4KT7A

The crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritolsynthase from anaerococcus prevotii dsm 20548
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
227
Chain Sequence
SNAMIDGKFISAIITAAGSGLRMPYIEVGGRKVLEITLDTVSRVKEIDEIILVIRKDDEDIIKDILEKYDGNIRYVYGSTTRELSTFEGLKALDPQSELVLTHDGVRPFASEELFLKTINALRKNKAVITATKSKDTVKIIDDDMYVDFTPNRDYVYNIQTPQAFDKKLIYAMYEKYLASEFKVTDDSQLFEFFDRDEKVKVVHGEYSNIKITTQEDIIFANAYLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title The crystal structure of 4-diphosphocytidyl-2C-methyl-D-erythritolsynthase from Anaerococcus prevotii DSM 20548
rcsb
source organism Anaerococcus prevotii
total genus 72
structure length 227
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4kt7A00
3LW6A 4FCUA 2RIZA 1HJJA 1R80A 2A8WA 3SX7A 4HO9A 1ZHJA 2I7BA 1H5RB 4D0ZA 3V0LA 4M28A 1FXJA 5C36A 2VS4A 1H5SD 1NQIB 2X5ZA 2Y4JA 1ZI4A 4ASJA 2YCMA 3ST8A 3JTJA 5FUHA 1ZCUA 4D11C 3KIAA 3CKOA 2AM4A 4IRPA 3Q7UA 1ZIZA 1VH1A 2RJ1A 2VXLA 1G8OA 4LW3A 3U2TA 3U0YA 4DE7A 2RIXA 3EE5A 4HCQA 1FR8A 1ZI1A 1G0RA 4LW6A 1W77A 1R7XA 3DUVA 4JISA 2QKXA 4JD0A 4AC3A 2XMEA 2W0VA 1XZ6A 4Y6UA 5C1LA 1LL2A 1ZJOA 1JVGA 5DDVA 5IDTA 4L41C 2YQHA 3U2XA 2Z87A 1VGUA 3HL3A 3OH3A 1FR9A 3CKNA 4FRHA 5EIYA 5C4BA 4KC1A 4FRBA 4NAKA 5C4DA 1HM8A 4EEAA 2E3DA 4Y7UA 1Z90A 3OH2A 4HOCA 4G3QA 4IRQA 1LZIA 2RJ5A 2ZU9A 3I0LA 3F1YA 5C4CA 2AH9A 5FU0A 3V0NA 1NMMB 2VSHA 2YQJA 4HO5A 4B42A 2JCJA 3SXDA 1R7TA 5JQQA 1G9RA 3SXCA 3RMVA 4Y64A 4FREA 4M2AA 5C3AA 1V82A 4D48A 2P72A 1R81A 3OH0A 2AECA 3OKRA 1SS9A 1LL0A 1GA8A 4NANA 1VH3A 2GGQA 5CMFX 4C2SA 2ICXA 1IINA 1QG8A 4M4KA 3ZGFA 1FWYA 2VS5A 1S4NA 1GQCA 1GWVA 3V8YA 4HO8A 1JV1A 1PZTA 1YP4A 3OC9A 5CMHA 3USRA 5CQPA 4E1KA 2I5KA 3CU0A 3ZF8A 2XWMA 3PNNA 2CU2A 3I0DA 1G97A 1JVDA 1FO8A 5FTVA 3ZLLA 4HO0A 5C38A 1WVCA 3SX3A 4KNRA 5EJ1A 4HO3A 2WVKA 2OEGA 2NXVA 1G2VA 4D11A 4FCEA 2AE7A 4Y7TA 3IOIA 3O3PA 4FROA 5C47A 4EE3A 2OEFA 1WSZA 1MP3A 2Y4KA 1H5SA 2Y4MA 4HO4A 3ZLKA 5I1FA 1LZ0A 3U2UA 4G3SA 2YESA 1ZJ3A 2WEEA 1ON8A 2Z86A 2RJ8A 5FTSA 4FRMA 5CQMX 1ZI3A 3SX5A 4MYBA 5AJOA 1VGZA 4Y6NA 1KWSA 3SXEA 4CVHA 5FYEA 1EYRA 1JYKA 1INJA 1R7UA 2O1GA 1FOAA 2YC3A 5C49A 1TVYA 3T7MA 2X5SA 1H5SC 1H4CA 2VFZA 1H4DA 1ZCVA 2VD4A 4KPZA 1O7OA 4BQHA 4EEOA 4K6RA 1HV9A 2YC5A 4FRPA 4B2WA 4KC2A 2MZBA 2V0IA 2JCKA 1G93A 2AESA 3BRKX 3CGXA 4NAIA 1HM9A 4AYLA 3U2WA 2X60A 3I0GA 1VICA 2Y6PA 2QGIA 5CMJA 1VM8A 2FFUA 1S4PA 1FXOA 1EZIA 3D8VA 1H7LA 3E26A 4ARWA 3BCVA 3IOJA 1H7FA 5HS2A 2P73A 4G87A 1JYLA 3K8DA 4NALA 4Y9XA 1O0RA 5CMGX 1YROB 1ZI5A 2GGOA 3CKVA 1K4VA 3NGWA 1FGGA 3Q4SA 3FOQA 4Y7GA 3T7NA 2BO4A 1R7VA 3I0CA 4DECA 1VZUA 2O1HA 3IOHA 3GUEA 4CJBA 5FU8A 3I0IX 3K8EA 4R7PA 1MP5A 1ZJ1A 3SPTA 3E25A 1OMZA 2PA4A 2Q4JA 4EEMA 1NKHB 1VZXA 4FRLA 1ZDGA 1ZJ0A 4Y7VA 4AAWA 2OI7A 2WGZA 5AJNA 1WT0A 4B4GA 1O7QA 1NF5B 1PZYB 3OH1A 4B3UA 4M2BA 5CQOA 4CJCA 5C3BA 5J49A 1G95A 1FO9A 2ZU7A 1LVWA 3R3IA 2PGYA 4ASYA 3PKQA 1WT2A 1WT3A 1FRWA 3JUJA 1JV3A 3ZGGA 5C1HA 2WVMA 1V83A 4AYJA 1E5KA 3R2WA 4KNXA 2BO8A 3PKPA 2OI6A 1H7QA 5IFYA 3OGZA 5C4EA 4Y62A 2WE9A 5C8RA 3D5NA 4EVWA 4KQLA 1HM0A 1FZWA 2FFVA 4P00A 3CKJA 4ZDQA 3U2VA 3V0PA 4P02A 4B4BA 1HJLA 2WAWA 4EE5A 2Y4LA 5C48A 5L6VA 2XWNA 2W0WA 2UX8A 3I0JA 1H7EA 4KXOA 3POLA 1TW1A 4KC4A 1H3MA 5FV9A 1H5TA 2ZU8A 1YP2A 1VGTA 1LZJA 1MP4A 1W57A 2D0JA 4B5BA 1VZTA 1ZCTA 4BMAA 1ZDFA 4D0TA 4B4MA 1INIA 1QGSA 4Y7FA 1NWGB 5CQLX 1ZCYA 2PX7A 1TW5A 3CKQA 3SXBA 3V0OA 1YP3A 2V0KA 3V90A 1GQ9A 3V0QA 1OQMB 2PGVA 5L6SA 2O1FA 3TQDA 1ZJPA 1NHEB 1XHBA 3RSBA 3D98A 2V0HA 5DDTA 1FGXA 1H5SB 2P6WA 4EEGA 2E8BA 2RJ4A 1TZFA 