1FR9A

Structure of e. coli moba
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
191
structure length
185
Chain Sequence
NLMTTITGVVLAGGKVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS PROTEIN
publication title The crystal structure of the Escherichia coli MobA protein provides insight into molybdopterin guanine dinucleotide biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 185
sequence length 191
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fr9A00
1Z90A 1QG8A 5C3DA 4BMAA 2V0JA 2Y6PA 4Y9XA 2AE7A 5C3BA 3SXBA 1WT0A 5CMGX 1JV1A 1FGGA 2A8UA 2FFUA 1VZUA 1WT2A 2I7BA 2V0LA 4Y63A 4NAKA 2D7RA 2ZU9A 1INIA 5IFYA 1G97A 2I5KA 1TW1A 1GX4A 4FRBA 4M2BA 5EJ1A 4DDZA 2BO4A 3GUEA 2VSHA 2W0WA 1H5RB 1YP2A 3Q80A 2YESA 3BCVA 4D0ZA 3IOIA 1G8OA 1XHBA 2V0KA 3R2WA 5AJNA 5FUHA 1MP5A 1FO8A 1H5SD 1YP4A 3USRA 3I0DA 4Y64A 4B3UA 1VH3A 2RIXA 2QGIA 2RJ7A 2GGQA 2PA4A 4HO2A 4EEAA 5FTVA 1H7QA 1WVCA 1H5SB 4JISA 2XWNA 2YCMA 1FG5N 3IOHA 3U0XA 3SPTA 4FREA 2VSIA 2XMHA 3K8EA 3K8DA 4XWIA 2X5SA 2OEFA 1ZCTA 4Y6UA 3FWWA 2JCJA 4FCEA 4FRDA 4KT7A 2GGOA 4MNDA 4K6RA 3SXEA 3I0EA 1ZDGA 4UEGA 4EE3A 4EEMA 1INJA 3CKOA 3SX7A 3USQA 1R80A 2VD4A 3OGZA 5C1HA 3SX5A 5CQPA 1JV3A 1VGWA 4G87A 2W0VA 3V0PA 3ZLLA 3DJ4A 2PGYA 1LL0A 1FR9A 1TVYA 2I5EA 3RMWA 4B4BA 2OI7A 1VH1A 3V91A 1H5TA 1R7YA 1IINA 3V0OA 4HO4A 4J18A 1G0RA 1FGXA 2AESA 1ZI4A 2VXLA 3PKQA 1H7TA 1H4DA 3OAMA 3OH1A 1H4EA 2DPWA 1YROB 1WT1A 4B5BA 1S4OA 2X5ZA 5FU8A 2NXVA 2P72A 1QWJA 4HOCA 3RSBA 2XMEA 2V0HA 2Y7AA 4NAIA 1KWSA 2XWLA 2VS4A 1OMXA 5FU0A 3CKNA 1FRWA 5J49A 4FROA 1H5RA 2BO7A 4Y7UA 1LZJA 4KXOA 1G9RA 2AECA 1ZJ0A 3I0LA 1FO9A 1R81A 2E8BA 1H5SC 4AYLA 3Q4SA 3I0IX 3O3PA 4KNRA 4AAWA 5CMJA 2YQSA 5IDTA 2VS3A 4HO6A 3I0FA 3OH0A 5C36A 2YQCA 3U2UA 2D7IA 1S4PA 3OH2A 3T7NA 1NHEB 5CQNX 1FXOA 2JCOA 3V0MA 2CU2A 3QVBA 1ZJ1A 1W77A 3LW6A 3Q7UA 4GBPA 