A8W A;  4KNR A;  1NWG B;  1NHE B;  1G93 A;  4ASJ A;  1V84 A;  3I0F A;  3JUJ A;  4J18 A;  3F1C A;  3E26 A;  1O7Q A;  4ARW A;  2VS3 A;  3LW6 A;  1E5K A;  4EEA A;  5CQP A;  4D11 C;  3D8V A;  2GGO A;  3PNN A;  5FV9 A;  1MC3 A;  5C3A A;  1KWS A;  1ZJP A;  3CKN A;  4DDZ A;  3K8E A;  2VXM A;  4M28 A;  4KQL A;  3ZGG A;  3O3P A;  4D11 A;  1H5R B;  1FO8 A;  5CMG X;  1H7G A;  4HO9 A;  2D7I A;  3TQD A;  4HO2 A;  1WVC A;  2Q4J A;  1H5T A;  3IOJ A;  1EZI A;  2ICY A;  1GQC A;  2X60 A;  3ZGF A;  1WT2 A;  4EVW A;  3OGZ A;  2GGQ A;  4FRQ A;  1R7Y A;  2AM4 A;  4LW3 A;  1H7H A;  2VD4 A;  2APC A;  1H5S A;  2WGZ A;  4FRO A;  5CQM X;  4Y7U A;  1ZJ2 A;  3OH4 A;  4FCE A;  2Y4M A;  1GX4 A;  1JV3 A;  2VK9 A;  1H7E A;  4G3S A;  3FOQ A;  1FO9 A;  1IIM A;  3ZLL A;  1ZCY A;  4BQH A;  2X5Z A;  4JIS A;  5AJP A;  2ZU8 A;  4ECM A;  4MYB A;  3OH0 A;  2YQS A;  1YP4 A;  1YP2 A;  1ZCV A;  5DDV A;  2Y6P A;  4Y7T A;  5FUH A;  1PZY B;  1R81 A;  2YC5 A;  3I0D A;  1NQI B;  2YCM A;  4FRD A;  1ZJ0 A;  5C3D A;  1H5S D;  1NMM B;  3SX7 A;  2RJ0 A;  4C2S A;  3JTJ A;  3DUV A;  3PKP A;  3USQ A;  1ZDG A;  3U2X A;  2WVK A;  2YQC A;  1QG8 A;  3USR A;  3NGW A;  1LZ0 A;  4G3Q A;  1HV9 A;  1HM9 A;  2RIT A;  2PGV A;  3I0G A;  5CMH A;  3V91 A;  3BRK X;  4FRL A;  4B5B A;  2BO6 A;  1R7X A;  3SX5 A;  1W77 A;  3CKQ A;  1GWV A;  1LZJ A;  3D5N A;  2PA4 A;  4DEC A;  5FTV A;  3DK5 A;  2Y4L A;  1H3M A;  3N9W A;  2P72 A;  1W55 A;  4FIX A;  4KPZ A;  4Y7F A;  3CKJ A;  4B2W A;  1W57 A;  2Y4J A;  1JYK A;  4HO5 A;  4FIY A;  3U2T A;  3U2W A;  1H7F A;  2RIY A;  2W0W A;  1S4N A;  2AM5 A;  1H4C A;  1ZCT A;  3I0H A;  1JVD A;  5IDS A;  4MND A;  1O23 B;  3KIA A;  4P00 A;  1LL0 A;  4P02 A;  2RJ6 A;  3BCV A;  1EYR A;  4JD0 A;  2XWL A;  4FQW A;  5CQN X;  1NF5 B;  1H4D A;  3V0Q A;  1ZIZ A;  2FYA A;  1R82 A;  4E1K A;  2AGD A;  1ZJO A;  2J0B A;  1G9R A;  2FYC B;  1VGT A;  3HL3 A;  4M2B A;  4FRA A;  3SXC A;  3ST8 A;  1OQM B;  1TW1 A;  3I0J A;  5EJZ A;  3Q80 A;  2VXL A;  2E3D A;  2YQJ A;  3ZLK A;  4CJB A;  4HOC A;  2RJ5 A;  3CGX A;  3FWW A;  2AES A; 
#chains in the Genus database with same CATH homology
 4B3U A;  1G95 A;  2OI6 A;  2BO7 A;  1GA8 A;  1ZJ1 A;  1JYL A;  1FGG A;  4M2A A;  5HS2 A;  1ZDF A;  5FU8 A;  5FU0 A;  3RMW A;  4CVH A;  4KXO A;  4EE4 A;  1NKH B;  3JUK A;  4HCQ A;  3SPT A;  3V0N A;  2JCL A;  3OH2 A;  4Y9X A;  5J49 A;  1G2V A;  1I52 A;  2OEF A;  2XWM A;  2JCO A;  3OC9 A;  2V0K A;  4Y6U A;  2RJ8 A;  1FR8 A;  5BXC A;  5C47 A;  1VGU A;  2AM3 A;  1O0R A;  3GUE A;  4NAI A;  1YRO B;  1FZW A;  