2X65A 4FQWA 3I0HA 2OI5A 2V0LA 3QVBA 4GBPA 1GX0A 3USQA 1QWJA 2V0JA 1H7GA 1G1LA 1GWWA 3V8ZA 1FG5N 2RJ6A 1QGQA 5IDSA 3FWWA 3F1CA 2BO6A 2FYAA 3DK5A 4CJ8A 4FRDA 1H7HA 1H7TA 1H5TB 2RJ9A 3TZTA 4J18A 5BXCA 2RIYA 2RJ0A 4HO2A 4DDZA 1ON6A 1VPAA 4UEGA 5CQNX 3N9WA 4ECMA 1OMXA 2A8UA 4MNDA 2D7RA 2AGDA 1G23A 2XWLA 3DJ4A 3U0XA 2VS3A 3V91A 1I52A 2FYCB 1H5RA 1S4OA 3V0MA 2FYDB 3OH4A 4FRAA 2ICYA 4KPXA 5C3DA 2DPWA 2D7IA 2WVLA 1ZJ2A 2YQCA 2Y7AA 4Y63A 1LZ7A 3I0EA 2APCA 2QH5A 5AJPA 4FRQA 1H4EA 2VSIA 4EE4A 4YS8A 4KT7A 5EJZA 4KRVA 3RMWA 1VGWA 1LL3A 4HO6A 1MC3A 5C4FA 2FY7A 1IIMA 2FYBA 2AM5A 3I0FA 1R82A 2I5EA 1V84A 3SX8A 1W55A 1WT1A 5C1GA 5CMIA 4XWIA 2JCOA 4B2XA 3SXGA 2BO7A 1O23B 2RJ7A 4HG6A 2VXMA 2YQSA 2AM3A 3Q80A 3JUKA 4G3PA 3SXAA 2RITA 2XMHA 1G3LA 1R7YA 2JCLA 3OAMA 3I0KA 1GX4A 3T7OA
chains in the Genus database with same CATH superfamily
3LW6A 4FCUA 2RIZA 1HJJA 1R80A 2A8WA 3SX7A 4HO9A 1ZHJA 2I7BA 1H5RB 4D0ZA 3V0LA 4M28A 1FXJA 5C36A 2VS4A 1H5SD 1NQIB 2X5ZA 2Y4JA 1ZI4A 4ASJA 2YCMA 3ST8A 4Q7CA 3JTJA 5FUHA 1ZCUA 4D11C 3KIAA 3CKOA 2AM4A 4IRPA 3Q7UA 1ZIZA 1VH1A 2RJ1A 2VXLA 1G8OA 4LW3A 3U2TA 3U0YA 4DE7A 2RIXA 3EE5A 5D91A 4HCQA 1FR8A 1ZI1A 1G0RA 4LW6A 1W77A 1R7XA 3DUVA 4JISA 2QKXA 4JD0A 4AC3A 2XMEA 2W0VA 1XZ6A 4Y6UA 5D92A 5C1LA 1LL2A 1ZJOA 1JVGA 5DDVA 5IDTA 4L41C 2YQHA 3U2XA 2Z87A 1VGUA 3HL3A 3OH3A 1FR9A 3CKNA 4FRHA 5EIYA 5C4BA 4KC1A 4FRBA 4NAKA 5C4DA 1HM8A 4EEAA 2E3DA 4Y7UA 1Z90A 3OH2A 4HOCA 4G3QA 4IRQA 1LZIA 2RJ5A 2ZU9A 3I0LA 3F1YA 5C4CA 2AH9A 5FU0A 3V0NA 1NMMB 2VSHA 2YQJA 4HO5A 4B42A 2JCJA 3SXDA 1R7TA 5JQQA 1G9RA 3SXCA 3RMVA 4Y64A 4FREA 4M2AA 5C3AA 1V82A 4D48A 2P72A 1R81A 3OH0A 2AECA 3OKRA 1SS9A 1LL0A 2C0NA 1GA8A 4NANA 1VH3A 2GGQA 5CMFX 4C2SA 2ICXA 1IINA 1QG8A 4M4KA 3ZGFA 4MIXA 1FWYA 2VS5A 1S4NA 1GQCA 1GWVA 3V8YA 4HO8A 1JV1A 1PZTA 1YP4A 3OC9A 5CMHA 3USRA 5CQPA 4E1KA 2I5KA 3CU0A 3ZF8A 2XWMA 3PNNA 2CU2A 3I0DA 1G97A 1JVDA 1FO8A 5FTVA 3ZLLA 4HO0A 5C38A 1WVCA 3SX3A 4KNRA 5EJ1A 4HO3A 2WVKA 2OEGA 2NXVA 1G2VA 4D11A 4FCEA 2AE7A 4Y7TA 3IOIA 3O3PA 4FROA 5C47A 4EE3A 2OEFA 1WSZA 1MP3A 2Y4KA 1H5SA 2Y4MA 4HO4A 3ZLKA 5I1FA 1LZ0A 3U2UA 4G3SA 2YESA 1ZJ3A 2WEEA 1ON8A 2Z86A 2RJ8A 5FTSA 4FRMA 5CQMX 1ZI3A 3SX5A 4MYBA 5AJOA 1VGZA 4Y6NA 1KWSA 3SXEA 4CVHA 5FYEA 1EYRA 1JYKA 1INJA 1R7UA 2O1GA 1FOAA 2YC3A 5C49A 1TVYA 3T7MA 2X5SA 1H5SC 1H4CA 2VFZA 1H4DA 1ZCVA 2VD4A 4KPZA 1O7OA 4BQHA 4EEOA 4K6RA 1HV9A 2YC5A 4FRPA 4B2WA 4KC2A 2MZBA 2V0IA 2JCKA 1G93A 2AESA 3BRKX 3CGXA 4NAIA 1HM9A 4AYLA 2J0BA 3U2WA 2X60A 3I0GA 1VICA 2Y6PA 2QGIA 5CMJA 1VM8A 2FFUA 1S4PA 1FXOA 1EZIA 3D8VA 1H7LA 3E26A 4ARWA 3BCVA 3IOJA 1H7FA 5HS2A 2P73A 4G87A 1JYLA 3K8DA 4NALA 4Y9XA 1O0RA 5CMGX 1YROB 1ZI5A 2GGOA 3CKVA 1K4VA 3NGWA 1FGGA 3Q4SA 3FOQA 4Y7GA 3T7NA 2BO4A 1R7VA 3I0CA 4DECA 1VZUA 2O1HA 3IOHA 3GUEA 4CJBA 5FU8A 3I0IX 3K8EA 4R7PA 1MP5A 1ZJ1A 3SPTA 3E25A 4O6NA 1OMZA 2PA4A 2Q4JA 4EEMA 1NKHB 1VZXA 4FRLA 1ZDGA 1ZJ0A 4Y7VA 4AAWA 2OI7A 2WGZA 5AJNA 1WT0A 4B4GA 1O7QA 1NF5B 1PZYB 3OH1A 4B3UA 4M2BA 5CQOA 4CJCA 5C3BA 5J49A 1G95A 1FO9A 2ZU7A 1LVWA 3R3IA 2PGYA 4ASYA 3PKQA 1WT2A 1WT3A 1FRWA 3JUJA 1JV3A 3ZGGA 5C1HA 2WVMA 1V83A 4AYJA 1E5KA 3R2WA 4KNXA 2BO8A 3PKPA 2OI6A 1H7QA 2J0AA 2VK9A 5IFYA 3OGZA 5C4EA 4Y62A 2WE9A 5C8RA 3D5NA 4EVWA 4KQLA 1HM0A 1FZWA 2FFVA 4P00A 3CKJA 4ZDQA 3U2VA 3V0PA 4P02A 4B4BA 1HJLA 2WAWA 4EE5A 2Y4LA 5C48A 5L6VA 2XWNA 4O6MA 2W0WA 2UX8A 3I0JA 1H7EA 4KXOA 3POLA 1TW1A 4KC4A 1H3MA 5FV9A 1H5TA 2ZU8A 1YP2A 1VGTA 1LZJA 1MP4A 1W57A 2D0JA 4B5BA 1VZTA 1ZCTA 4BMAA 1ZDFA 4D0TA 4B4MA 1INIA 1QGSA 4Y7FA 1NWGB 5CQLX 1ZCYA 2PX7A 1TW5A 3CKQA 