4ZDQA 1VZTA 1H7FA 1LZIA 4KQLA 1ZJPA 1HM0A 3CKJA 4Y62A 4FQWA 4ARWA 3TQDA 3RMVA 4LW3A 2PGVA 3PNNA 4CJCA 3E25A 4IRPA 2FYDB 1LL2A 2FFVA 2WAWA 1I52A 4HO5A 4C2SA 2O1FA 1H7LA 2P6WA 3SXCA 3ZLKA 3OH4A 5C48A 3E26A 4EVWA 1GWWA 5CQOA 1VGUA 2RJ9A 2WVMA 2RJ5A 2RJ4A 4HG6A 5C3AA 1QGQA 4Y7VA 2RITA 5HS2A 2BO6A 4MYBA 3CGXA 3SXDA 4D48A 1FOAA 2Z86A 4KC1A 5C8RA 3ZGFA 1ZI1A 3U2TA 1WT3A 2YQJA 2PX7A 1H7GA 3PKPA 4D11C 2E3DA 1IIMA 5CMIA 3NGWA 5C4DA 2X65A 3POLA 3V8YA 1VICA 1ZHJA 4D11A 1YP3A 3T7OA 1NMMB 3CU0A 4AC3A 1VZXA 4EEOA 5IDSA 4LW6A 3D98A 5I1FA 1LL3A 1NQIB 4L41C 1OMZA 2OI5A 3JUKA 4M28A 3CKVA 1FWYA 1O0RA 3BRKX 2ICYA 1V84A 3V90A 3U2WA 1PZTA 3OKRA 4KPXA 2ZU7A 3DK5A 5DDVA 1H7EA 2VXMA 4HO3A 1S4NA 1LVWA 2XWMA 2Y4LA 1FR8A 4ASYA 1EZIA 3KIAA 3F1YA 5EIYA 3T7MA 1V83A 1FZWA 3F1CA 2WVLA 1FXJA 3D5NA 1HJLA 2RJ6A 4NALA 4Y7TA 2JCKA 1ZI5A 2WE9A 1VGTA 4YS8A 1HM9A 4HCQA 4CVHA 3N9WA 1JYLA 3SX8A 5C4CA 5EJZA 2P73A 5L6SA 1H5TB 5C38A 4CJ8A 1EYRA 3I0CA 1GQ9A 1GQCA 3JUJA 1NF5B 2ZU8A 1H4CA 4DECA 4B2WA 4G3PA 1QGSA 3OC9A 1K4VA 1ZI3A 2V0IA 1G23A 2RIYA 1H7HA 4EEGA 3IOJA 4ASJA 1MC3A 2OEGA 1SS9A 1H5SA 1ZCVA 3D8VA 4FRLA 5CQLX 5C47A 3I0HA 4KC4A 2JCLA 4Y6NA 5AJPA 5C1LA 1H3MA 3OH3A 1ZJOA 4FRMA 4HO9A 2FYBA 4B4MA 2VFZA 4CJBA 1R7TA 2Q4JA 1R7UA 3I0GA 1G2VA 1W57A 2RJ0A 1R7XA 1MP4A 3CKQA 1HV9A 3SXAA 1G1LA 1LZ0A 2FY7A 1E5KA 3TZTA 3R3IA 4B42A 5JQQA 4FRPA 2YC5A 3I0JA 2YC3A 1MP3A 5FYEA 2QH5A 2RIZA 3JTJA 4BQHA 1O7OA 1XZ6A 1ON8A 4B2XA 2OI6A 3V0LA 1V82A 1ZJ3A 4Y7GA 2VS5A 1G95A 4M2AA 2AH9A 4B4GA 1JVGA 1ZIZA 5CQMX 2O1HA 1JYKA 2QKXA 3ZF8A 3V8ZA 1O7QA 2Y4MA 4M4KA 5C4FA 1JVDA 1VPAA 4EE4A 4FRHA 3SXGA 1OQMB 1VM8A 5CMFX 5AJOA 5BXCA 2Y4KA 3SX3A 4G3QA 4DE7A 1NKHB 2AM4A 3V0NA 1R82A 1WSZA 3I0KA 4G3SA 4JD0A 1GX0A 2FYCB 2BO8A 2AGDA 5C4BA 2WEEA 2ICXA 3DUVA 4EE5A 3ST8A 2APCA 3EE5A 4FCUA 5C4EA 1PZYB 3ZGGA 1ZCYA 4Y7FA 5L6VA 2O1GA 