5C4C A;  2RJ4 A;  3I0K A;  1TVY A;  3E25 A;  4Y64 A;  4MIX A;  4XWI A;  4O6M A;  3SX8 A;  1HM8 A;  1S4O A;  1GWW A;  3Q7U A;  4KC1 A;  4HO4 A;  2BO8 A;  2NXV A;  2O1H A;  2V0I A;  1H4E A;  4HO6 A;  1H5T B;  5C38 A;  4EEO A;  3R3I A;  2QGI A;  1XZ6 A;  2RJ9 A;  2D7R A;  3V0L A;  4AYJ A;  4LW6 A;  1G97 A;  1VPA A;  2YQH A;  1H5S B;  3R2W A;  4KRV A;  2X65 A;  1ZHJ A;  5CMF X;  5IFY A;  2O1F A;  3T7N A;  1LVW A;  1INJ A;  4ASY A;  1G1L A;  3T7M A;  4KC4 A;  4Y7G A;  1VIC A;  3V8Y A;  4B4M A;  5CQO A;  4HO0 A;  3POL A;  1G8O A;  4Y7V A;  5C4E A;  1ON8 A;  2Z86 A;  2FYB A;  3TZT A;  4B4G A;  2I7B A;  1H7T A;  2YC3 A;  1FRW A;  3I0I X;  2I5K A;  1SS9 A;  3SXE A;  4B4B A;  2V0J A;  4M4K A;  2PX7 A;  2V0H A;  1VGZ A;  2AEC A;  4KC2 A;  4ZDQ A;  2D0J A;  1R7V A;  4R7P A;  2VSH A;  1OMX A;  2RJ1 A;  2RJ7 A;  1ON6 A;  3U2V A;  1LZ7 A;  5C48 A;  1MP3 A;  2VS4 A;  4HG6 A;  4NAN A;  4UEG A;  3OAM A;  2RIX A;  3QVB A;  4D0T A;  1VGW A;  3RSB A;  3I0C A;  5L6S A;  1V83 A;  2XWN A;  2I5E A;  5I1F A;  1FXJ A;  1INI A;  1HJL A;  2UX8 A;  2XMH A;  4CJC A;  1G23 A;  2E8B A;  2AH9 A;  3EE5 A;  3D98 A;  2FYD B;  5EIY A;  4Y62 A;  4EE3 A;  1JVG A;  2WE9 A;  1MP5 A;  4O6N A;  5CQL X;  1VH1 A;  5FTS A;  5C3B A;  5JQQ A;  2C0N A;  1FOA A;  2ZU7 A;  1H5R A;  3SXB A;  5FYE A;  2Y4K A;  5C1G A;  1Z90 A;  1YP3 A;  2QKX A;  3U0Y A;  2DPW A;  2PGY A;  3CKO A;  2ICX A;  4NAK A;  4IRP A;  2O1G A;  2VFZ A;  4D48 A;  2OI7 A;  3SXA A;  3RMV A;  1ZI4 A;  3OKR A;  5AJO A;  1OMZ A;  5IDT A;  5C49 A;  1S4P A;  1WSZ A;  4B42 A;  2WEE A;  4HO8 A;  1VZU A;  2RIZ A;  3V0O A;  3V8Z A;  2BO4 A;  1TW5 A;  2CU2 A;  4AC3 A;  1FWY A;  4DE7 A;  2V0L A;  1ZI5 A;  3SXD A;  5C1H A;  3U0X A;  1H5S C;  4AAW A;  5C4F A;  1QWJ A;  1WT0 A;  4K6R A;  1V82 A;  3DJ4 A;  4FRB A;  1GX0 A;  3U2U A;  1ZI1 A;  1TZF A;  3OH1 A;  2P73 A;  1FR9 A;  1R80 A;  4FRP A;  1ZCU A;  1FGX A;  4Y6N A;  1G3L A;  1HM0 A;  5CMI A;  5DDT A;  1VM8 A;  4CJ8 A;  2WAW A;  2Z87 A;  2WVM A;  3OH3 A;  2X5S A;  3T7O A;  3ZF8 A;  4FRE A;  3K8D A;  4AYL A;  2FY7 A;  4FRH A;  4KT7 A;  4NAL A;  1WT1 A;  3I0E A;  5C36 A;  1MP4 A;  2JCJ A;  3IOH A;  4D0Z A;  4G87 A;  2ZU9 A;  1JV1 A;  1G0R A;  2JCK A;  2OEG A;  2YES A;  3Q4S A;  1ZI3 A;  2FFV A;  2VS5 A;  3I0L A;  2A8U A;  4L41 C;  1FXO A;  4YS8 A;  3F1Y A;  3V0P A;  2J0A A;  4Y63 A;  2W0V A;  5EJ1 A;  2OI5 A;  1R7T A;  4IRQ A;  1VZT A;  1H7Q A;  1QGQ A;  1WT3 A;  2FFU A;  1GQ9 A;  4G3P A;  2MZB A;  2VSI A;  5D91 A;  4HO3 A;  2Y7A A;  1K4V A;  2XME A;  4EEG