3SXBA 3V0OA 1YP3A 2V0KA 3V90A 1GQ9A 3V0QA 1OQMB 2PGVA 5L6SA 2O1FA 3TQDA 1ZJPA 1NHEB 1XHBA 3RSBA 3D98A 2V0HA 5DDTA 1FGXA 1H5SB 2P6WA 4EEGA 2E8BA 2RJ4A 1TZFA 2X65A 4FQWA 3I0HA 2OI5A 2V0LA 3QVBA 4GBPA 1GX0A 3USQA 1QWJA 2V0JA 1H7GA 1G1LA 1GWWA 3V8ZA 1FG5N 2RJ6A 1QGQA 5IDSA 3FWWA 3F1CA 2BO6A 2FYAA 3DK5A 4CJ8A 4FRDA 1H7HA 1H7TA 1H5TB 2RJ9A 3TZTA 4J18A 5BXCA 2RIYA 2RJ0A 4HO2A 4DDZA 1ON6A 1VPAA 4UEGA 5CQNX 3N9WA 4ECMA 1OMXA 2A8UA 4MNDA 2D7RA 2AGDA 1G23A 2XWLA 3DJ4A 3U0XA 2VS3A 3V91A 1I52A 2FYCB 1H5RA 1S4OA 3V0MA 2FYDB 3OH4A 4FRAA 2ICYA 4KPXA 4FIYA 2DPWA 5C3DA 2D7IA 2WVLA 1ZJ2A 2YQCA 2Y7AA 4Y63A 1LZ7A 3I0EA 2APCA 2QH5A 5AJPA 4FRQA 1H4EA 2VSIA 4EE4A 4YS8A 4KT7A 5EJZA 4KRVA 3RMWA 1VGWA 1LL3A 4HO6A 1MC3A 5C4FA 2FY7A 1IIMA 2FYBA 2AM5A 3I0FA 1R82A 2I5EA 1V84A 3SX8A 1W55A 1WT1A 5C1GA 5CMIA 4XWIA 2JCOA 4B2XA 3SXGA 2BO7A 1O23B 2RJ7A 4FIXA 4HG6A 2VXMA 2YQSA 2AM3A 3Q80A 3JUKA 4G3PA 3SXAA 2RITA 2XMHA 1G3LA 1R7YA 2JCLA 3OAMA 3I0KA 1GX4A 3T7OA
chains in the Genus database with same CATH topology
3LW6A 4FCUA 2RIZA 1HJJA 1R80A 2A8WA 3SX7A 4HO9A 1ZHJA 2I7BA 1H5RB 4D0ZA 3V0LA 4M28A 1FXJA 5C36A 2VS4A 1H5SD 1NQIB 2X5ZA 2Y4JA 1ZI4A 4ASJA 2YCMA 3ST8A 4Q7CA 3JTJA 5FUHA 1ZCUA 4D11C 3KIAA 3CKOA 2AM4A 4IRPA 3Q7UA 1ZIZA 1VH1A 2RJ1A 2VXLA 1G8OA 4LW3A 3U2TA 3U0YA 4DE7A 2RIXA 3EE5A 5D91A 4HCQA 1FR8A 1ZI1A 1G0RA 4LW6A 1W77A 1R7XA 3DUVA 4JISA 2QKXA 4JD0A 4AC3A 2XMEA 2W0VA 1XZ6A 4Y6UA 5D92A 5C1LA 1LL2A 1ZJOA 1JVGA 5DDVA 5IDTA 4L41C 2YQHA 3U2XA 2Z87A 1VGUA 3HL3A 3OH3A 1FR9A 3CKNA 4FRHA 5EIYA 5C4BA 4KC1A 4FRBA 4NAKA 5C4DA 1HM8A 4EEAA 2E3DA 4Y7UA 1Z90A 3OH2A 4HOCA 4G3QA 4IRQA 1LZIA 2RJ5A 2ZU9A 3I0LA 3F1YA 5C4CA 2AH9A 5FU0A 3V0NA 1NMMB 2VSHA 2YQJA 4HO5A 4B42A 2JCJA 3SXDA 1R7TA 5JQQA 1G9RA 3SXCA 3RMVA 4Y64A 4FREA 4M2AA 5C3AA 1V82A 4D48A 2P72A 1R81A 3OH0A 2AECA 3OKRA 1SS9A 1LL0A 2C0NA 1GA8A 4NANA 1VH3A 2GGQA 5CMFX 4C2SA 2ICXA 1IINA 1QG8A 4M4KA 3ZGFA 4MIXA 1FWYA 2VS5A 1S4NA 1GQCA 1GWVA 3V8YA 4HO8A 1JV1A 1PZTA 1YP4A 3OC9A 5CMHA 3USRA 5CQPA 4E1KA 2I5KA 3CU0A 3ZF8A 2XWMA 3PNNA 2CU2A 3I0DA 1G97A 1JVDA 1FO8A 5FTVA 3ZLLA 4HO0A 5C38A 1WVCA 3SX3A 4KNRA 5EJ1A 4HO3A 2WVKA 2OEGA 2NXVA 1G2VA 4D11A 4FCEA 2AE7A 4Y7TA 3IOIA 3O3PA 4FROA 5C47A 4EE3A 2OEFA 1WSZA 1MP3A 2Y4KA 1H5SA 2Y4MA 4HO4A 3ZLKA 5I1FA 1LZ0A 3U2UA 4G3SA 2YESA 1ZJ3A 2WEEA 1ON8A 2Z86A 2RJ8A 5FTSA 4FRMA 5CQMX 1ZI3A 3SX5A 4MYBA 5AJOA 1VGZA 4Y6NA 1KWSA 3SXEA 4CVHA 5FYEA 1EYRA 1JYKA 1INJA 1R7UA 2O1GA 1FOAA 2YC3A 5C49A 1TVYA 3T7MA 2X5SA 1H5SC 1H4CA 2VFZA 1H4DA 1ZCVA 2VD4A 4KPZA 1O7OA 4BQHA 4EEOA 4K6RA 1HV9A 2YC5A 4FRPA 4B2WA 4KC2A 2MZBA 2V0IA 2JCKA 1G93A 2AESA 3BRKX 3CGXA 4NAIA 1HM9A 4AYLA 2J0BA 3U2WA 2X60A 3I0GA 1VICA 2Y6PA 2QGIA 5CMJA 1VM8A 2FFUA 1S4PA 1FXOA 1EZIA 3D8VA 1H7LA 3E26A 4ARWA 3BCVA 3IOJA 1H7FA 5HS2A 2P73A 4G87A 1JYLA 3K8DA 4NALA 4Y9XA 1O0RA 5CMGX 1YROB 1ZI5A 2GGOA 3CKVA 1K4VA 3NGWA 1FGGA 3Q4SA 3FOQA 4Y7GA 3T7NA 2BO4A 1R7VA 3I0CA 4DECA 1VZUA 2O1HA 3IOHA 3GUEA 4CJBA 5FU8A 3I0IX 3K8EA 4R7PA 1MP5A 1ZJ1A 3SPTA 3E25A 4O6NA 1OMZA 2PA4A 2Q4JA 4EEMA 1NKHB 1VZXA 4FRLA 1ZDGA 1ZJ0A 4Y7VA 4AAWA 2OI7A 2WGZA 5AJNA 1WT0A 4B4GA 1O7QA 1NF5B 1PZYB 3OH1A 4B3UA 4M2BA 5CQOA 4CJCA 5C3BA 5J49A 1G95A 1FO9A 2ZU7A 1LVWA 3R3IA 2PGYA 4ASYA 3PKQA 1WT2A 1WT3A 1FRWA 3JUJA 1JV3A 3ZGGA 5C1HA 2WVMA 1V83A 4AYJA 1E5KA 3R2WA 4KNXA 2BO8A 3PKPA 2OI6A 1H7QA 2J0AA 2VK9A 5IFYA 3OGZA 5C4EA 4Y62A 2WE9A 5C8RA 3D5NA 4EVWA 4KQLA 1HM0A 1FZWA 2FFVA 4P00A 3CKJA 4ZDQA 3U2VA 3V0PA 4P02A 4B4BA 1HJLA 2WAWA 4EE5A 2Y4LA 5C48A 5L6VA 2XWNA 4O6MA 2W0WA 2UX8A 3I0JA 1H7EA 4KXOA 3POLA 1TW1A 