2MZBA 3U2XA 4IRQA 4KPZA 4KC2A 1R7VA 1ZCUA 3V0QA 4FRQA 1GWVA 2Z87A 1VGZA 4P02A 4AYJA 1ON6A 2X60A 4P00A 2UX8A 1ZJ2A 5FTSA 1ZDFA 2RJ1A 1HJJA 4R7PA 1LZ7A 4HO8A 1TZFA 1W55A 1HM8A 5C1GA 5DDTA 4NANA 4D0TA 2WGZA 3U0YA 4ECMA 1O23B 5CMHA 1TW5A 2RJ8A 2YQHA 1GA8A 3FOQA 3HL3A 5FV9A 4HO0A 2WVKA 2AM5A 1G3LA 1NWGB 2Y4JA 4FRAA 5C49A 1G93A 2A8WA 4KNXA 3U2VA 4E1KA 2D0JA 2FYAA 4KRVA 2AM3A
chains in the Genus database with same CATH superfamily
1Z90A 1QG8A 5C3DA 4BMAA 2V0JA 4FIYA 2Y6PA 4Y9XA 2AE7A 5C3BA 3SXBA 1WT0A 5CMGX 1JV1A 1FGGA 2A8UA 2FFUA 1VZUA 1WT2A 2I7BA 2V0LA 4Y63A 4NAKA 2D7RA 2ZU9A 1INIA 5IFYA 1G97A 2I5KA 1TW1A 1GX4A 4FRBA 4M2BA 5EJ1A 4DDZA 2BO4A 3GUEA 2VSHA 2W0WA 1H5RB 1YP2A 3Q80A 2YESA 3BCVA 4D0ZA 3IOIA 1G8OA 1XHBA 2V0KA 3R2WA 5AJNA 5FUHA 1MP5A 1FO8A 1H5SD 1YP4A 3USRA 3I0DA 4Y64A 4B3UA 1VH3A 2RIXA 2QGIA 2RJ7A 2GGQA 2PA4A 4HO2A 4EEAA 5FTVA 1H7QA 1WVCA 1H5SB 4JISA 2XWNA 2YCMA 1FG5N 3IOHA 3U0XA 3SPTA 4FREA 2VSIA 2XMHA 3K8EA 3K8DA 4XWIA 2X5SA 2OEFA 1ZCTA 4Y6UA 3FWWA 2JCJA 4FCEA 4FRDA 4KT7A 2GGOA 2J0AA 4MNDA 4K6RA 3SXEA 3I0EA 1ZDGA 4UEGA 4EE3A 4EEMA 1INJA 3CKOA 3SX7A 3USQA 1R80A 2VD4A 3OGZA 5C1HA 3SX5A 5CQPA 1JV3A 1VGWA 4G87A 2W0VA 3V0PA 3ZLLA 3DJ4A 2PGYA 1LL0A 1FR9A 1TVYA 2I5EA 3RMWA 4B4BA 2OI7A 1VH1A 3V91A 1H5TA 1R7YA 1IINA 3V0OA 4HO4A 4J18A 1G0RA 1FGXA 2AESA 1ZI4A 2VXLA 4O6NA 3PKQA 1H7TA 1H4DA 3OAMA 3OH1A 1H4EA 2DPWA 1YROB 2C0NA 1WT1A 4B5BA 1S4OA 2X5ZA 5FU8A 2NXVA 2P72A 1QWJA 4HOCA 3RSBA 2XMEA 2V0HA 2Y7AA 4NAIA 1KWSA 2XWLA 2VS4A 1OMXA 5FU0A 3CKNA 1FRWA 5D91A 5J49A 4FROA 1H5RA 2BO7A 4Y7UA 1LZJA 4KXOA 1G9RA 2AECA 1ZJ0A 3I0LA 1FO9A 1R81A 2E8BA 1H5SC 4AYLA 3Q4SA 3I0IX 3O3PA 4KNRA 4AAWA 5CMJA 2YQSA 5IDTA 2VS3A 4HO6A 4Q7CA 3I0FA 3OH0A 5C36A 2YQCA 3U2UA 2D7IA 1S4PA 3OH2A 3T7NA 1NHEB 5CQNX 1FXOA 2JCOA 3V0MA 2CU2A 3QVBA 1ZJ1A 1W77A 3LW6A 3Q7UA 4GBPA 4ZDQA 1VZTA 1H7FA 