A;  4B2X A;  5C4D A;  5CMJ A;  1PZT A;  4GBP A;  5AJN A;  2AE7 A;  4FCU A;  4FRM A;  1IIN A;  1XHB A;  1ZJ3 A;  3SXG A;  2QH5 A;  4Q7C A;  1FG5 N;  3CKV A;  5L6V A;  1LZI A;  5D92 A;  5C8R A;  4EE5 A;  3CU0 A;  1H7L A;  1LL3 A;  2WVL A;  3V0M A;  5C1L A;  3PKQ A;  1QGS A;  3SX3 A;  2P6W A;  1R7U A;  1VZX A;  4EEM A;  4BMA A;  1HJJ A;  1O7O A;  4KNX A;  3IOI A;  3V90 A;  5C4B A;  1VH3 A;  4KPX A;  1LL2 A;  2A8W A;  4KNR A;  1NWG B;  1NHE B;  1G93 A;  4ASJ A;  1V84 A;  3I0F A;  3JUJ A;  4J18 A;  3F1C A;  3E26 A;  1O7Q A;  4ARW A;  2VS3 A;  3LW6 A;  1E5K A;  4EEA A;  5CQP A;  4D11 C;  3D8V A;  2GGO A;  3PNN A;  5FV9 A;  1MC3 A;  5C3A A;  1KWS A;  1ZJP A;  3CKN A;  4DDZ A;  3K8E A;  2VXM A;  4M28 A;  4KQL A;  3ZGG A;  3O3P A;  4D11 A;  1H5R B;  1FO8 A;  5CMG X;  1H7G A;  4HO9 A;  2D7I A;  3TQD A;  4HO2 A;  1WVC A;  2Q4J A;  1H5T A;  3IOJ A;  1EZI A;  2ICY A;  1GQC A;  2X60 A;  3ZGF A;  1WT2 A;  4EVW A;  3OGZ A;  2GGQ A;  4FRQ A;  1R7Y A;  2AM4 A;  4LW3 A;  1H7H A;  2VD4 A;  2APC A;  1H5S A;  2WGZ A;  4FRO A;  5CQM X;  4Y7U A;  1ZJ2 A;  3OH4 A;  4FCE A;  2Y4M A;  1GX4 A;  1JV3 A;  2VK9 A;  1H7E A;  4G3S A;  3FOQ A;  1FO9 A;  1IIM A;  3ZLL A;  1ZCY A;  4BQH A;  2X5Z A;  4JIS A;  5AJP A;  2ZU8 A;  4ECM A;  4MYB A;  3OH0 A;  2YQS A;  1YP4 A;  1YP2 A;  1ZCV A;  5DDV A;  2Y6P A;  4Y7T A;  5FUH A;  1PZY B;  1R81 A;  2YC5 A;  3I0D A;  1NQI B;  2YCM A;  4FRD A;  1ZJ0 A;  5C3D A;  1H5S D;  1NMM B;  3SX7 A;  2RJ0 A;  4C2S A;  3JTJ A;  3DUV A;  3PKP A;  3USQ A;  1ZDG A;  3U2X A;  2WVK A;  2YQC A;  1QG8 A;  3USR A;  3NGW A;  1LZ0 A;  4G3Q A;  1HV9 A;  1HM9 A;  2RIT A;  2PGV A;  3I0G A;  5CMH A;  3V91 A;  3BRK X;  4FRL A;  4B5B A;  2BO6 A;  1R7X A;  3SX5 A;  1W77 A;  3CKQ A;  1GWV A;  1LZJ A;  3D5N A;  2PA4 A;  4DEC A;  5FTV A;  3DK5 A;  2Y4L A;  1H3M A;  3N9W A;  2P72 A;  1W55 A;  4FIX A;  4KPZ A;  4Y7F A;  3CKJ A;  4B2W A;  1W57 A;  2Y4J A;  1JYK A;  4HO5 A;  4FIY A;  3U2T A;  3U2W A;  1H7F A;  2RIY A;  2W0W A;  1S4N A;  2AM5 A;  1H4C A;  1ZCT A;  3I0H A;  1JVD A;  5IDS A;  4MND A;  1O23 B;  3KIA A;  4P00 A;  1LL0 A;  4P02 A;  2RJ6 A;  3BCV A;  1EYR A;  4JD0 A;  2XWL A;  4FQW A;  5CQN X;  1NF5 B;  1H4D A;  3V0Q A;  1ZIZ A;  2FYA A;  1R82 A;  4E1K A;  2AGD A;  1ZJO A;  2J0B A;  1G9R A;  2FYC B;  1VGT A;  3HL3 A;  4M2B A;  4FRA A;  3SXC A;  3ST8 A;  1OQM B;  1TW1 A;  3I0J A;  5EJZ A;  3Q80 A;  2VXL A;  2E3D A;  2YQJ A;  3ZLK A;  4CJB A;  4HOC A;  2RJ5 A;  3CGX A;  3FWW A;  2AES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...