4KC4A 1H3MA 5FV9A 1H5TA 2ZU8A 1YP2A 1VGTA 1LZJA 1MP4A 1W57A 2D0JA 4B5BA 1VZTA 1ZCTA 4BMAA 1ZDFA 4D0TA 4B4MA 1INIA 1QGSA 4Y7FA 1NWGB 5CQLX 1ZCYA 2PX7A 1TW5A 3CKQA 3SXBA 3V0OA 1YP3A 2V0KA 3V90A 1GQ9A 3V0QA 1OQMB 2PGVA 5L6SA 2O1FA 3TQDA 1ZJPA 1NHEB 1XHBA 3RSBA 3D98A 2V0HA 5DDTA 1FGXA 1H5SB 2P6WA 4EEGA 2E8BA 2RJ4A 1TZFA 2X65A 4FQWA 3I0HA 2OI5A 2V0LA 3QVBA 4GBPA 1GX0A 3USQA 1QWJA 2V0JA 1H7GA 1G1LA 1GWWA 3V8ZA 1FG5N 2RJ6A 1QGQA 5IDSA 3FWWA 3F1CA 2BO6A 2FYAA 3DK5A 4CJ8A 4FRDA 1H7HA 1H7TA 1H5TB 2RJ9A 3TZTA 4J18A 5BXCA 2RIYA 2RJ0A 4HO2A 4DDZA 1ON6A 1VPAA 4UEGA 5CQNX 3N9WA 4ECMA 1OMXA 2A8UA 4MNDA 2D7RA 2AGDA 1G23A 2XWLA 3DJ4A 3U0XA 2VS3A 3V91A 1I52A 2FYCB 1H5RA 1S4OA 3V0MA 2FYDB 3OH4A 4FRAA 2ICYA 4KPXA 4FIYA 2DPWA 5C3DA 2D7IA 2WVLA 1ZJ2A 2YQCA 2Y7AA 4Y63A 1LZ7A 3I0EA 2APCA 2QH5A 5AJPA 4FRQA 1H4EA 2VSIA 4EE4A 4YS8A 4KT7A 5EJZA 4KRVA 3RMWA 1VGWA 1LL3A 4HO6A 1MC3A 5C4FA 2FY7A 1IIMA 2FYBA 2AM5A 3I0FA 1R82A 2I5EA 1V84A 3SX8A 1W55A 1WT1A 5C1GA 5CMIA 4XWIA 2JCOA 4B2XA 3SXGA 2BO7A 1O23B 2RJ7A 4FIXA 4HG6A 2VXMA 2YQSA 2AM3A 3Q80A 3JUKA 4G3PA 3SXAA 2RITA 2XMHA 1G3LA 1R7YA 2JCLA 3OAMA 3I0KA 1GX4A 3T7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW6 A;  4FCU A;  2RIZ A;  1HJJ A;  1R80 A;  2A8W A;  3SX7 A;  4HO9 A;  1ZHJ A;  2I7B A;  1H5R B;  4D0Z A;  3V0L A;  4M28 A;  1FXJ A;  5C36 A;  2VS4 A;  1H5S D;  1NQI B;  2X5Z A;  2Y4J A;  1ZI4 A;  4ASJ A;  2YCM A;  3ST8 A;  3JTJ A;  5FUH A;  1ZCU A;  4D11 C;  3KIA A;  3CKO A;  2AM4 A;  4IRP A;  3Q7U A;  1ZIZ A;  1VH1 A;  2RJ1 A;  2VXL A;  1G8O A;  4LW3 A;  3U2T A;  3U0Y A;  4DE7 A;  2RIX A;  3EE5 A;  4HCQ A;  1FR8 A;  1ZI1 A;  1G0R A;  4LW6 A;  1W77 A;  1R7X A;  3DUV A;  4JIS A;  2QKX A;  4JD0 A;  4AC3 A;  2XME A;  2W0V A;  1XZ6 A;  4Y6U A;  5C1L A;  1LL2 A;  1ZJO A;  1JVG A;  5DDV A;  5IDT A;  4L41 C;  2YQH A;  3U2X A;  2Z87 A;  1VGU A;  3HL3 A;  3OH3 A;  1FR9 A;  3CKN A;  4FRH A;  5EIY A;  5C4B A;  4KC1 A;  4FRB A;  4NAK A;  5C4D A;  1HM8 A;  4EEA A;  2E3D A;  4Y7U A;  1Z90 A;  3OH2 A;  4HOC A;  4G3Q A;  4IRQ A;  1LZI A;  2RJ5 A;  2ZU9 A;  3I0L A;  3F1Y A;  5C4C A;  2AH9 A;  5FU0 A;  3V0N A;  1NMM B;  2VSH A;  2YQJ A;  4HO5 A;  4B42 A;  2JCJ A;  3SXD A;  1R7T A;  5JQQ A;  1G9R A;  3SXC A;  3RMV A;  4Y64 A;  4FRE A;  4M2A A;  5C3A A;  1V82 A;  4D48 A;  2P72 A;  1R81 A;  3OH0 A;  2AEC A;  3OKR A;  1SS9 A;  1LL0 A;  1GA8 A;  4NAN A;  1VH3 A;  2GGQ A;  5CMF X;  4C2S A;  2ICX A;  1IIN A;  1QG8 A;  4M4K A;  3ZGF A;  1FWY A;  2VS5 A;  1S4N A;  1GQC A;  1GWV A;  3V8Y A;  4HO8 A;  1JV1 A;  1PZT A;  1YP4 A;  3OC9 A;  5CMH A;  3USR A;  5CQP A;  4E1K A;  2I5K A;  3CU0 A;  3ZF8 A;  2XWM A;  3PNN A;  2CU2 A;  3I0D A;  1G97 A;  1JVD A;  1FO8 A;  5FTV A;  3ZLL A;  4HO0 A;  5C38 A;  1WVC A;  3SX3 A;  4KNR A;  5EJ1 A;  4HO3 A;  2WVK A;  2OEG A;  2NXV A;  1G2V A;  4D11 A;  4FCE A;  2AE7 A;  4Y7T A;  3IOI A;  3O3P A;  4FRO A;  5C47 A;  4EE3 A;  2OEF A;  1WSZ A;  1MP3 A;  2Y4K A;  1H5S A;  2Y4M A;  4HO4 A;  3ZLK A;  5I1F A;  1LZ0 A;  3U2U A;  4G3S A;  2YES A;  1ZJ3 A;  2WEE A;  1ON8 A;  2Z86 A;  2RJ8 A;  5FTS A;  4FRM A;  5CQM X;  1ZI3 A;  3SX5 A;  4MYB A;  5AJO A;  1VGZ A;  4Y6N A;  1KWS A;  3SXE A;  4CVH A;  5FYE A;  1EYR A;  1JYK A;  1INJ A;  1R7U A;  2O1G A;  1FOA A;  2YC3 A;  5C49 A;  1TVY A;  3T7M A;  2X5S A;  1H5S C;  1H4C A;  2VFZ A;  1H4D A;  1ZCV A;  2VD4 A;  4KPZ A;  1O7O A;  4BQH A;  4EEO A;  4K6R A;  1HV9 A;  2YC5 A;  4FRP A;  4B2W A;  4KC2 A;  2MZB A;  2V0I A;  2JCK A;  1G93 A;  2AES A;  3BRK X;  3CGX A;  4NAI A;  1HM9 