1LZIA 4KQLA 1ZJPA 1HM0A 3CKJA 4Y62A 4FQWA 4ARWA 3TQDA 3RMVA 4LW3A 2PGVA 3PNNA 4CJCA 3E25A 4IRPA 2FYDB 1LL2A 2FFVA 2WAWA 1I52A 4HO5A 4C2SA 2O1FA 1H7LA 2P6WA 3SXCA 3ZLKA 3OH4A 5C48A 3E26A 4EVWA 1GWWA 5CQOA 1VGUA 2RJ9A 2WVMA 2RJ5A 2RJ4A 4HG6A 5C3AA 1QGQA 4Y7VA 2RITA 5HS2A 2BO6A 4MYBA 3CGXA 3SXDA 4D48A 1FOAA 2Z86A 4KC1A 5C8RA 3ZGFA 1ZI1A 3U2TA 1WT3A 2YQJA 2PX7A 1H7GA 3PKPA 4D11C 2E3DA 1IIMA 5CMIA 3NGWA 5C4DA 2X65A 3POLA 4MIXA 3V8YA 1VICA 1ZHJA 4D11A 1YP3A 3T7OA 1NMMB 3CU0A 2VK9A 4AC3A 1VZXA 4EEOA 5IDSA 4LW6A 3D98A 5I1FA 1LL3A 1NQIB 4L41C 1OMZA 2OI5A 3JUKA 4M28A 3CKVA 5D92A 1FWYA 1O0RA 3BRKX 2ICYA 1V84A 3V90A 3U2WA 1PZTA 3OKRA 4KPXA 2ZU7A 3DK5A 5DDVA 1H7EA 2VXMA 4HO3A 1S4NA 1LVWA 2XWMA 2Y4LA 1FR8A 4ASYA 1EZIA 3KIAA 3F1YA 5EIYA 3T7MA 1V83A 1FZWA 3F1CA 2WVLA 1FXJA 3D5NA 1HJLA 2RJ6A 4NALA 4Y7TA 2JCKA 1ZI5A 2WE9A 1VGTA 4YS8A 1HM9A 4HCQA 4CVHA 3N9WA 1JYLA 3SX8A 5C4CA 5EJZA 2P73A 5L6SA 1H5TB 5C38A 4CJ8A 1EYRA 3I0CA 1GQ9A 1GQCA 3JUJA 1NF5B 2ZU8A 1H4CA 4DECA 4B2WA 2J0BA 4G3PA 1QGSA 3OC9A 1K4VA 1ZI3A 2V0IA 1G23A 2RIYA 1H7HA 4EEGA 3IOJA 4ASJA 1MC3A 2OEGA 1SS9A 1H5SA 1ZCVA 3D8VA 4FRLA 5CQLX 5C47A 3I0HA 4KC4A 2JCLA 4Y6NA 5AJPA 5C1LA 1H3MA 3OH3A 1ZJOA 4FRMA 4HO9A 2FYBA 4B4MA 2VFZA 4CJBA 1R7TA 2Q4JA 1R7UA 3I0GA 1G2VA 1W57A 2RJ0A 1R7XA 1MP4A 3CKQA 1HV9A 3SXAA 1G1LA 1LZ0A 2FY7A 1E5KA 3TZTA 3R3IA 4B42A 5JQQA 4FRPA 2YC5A 3I0JA 2YC3A 1MP3A 5FYEA 2QH5A 2RIZA 3JTJA 4BQHA 1O7OA 1XZ6A 1ON8A 4B2XA 2OI6A 3V0LA 1V82A 1ZJ3A 4Y7GA 2VS5A 1G95A 4M2AA 2AH9A 4B4GA 1JVGA 1ZIZA 5CQMX 2O1HA 1JYKA 2QKXA 3ZF8A 3V8ZA 1O7QA 2Y4MA 4M4KA 5C4FA 1JVDA 1VPAA 4EE4A 4FRHA 3SXGA 1OQMB 1VM8A 5CMFX 5AJOA 5BXCA 2Y4KA 3SX3A 4G3QA 4DE7A 1NKHB 2AM4A 3V0NA 1R82A 4FIXA 1WSZA 3I0KA 4G3SA 4JD0A 1GX0A 2FYCB 2BO8A 2AGDA 5C4BA 2WEEA 2ICXA 3DUVA 4EE5A 3ST8A 2APCA 3EE5A 4FCUA 5C4EA 1PZYB 3ZGGA 1ZCYA 4Y7FA 5L6VA 