A;  4AYL A;  3U2W A;  2X60 A;  3I0G A;  1VIC A;  2Y6P A;  2QGI A;  5CMJ A;  1VM8 A;  2FFU A;  1S4P A;  1FXO A;  1EZI A;  3D8V A;  1H7L A;  3E26 A;  4ARW A;  3BCV A;  3IOJ A;  1H7F A;  5HS2 A;  2P73 A;  4G87 A;  1JYL A;  3K8D A;  4NAL A;  4Y9X A;  1O0R A;  5CMG X;  1YRO B;  1ZI5 A;  2GGO A;  3CKV A;  1K4V A;  3NGW A;  1FGG A;  3Q4S A;  3FOQ A;  4Y7G A;  3T7N A;  2BO4 A;  1R7V A;  3I0C A;  4DEC A;  1VZU A;  2O1H A;  3IOH A;  3GUE A;  4CJB A;  5FU8 A;  3I0I X;  3K8E A;  4R7P A;  1MP5 A;  1ZJ1 A;  3SPT A;  3E25 A;  1OMZ A;  2PA4 A;  2Q4J A;  4EEM A;  1NKH B;  1VZX A;  4FRL A;  1ZDG A;  1ZJ0 A;  4Y7V A;  4AAW A;  2OI7 A;  2WGZ A;  5AJN A;  1WT0 A;  4B4G A;  1O7Q A;  1NF5 B;  1PZY B;  3OH1 A;  4B3U A;  4M2B A;  5CQO A;  4CJC A;  5C3B A;  5J49 A;  1G95 A;  1FO9 A;  2ZU7 A;  1LVW A;  3R3I A;  2PGY A;  4ASY A;  3PKQ A;  1WT2 A;  1WT3 A;  1FRW A;  3JUJ A;  1JV3 A;  3ZGG A;  5C1H A;  2WVM A;  1V83 A;  4AYJ A;  1E5K A;  3R2W A;  4KNX A;  2BO8 A;  3PKP A;  2OI6 A;  1H7Q A;  5IFY A;  3OGZ A;  5C4E A;  4Y62 A;  2WE9 A;  5C8R A;  3D5N A;  4EVW A;  4KQL A;  1HM0 A;  1FZW A;  2FFV A;  4P00 A;  3CKJ A;  4ZDQ A;  3U2V A;  3V0P A;  4P02 A;  4B4B A;  1HJL A;  2WAW A;  4EE5 A;  2Y4L A;  5C48 A;  5L6V A;  2XWN A;  2W0W A;  2UX8 A;  3I0J A;  1H7E A;  4KXO A;  3POL A;  1TW1 A;  4KC4 A;  1H3M A;  5FV9 A;  1H5T A;  2ZU8 A;  1YP2 A;  1VGT A;  1LZJ A;  1MP4 A;  1W57 A;  2D0J A;  4B5B A;  1VZT A;  1ZCT A;  4BMA A;  1ZDF A;  4D0T A;  4B4M A;  1INI A;  1QGS A;  4Y7F A;  1NWG B;  5CQL X;  1ZCY A;  2PX7 A;  1TW5 A;  3CKQ A;  3SXB A;  3V0O A;  1YP3 A;  2V0K A;  3V90 A;  1GQ9 A;  3V0Q A;  1OQM B;  2PGV A;  5L6S A;  2O1F A;  3TQD A;  1ZJP A;  1NHE B;  1XHB A;  3RSB A;  3D98 A;  2V0H A;  5DDT A;  1FGX A;  1H5S B;  2P6W A;  4EEG A;  2E8B A;  2RJ4 A;  1TZF A;  2X65 A;  4FQW A;  3I0H A;  2OI5 A;  2V0L A;  3QVB A;  4GBP A;  1GX0 A;  3USQ A;  1QWJ A;  2V0J A;  1H7G A;  1G1L A;  1GWW A;  3V8Z A;  1FG5 N;  2RJ6 A;  1QGQ A;  5IDS A;  3FWW A;  3F1C A;  2BO6 A;  2FYA A;  3DK5 A;  4CJ8 A;  4FRD A;  1H7H A;  1H7T A;  1H5T B;  2RJ9 A;  3TZT A;  4J18 A;  5BXC A;  2RIY A;  2RJ0 A;  4HO2 A;  4DDZ A;  1ON6 A;  1VPA A;  4UEG A;  5CQN X;  3N9W A;  4ECM A;  1OMX A;  2A8U A;  4MND A;  2D7R A;  2AGD A;  1G23 A;  2XWL A;  3DJ4 A;  3U0X A;  2VS3 A;  3V91 A;  1I52 A;  2FYC B;  1H5R A;  1S4O A;  3V0M A;  2FYD B;  3OH4 A;  4FRA A;  2ICY A;  4KPX A;  5C3D A;  2DPW A;  2D7I A;  2WVL A;  1ZJ2 A;  2YQC A;  2Y7A A;  4Y63 A;  1LZ7 A;  3I0E A;  2APC A;  2QH5 A;  5AJP A;  4FRQ A;  1H4E A;  2VSI A;  4EE4 A;  4YS8 A;  4KT7 A;  5EJZ A;  4KRV A;  3RMW A;  1VGW A;  1LL3 A;  4HO6 A;  1MC3 A;  5C4F A;  2FY7 A;  1IIM A;  2FYB A;  2AM5 A;  3I0F A;  1R82 A;  2I5E A;  1V84 A;  3SX8 A;  1W55 A;  1WT1 A;  5C1G A;  5CMI A;  4XWI A;  2JCO A;  4B2X A;  3SXG A;  2BO7 A;  1O23 B;  2RJ7 A;  4HG6 A;  2VXM A;  2YQS A;  2AM3 A;  3Q80 A;  3JUK A;  4G3P A;  3SXA A;  2RIT A;  2XMH A;  1G3L A;  1R7Y A;  2JCL A;  3OAM A;  3I0K A;  1GX4 A;  3T7O A; 
#chains in the Genus database with same CATH topology
 3LW6 A;  4FCU A;  2RIZ A;  1HJJ A;  1R80 A;  2A8W A;  3SX7 A;  4HO9 A;  1ZHJ A;  2I7B A;  1H5R B;  4D0Z A;  3V0L A;  4M28 A;  1FXJ A;  5C36 A;  2VS4 A;  1H5S D;  1NQI B;  2X5Z A;  2Y4J A;  1ZI4 A;  4ASJ A;  2YCM A;  3ST8 A;  4Q7C A;  3JTJ A;  5FUH A;  1ZCU A;  4D11 C;  3KIA A;  3CKO A;  2AM4 A;  4IRP A;  3Q7U A;  1ZIZ A;  1VH1 A;  2RJ1 A;  2VXL A;  1G8O A;  4LW3 A;  3U2T A;  3U0Y A;  4DE7 A;  2RIX A;  3EE5 A;  5D91 A;  4HCQ A;  1FR8 A;  1ZI1 A;  1G0R A;  4LW6 A;  1W77 A;  1R7X A;  3DUV A;  4JIS A;  2QKX A;  4JD0 A;  4AC3 A;  2XME A;  2W0V A;  1XZ6 A;  4Y6U A;  5D92 A;  5C1L A;  1LL2 A;  1ZJO A;  1JVG A;  5DDV A;  5IDT A;  4L41 C;  2YQH A;  3U2X A;  2Z87 A;  1VGU A;  3HL3 A;  3OH3 A;  1FR9 A;  3CKN A;  4FRH A;  5EIY A;  5C4B A;  4KC1 A;  4FRB A;  4NAK A;  5C4D A;  1HM8 A;  4EEA A;  2E3D A;  4Y7U A;  1Z90 A;  3OH2 A;  4HOC A;  4G3Q A;  4IRQ A;  1LZI A;  2RJ5 A;  2ZU9 A;  3I0L A;  3F1Y A;  5C4C A;  2AH9 A;  5FU0 A;  3V0N A;  1NMM B;  2VSH A;  2YQJ A;  4HO5 A;  4B42 A;  2JCJ A;  3SXD A;  1R7T A;  5JQQ A;  1G9R A;  3SXC A;  3RMV A;  4Y64 A;  4FRE A;  4M2A A;  5C3A A;  1V82 A;  4D48 A;  2P72 A;  1R81 A;  3OH0 A;  2AEC A;  3OKR A;  1SS9 A;  1LL0 A;  2C0N A;  1GA8 A;  4NAN A;  1VH3 A;  2GGQ A;  5CMF X;  4C2S A;  2ICX A;  1IIN A;  1QG8 A;  4M4K A;  3ZGF A;  4MIX A;  1FWY A;  2VS5 A;  1S4N A;  1GQC A;  1GWV A;  3V8Y A;  4HO8 A;  1JV1 A;  1PZT A;  1YP4 A;  3OC9 A;  5CMH A;  3USR A;  5CQP A;  4E1K A;  2I5K A;  3CU0 A;  3ZF8 A;  2XWM A;  3PNN A;  2CU2 A;  3I0D A;  1G97 A;  1JVD A;  1FO8 A;  5FTV A;  3ZLL A;  4HO0 A;  5C38 A;  1WVC A;  3SX3 A;  4KNR A;  5EJ1 A;  4HO3 A;  2WVK A;  2OEG A;  2NXV A;  1G2V A;  4D11 A;  4FCE A;  2AE7 A;  4Y7T A;  3IOI A;  3O3P A;  4FRO A;  5C47 A;  4EE3 A;  2OEF A;  1WSZ A;  1MP3 A;  2Y4K A;  1H5S A;  2Y4M A;  4HO4 A;  3ZLK A;  5I1F A;  1LZ0 A;  3U2U A;  4G3S A;  2YES A;  1ZJ3 A;  2WEE A;  1ON8 A;  2Z86 A;  2RJ8 A;  5FTS A;  4FRM A;  5CQM X;  1ZI3 A;  3SX5 A;  4MYB A;  5AJO A;  1VGZ A;  4Y6N A;  1KWS A;  3SXE A;  4CVH A;  5FYE A;  1EYR A;  1JYK A;  1INJ A;  1R7U A;  2O1G A;  1FOA A;  2YC3 A;  5C49 A;  1TVY A;  3T7M A;  2X5S A;  1H5S C;  1H4C A;  2VFZ A;  1H4D A;  1ZCV A;  2VD4 A;  4KPZ A;  1O7O A;  4BQH A;  4EEO A;  4K6R A;  1HV9 A;  2YC5 A;  4FRP A;  4B2W A;  4KC2 A;  2MZB A;  2V0I A;  2JCK A;  1G93 A;  2AES A;  3BRK X;  3CGX A;  4NAI A;  1HM9 A;  4AYL A;  2J0B A;  3U2W A;  2X60 A;  3I0G A;  1VIC A;  2Y6P A;  2QGI A;  5CMJ A;  1VM8 A;  2FFU A;  1S4P A;  1FXO A;  1EZI A;  3D8V A;  1H7L A;  3E26 A;  4ARW A;  3BCV A;  3IOJ A;  1H7F A;  5HS2 A;  2P73 A;  4G87 A;  1JYL A;  3K8D A;  4NAL A;  4Y9X A;  1O0R A;  5CMG X;  1YRO B;  1ZI5 A;  2GGO A;  3CKV A;  1K4V A;  3NGW A;  1FGG A;  3Q4S A;  3FOQ A;  4Y7G A;  3T7N A;  2BO4 A;  1R7V A;  3I0C A;  4DEC A;  1VZU A;  2O1H A;  3IOH A;  3GUE A;  4CJB A;  5FU8 A;  3I0I X;  3K8E A;  4R7P A;  1MP5 A;  1ZJ1 A;  3SPT A;  3E25 A;  4O6N A;  1OMZ A;  2PA4 A;  2Q4J A;  4EEM A;  1NKH B;  1VZX A;  4FRL A;  1ZDG A;  1ZJ0 A;  4Y7V A;  4AAW A;  2OI7 A;  2WGZ A;  5AJN A;  1WT0 A;  4B4G A;  1O7Q A;  1NF5 B;  1PZY B;  3OH1 A;  4B3U A;  4M2B A;  5CQO A;  4CJC A;  5C3B A;  5J49 A;  1G95 A;  1FO9 A;  2ZU7 A;  1LVW A;  3R3I A;  2PGY A;  4ASY A;  3PKQ A;  1WT2 A;  1WT3 A;  1FRW A;  3JUJ A;  1JV3 A;  3ZGG A;  5C1H A;  2WVM A;  1V83 A;  4AYJ A;  1E5K A;  3R2W A;  4KNX A;  2BO8 A;  3PKP A;  2OI6 A;  1H7Q A;  2J0A A;  2VK9 A;  5IFY A;  3OGZ A;  5C4E A;  4Y62 A;  2WE9 A;  5C8R A;  3D5N A;  4EVW A;  4KQL A;  1HM0 A;  1FZW A;  2FFV A;  4P00 A;  3CKJ A;  4ZDQ A;  3U2V A;  3V0P A;  4P02 A;  4B4B A;  1HJL A;  2WAW A;  4EE5 A;  2Y4L A;  5C48 A;  5L6V A;  2XWN A;  4O6M A;  2W0W A;  2UX8 A;  3I0J A;  1H7E A;  4KXO A;  3POL A;  1TW1 A;  4KC4 A;  1H3M A;  5FV9 A;  1H5T A;  2ZU8 A;  1YP2 A;  1VGT A;  1LZJ A;  1MP4 A;  1W57 A;  2D0J A;  4B5B A;  1VZT A;  1ZCT A;  4BMA A;  1ZDF A;  4D0T A;  4B4M A;  1INI A;  1QGS A;  4Y7F A;  1NWG B;  5CQL X;  1ZCY A;  2PX7 