2O1GA 2MZBA 3U2XA 4IRQA 4KPZA 4KC2A 1R7VA 1ZCUA 3V0QA 4FRQA 1GWVA 2Z87A 1VGZA 4P02A 4AYJA 1ON6A 2X60A 4P00A 2UX8A 1ZJ2A 5FTSA 1ZDFA 2RJ1A 1HJJA 4R7PA 1LZ7A 4HO8A 1TZFA 1W55A 1HM8A 5C1GA 5DDTA 4NANA 4D0TA 2WGZA 3U0YA 4ECMA 1O23B 5CMHA 1TW5A 2RJ8A 2YQHA 1GA8A 3FOQA 3HL3A 5FV9A 4HO0A 2WVKA 2AM5A 1G3LA 1NWGB 2Y4JA 4FRAA 4O6MA 5C49A 1G93A 2A8WA 4KNXA 3U2VA 4E1KA 2D0JA 2FYAA 4KRVA 2AM3A
chains in the Genus database with same CATH topology
1Z90A 1QG8A 5C3DA 4BMAA 2V0JA 4FIYA 2Y6PA 4Y9XA 2AE7A 5C3BA 3SXBA 1WT0A 5CMGX 1JV1A 1FGGA 2A8UA 2FFUA 1VZUA 1WT2A 2I7BA 2V0LA 4Y63A 4NAKA 2D7RA 2ZU9A 1INIA 5IFYA 1G97A 2I5KA 1TW1A 1GX4A 4FRBA 4M2BA 5EJ1A 4DDZA 2BO4A 3GUEA 2VSHA 2W0WA 1H5RB 1YP2A 3Q80A 2YESA 3BCVA 4D0ZA 3IOIA 1G8OA 1XHBA 2V0KA 3R2WA 5AJNA 5FUHA 1MP5A 1FO8A 1H5SD 1YP4A 3USRA 3I0DA 4Y64A 4B3UA 1VH3A 2RIXA 2QGIA 2RJ7A 2GGQA 2PA4A 4HO2A 4EEAA 5FTVA 1H7QA 1WVCA 1H5SB 4JISA 2XWNA 2YCMA 1FG5N 3IOHA 3U0XA 3SPTA 4FREA 2VSIA 2XMHA 3K8EA 3K8DA 4XWIA 2X5SA 2OEFA 1ZCTA 4Y6UA 3FWWA 2JCJA 4FCEA 4FRDA 4KT7A 2GGOA 2J0AA 4MNDA 4K6RA 3SXEA 3I0EA 1ZDGA 4UEGA 4EE3A 4EEMA 1INJA 3CKOA 3SX7A 3USQA 1R80A 2VD4A 3OGZA 5C1HA 3SX5A 5CQPA 1JV3A 1VGWA 4G87A 2W0VA 3V0PA 3ZLLA 3DJ4A 2PGYA 1LL0A 1FR9A 1TVYA 2I5EA 3RMWA 4B4BA 2OI7A 1VH1A 3V91A 1H5TA 1R7YA 1IINA 3V0OA 4HO4A 4J18A 1G0RA 1FGXA 2AESA 1ZI4A 2VXLA 4O6NA 3PKQA 1H7TA 1H4DA 3OAMA 3OH1A 1H4EA 2DPWA 1YROB 2C0NA 1WT1A 4B5BA 1S4OA 2X5ZA 5FU8A 2NXVA 2P72A 1QWJA 4HOCA 3RSBA 2XMEA 2V0HA 2Y7AA 4NAIA 1KWSA 2XWLA 2VS4A 1OMXA 5FU0A 3CKNA 1FRWA 5D91A 5J49A 4FROA 1H5RA 2BO7A 4Y7UA 1LZJA 4KXOA 1G9RA 2AECA 1ZJ0A 3I0LA 1FO9A 1R81A 2E8BA 1H5SC 4AYLA 3Q4SA 3I0IX 3O3PA 4KNRA 4AAWA 5CMJA 2YQSA 5IDTA 2VS3A 4HO6A 4Q7CA 3I0FA 3OH0A 5C36A 2YQCA 3U2UA 2D7IA 1S4PA 3OH2A 3T7NA 1NHEB 5CQNX 1FXOA 2JCOA 3V0MA 2CU2A 3QVBA 1ZJ1A 1W77A 3LW6A 3Q7UA 4GBPA 