A;  1TW5 A;  3CKQ A;  3SXB A;  3V0O A;  1YP3 A;  2V0K A;  3V90 A;  1GQ9 A;  3V0Q A;  1OQM B;  2PGV A;  5L6S A;  2O1F A;  3TQD A;  1ZJP A;  1NHE B;  1XHB A;  3RSB A;  3D98 A;  2V0H A;  5DDT A;  1FGX A;  1H5S B;  2P6W A;  4EEG A;  2E8B A;  2RJ4 A;  1TZF A;  2X65 A;  4FQW A;  3I0H A;  2OI5 A;  2V0L A;  3QVB A;  4GBP A;  1GX0 A;  3USQ A;  1QWJ A;  2V0J A;  1H7G A;  1G1L A;  1GWW A;  3V8Z A;  1FG5 N;  2RJ6 A;  1QGQ A;  5IDS A;  3FWW A;  3F1C A;  2BO6 A;  2FYA A;  3DK5 A;  4CJ8 A;  4FRD A;  1H7H A;  1H7T A;  1H5T B;  2RJ9 A;  3TZT A;  4J18 A;  5BXC A;  2RIY A;  2RJ0 A;  4HO2 A;  4DDZ A;  1ON6 A;  1VPA A;  4UEG A;  5CQN X;  3N9W A;  4ECM A;  1OMX A;  2A8U A;  4MND A;  2D7R A;  2AGD A;  1G23 A;  2XWL A;  3DJ4 A;  3U0X A;  2VS3 A;  3V91 A;  1I52 A;  2FYC B;  1H5R A;  1S4O A;  3V0M A;  2FYD B;  3OH4 A;  4FRA A;  2ICY A;  4KPX A;  4FIY A;  2DPW A;  5C3D A;  2D7I A;  2WVL A;  1ZJ2 A;  2YQC A;  2Y7A A;  4Y63 A;  1LZ7 A;  3I0E A;  2APC A;  2QH5 A;  5AJP A;  4FRQ A;  1H4E A;  2VSI A;  4EE4 A;  4YS8 A;  4KT7 A;  5EJZ A;  4KRV A;  3RMW A;  1VGW A;  1LL3 A;  4HO6 A;  1MC3 A;  5C4F A;  2FY7 A;  1IIM A;  2FYB A;  2AM5 A;  3I0F A;  1R82 A;  2I5E A;  1V84 A;  3SX8 A;  1W55 A;  1WT1 A;  5C1G A;  5CMI A;  4XWI A;  2JCO A;  4B2X A;  3SXG A;  2BO7 A;  1O23 B;  2RJ7 A;  4FIX A;  4HG6 A;  2VXM A;  2YQS A;  2AM3 A;  3Q80 A;  3JUK A;  4G3P A;  3SXA A;  2RIT A;  2XMH A;  1G3L A;  1R7Y A;  2JCL A;  3OAM A;  3I0K A;  1GX4 A;  3T7O A; 
#chains in the Genus database with same CATH homology
 3LW6 A;  4FCU A;  2RIZ A;  1HJJ A;  1R80 A;  2A8W A;  3SX7 A;  4HO9 A;  1ZHJ A;  2I7B A;  1H5R B;  4D0Z A;  3V0L A;  4M28 A;  1FXJ A;  5C36 A;  2VS4 A;  1H5S D;  1NQI B;  2X5Z A;  2Y4J A;  1ZI4 A;  4ASJ A;  2YCM A;  3ST8 A;  4Q7C A;  3JTJ A;  5FUH A;  1ZCU A;  4D11 C;  3KIA A;  3CKO A;  2AM4 A;  4IRP A;  3Q7U A;  1ZIZ A;  1VH1 A;  2RJ1 A;  2VXL A;  1G8O A;  4LW3 A;  3U2T A;  3U0Y A;  4DE7 A;  2RIX A;  3EE5 A;  5D91 A;  4HCQ A;  1FR8 A;  1ZI1 A;  1G0R A;  4LW6 A;  1W77 A;  1R7X A;  3DUV A;  4JIS A;  2QKX A;  4JD0 A;  4AC3 A;  2XME A;  2W0V A;  1XZ6 A;  4Y6U A;  5D92 A;  5C1L A;  1LL2 A;  1ZJO A;  1JVG A;  5DDV A;  5IDT A;  4L41 C;  2YQH A;  3U2X A;  2Z87 A;  1VGU A;  3HL3 A;  3OH3 A;  1FR9 A;  3CKN A;  4FRH A;  5EIY A;  5C4B A;  4KC1 A;  4FRB A;  4NAK A;  5C4D A;  1HM8 A;  4EEA A;  2E3D A;  4Y7U A;  1Z90 A;  3OH2 A;  4HOC A;  4G3Q A;  4IRQ A;  1LZI A;  2RJ5 A;  2ZU9 A;  3I0L A;  3F1Y A;  5C4C A;  2AH9 A;  5FU0 A;  3V0N A;  1NMM B;  2VSH A;  2YQJ A;  4HO5 A;  4B42 A;  2JCJ A;  3SXD A;  1R7T A;  5JQQ A;  1G9R A;  3SXC A;  3RMV A;  4Y64 A;  4FRE A;  4M2A A;  5C3A A;  1V82 A;  4D48 A;  2P72 A;  1R81 A;  3OH0 A;  2AEC A;  3OKR A;  1SS9 A;  1LL0 A;  2C0N A;  1GA8 A;  4NAN A;  1VH3 A;  2GGQ A;  5CMF X;  4C2S A;  2ICX A;  1IIN A;  1QG8 A;  4M4K A;  3ZGF A;  4MIX A;  1FWY A;  2VS5 A;  1S4N A;  1GQC A;  1GWV A;  3V8Y A;  4HO8 A;  1JV1 A;  1PZT A;  1YP4 A;  3OC9 A;  5CMH A;  3USR A;  5CQP A;  4E1K A;  2I5K A;  3CU0 A;  3ZF8 A;  2XWM A;  3PNN A;  2CU2 A;  3I0D A;  1G97 A;  1JVD A;  1FO8 A;  5FTV A;  3ZLL A;  4HO0 A;  5C38 A;  1WVC A;  3SX3 A;  4KNR A;  5EJ1 A;  4HO3 A;  2WVK A;  2OEG A;  2NXV A;  1G2V A;  4D11 A;  4FCE A;  2AE7 A;  4Y7T A;  3IOI A;  3O3P A;  4FRO A;  5C47 A;  4EE3 A;  2OEF A;  1WSZ A;  1MP3 A;  2Y4K A;  1H5S A;  2Y4M A;  4HO4 A;  3ZLK A;  5I1F A;  1LZ0 A;  3U2U A;  4G3S A;  2YES A;  1ZJ3 A;  2WEE A;  1ON8 A;  2Z86 A;  2RJ8 A;  5FTS A;  4FRM A;  5CQM X;  1ZI3 A;  3SX5 A;  4MYB A;  5AJO A;  1VGZ A;  4Y6N A;  1KWS A;  3SXE A;  4CVH A;  5FYE A;  1EYR A;  1JYK A;  1INJ A;  1R7U A;  2O1G A;  1FOA A;  2YC3 A;  5C49 A;  1TVY A;  3T7M A;  2X5S A;  1H5S C;  1H4C A;  2VFZ A;  1H4D A;  1ZCV A;  2VD4 A;  4KPZ A;  1O7O A;  4BQH A;  4EEO A;  4K6R A;  1HV9 A;  2YC5 A;  4FRP A;  4B2W A;  4KC2 A;  2MZB A;  2V0I A;  2JCK A;  1G93 A;  2AES A;  3BRK X;  3CGX A;  4NAI A;  1HM9 A;  4AYL A;  2J0B A;  3U2W A;  2X60 A;  3I0G A;  1VIC A;  2Y6P A;  2QGI A;  5CMJ A;  1VM8 A;  2FFU A;  1S4P A;  1FXO A;  1EZI A;  3D8V A;  1H7L A;  3E26 A;  4ARW A;  3BCV A;  3IOJ A;  1H7F A;  5HS2 A;  2P73 A;  4G87 A;  1JYL A;  3K8D A;  4NAL A;  4Y9X A;  1O0R A;  5CMG X;  1YRO B;  1ZI5 A;  2GGO A;  3CKV A;  1K4V A;  3NGW A;  1FGG A;  3Q4S A;  3FOQ A;  4Y7G A;  3T7N A;  2BO4 A;  1R7V A;  3I0C A;  4DEC A;  1VZU A;  2O1H A;  3IOH A;  3GUE A;  4CJB A;  5FU8 A;  3I0I X;  3K8E A;  4R7P A;  1MP5 A;  1ZJ1 A;  3SPT A;  3E25 A;  4O6N A;  1OMZ A;  2PA4 A;  2Q4J A;  4EEM A;  1NKH B;  1VZX A;  4FRL A;  1ZDG A;  1ZJ0 A;  4Y7V A;  4AAW A;  2OI7 A;  2WGZ A;  5AJN A;  1WT0 A;  4B4G A;  1O7Q A;  1NF5 B;  1PZY B;  3OH1 A;  4B3U A;  4M2B A;  5CQO A;  4CJC A;  5C3B A;  5J49 A;  1G95 A;  1FO9 A;  2ZU7 A;  1LVW A;  3R3I A;  2PGY A;  4ASY A;  3PKQ A;  1WT2 A;  1WT3 A;  1FRW A;  3JUJ A;  1JV3 A;  3ZGG A;  5C1H A;  2WVM A;  1V83 A;  4AYJ A;  1E5K A;  3R2W A;  4KNX A;  2BO8 A;  3PKP A;  2OI6 A;  1H7Q A;  2J0A A;  2VK9 A;  5IFY A;  3OGZ A;  5C4E A;  4Y62 A;  2WE9 A;  5C8R A;  3D5N A;  4EVW A;  4KQL A;  1HM0 A;  1FZW A;  2FFV A;  4P00 A;  3CKJ A;  4ZDQ A;  3U2V A;  3V0P A;  4P02 A;  4B4B A;  1HJL A;  2WAW A;  4EE5 A;  2Y4L A;  5C48 A;  5L6V A;  2XWN A;  4O6M A;  2W0W A;  2UX8 A;  3I0J A;  1H7E A;  4KXO A;  3POL A;  1TW1 A;  4KC4 A;  1H3M A;  5FV9 A;  1H5T A;  2ZU8 A;  1YP2 A;  1VGT A;  1LZJ A;  1MP4 A;  1W57 A;  2D0J A;  4B5B A;  1VZT A;  1ZCT A;  4BMA A;  1ZDF A;  4D0T A;  4B4M A;  1INI A;  1QGS A;  4Y7F A;  1NWG B;  5CQL X;  1ZCY A;  2PX7 A;  1TW5 A;  3CKQ A;  3SXB A;  3V0O A;  1YP3 A;  2V0K A;  3V90 A;  1GQ9 A;  3V0Q A;  1OQM B;  2PGV A;  5L6S A;  2O1F A;  3TQD A;  1ZJP A;  1NHE B;  1XHB A;  3RSB A;  3D98 A;  2V0H A;  5DDT A;  1FGX A;  1H5S B;  2P6W A;  4EEG A;  2E8B A;  2RJ4 A;  1TZF A;  2X65 A;  4FQW A;  3I0H A;  2OI5 A;  2V0L A;  3QVB A;  4GBP A;  1GX0 A;  3USQ A;  1QWJ A;  2V0J A;  1H7G A;  1G1L A;  1GWW A;  3V8Z A;  1FG5 N;  2RJ6 A;  1QGQ A;  5IDS A;  3FWW A;  3F1C A;  2BO6 A;  2FYA A;  3DK5 A;  4CJ8 A;  4FRD A;  1H7H A;  1H7T A;  1H5T B;  2RJ9 A;  3TZT A;  4J18 A;  5BXC A;  2RIY A;  2RJ0 A;  4HO2 A;  4DDZ A;  1ON6 A;  1VPA A;  4UEG A;  5CQN X;  3N9W A;  4ECM A;  1OMX A;  2A8U A;  4MND A;  2D7R A;  2AGD A;  1G23 A;  2XWL A;  3DJ4 A;  3U0X A;  2VS3 A;  3V91 A;  1I52 A;  2FYC B;  1H5R A;  1S4O A;  3V0M A;  2FYD B;  3OH4 A;  4FRA A;  2ICY A;  4KPX A;  4FIY A;  2DPW A;  5C3D A;  2D7I A;  2WVL A;  1ZJ2 A;  2YQC A;  2Y7A A;  4Y63 A;  1LZ7 A;  3I0E A;  2APC A;  2QH5 A;  5AJP A;  4FRQ A;  1H4E A;  2VSI A;  4EE4 A;  4YS8 A;  4KT7 A;  5EJZ A;  4KRV A;  3RMW A;  1VGW A;  1LL3 A;  4HO6 A;  1MC3 A;  5C4F A;  2FY7 A;  1IIM A;  2FYB A;  2AM5 A;  3I0F A;  1R82 A;  2I5E A;  1V84 A;  3SX8 A;  1W55 A;  1WT1 A;  5C1G A;  5CMI A;  4XWI A;  2JCO A;  4B2X A;  3SXG A;  2BO7 A;  1O23 B;  2RJ7 A;  4FIX A;  4HG6 A;  2VXM A;  2YQS A;  2AM3 A;  3Q80 A;  3JUK A;  4G3P A;  3SXA A;  2RIT A;  2XMH A;  1G3L A;  1R7Y A;  2JCL A;  3OAM A;  3I0K A;  1GX4 A;  3T7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...