4ZDQA 1VZTA 1H7FA 1LZIA 4KQLA 1ZJPA 1HM0A 3CKJA 4Y62A 4FQWA 4ARWA 3TQDA 3RMVA 4LW3A 2PGVA 3PNNA 4CJCA 3E25A 4IRPA 2FYDB 1LL2A 2FFVA 2WAWA 1I52A 4HO5A 4C2SA 2O1FA 1H7LA 2P6WA 3SXCA 3ZLKA 3OH4A 5C48A 3E26A 4EVWA 1GWWA 5CQOA 1VGUA 2RJ9A 2WVMA 2RJ5A 2RJ4A 4HG6A 5C3AA 1QGQA 4Y7VA 2RITA 5HS2A 2BO6A 4MYBA 3CGXA 3SXDA 4D48A 1FOAA 2Z86A 4KC1A 5C8RA 3ZGFA 1ZI1A 3U2TA 1WT3A 2YQJA 2PX7A 1H7GA 3PKPA 4D11C 2E3DA 1IIMA 5CMIA 3NGWA 5C4DA 2X65A 3POLA 4MIXA 3V8YA 1VICA 1ZHJA 4D11A 1YP3A 3T7OA 1NMMB 3CU0A 2VK9A 4AC3A 1VZXA 4EEOA 5IDSA 4LW6A 3D98A 5I1FA 1LL3A 1NQIB 4L41C 1OMZA 2OI5A 3JUKA 4M28A 3CKVA 5D92A 1FWYA 1O0RA 3BRKX 2ICYA 1V84A 3V90A 3U2WA 1PZTA 3OKRA 4KPXA 2ZU7A 3DK5A 5DDVA 1H7EA 2VXMA 4HO3A 1S4NA 1LVWA 2XWMA 2Y4LA 1FR8A 4ASYA 1EZIA 3KIAA 3F1YA 5EIYA 3T7MA 1V83A 1FZWA 3F1CA 2WVLA 1FXJA 3D5NA 1HJLA 2RJ6A 4NALA 4Y7TA 2JCKA 1ZI5A 2WE9A 1VGTA 4YS8A 1HM9A 4HCQA 4CVHA 3N9WA 1JYLA 3SX8A 5C4CA 5EJZA 2P73A 5L6SA 1H5TB 5C38A 4CJ8A 1EYRA 3I0CA 1GQ9A 1GQCA 3JUJA 1NF5B 2ZU8A 1H4CA 4DECA 4B2WA 2J0BA 4G3PA 1QGSA 3OC9A 1K4VA 1ZI3A 2V0IA 1G23A 2RIYA 1H7HA 4EEGA 3IOJA 4ASJA 1MC3A 2OEGA 1SS9A 1H5SA 1ZCVA 3D8VA 4FRLA 5CQLX 5C47A 3I0HA 4KC4A 2JCLA 4Y6NA 5AJPA 5C1LA 1H3MA 3OH3A 1ZJOA 4FRMA 4HO9A 2FYBA 4B4MA 2VFZA 4CJBA 1R7TA 2Q4JA 1R7UA 3I0GA 1G2VA 1W57A 2RJ0A 1R7XA 1MP4A 3CKQA 1HV9A 3SXAA 1G1LA 1LZ0A 2FY7A 1E5KA 3TZTA 3R3IA 4B42A 5JQQA 4FRPA 2YC5A 3I0JA 2YC3A 1MP3A 5FYEA 2QH5A 2RIZA 3JTJA 4BQHA 1O7OA 1XZ6A 1ON8A 4B2XA 2OI6A 3V0LA 1V82A 1ZJ3A 4Y7GA 2VS5A 1G95A 4M2AA 2AH9A 4B4GA 1JVGA 1ZIZA 5CQMX 2O1HA 1JYKA 2QKXA 3ZF8A 3V8ZA 1O7QA 2Y4MA 4M4KA 5C4FA 1JVDA 1VPAA 4EE4A 4FRHA 3SXGA 1OQMB 1VM8A 5CMFX 5AJOA 5BXCA 2Y4KA 3SX3A 4G3QA 4DE7A 1NKHB 2AM4A 3V0NA 1R82A 4FIXA 1WSZA 3I0KA 4G3SA 4JD0A 1GX0A 2FYCB 2BO8A 2AGDA 5C4BA 2WEEA 2ICXA 3DUVA 4EE5A 3ST8A 2APCA 3EE5A 4FCUA 5C4EA 1PZYB 3ZGGA 1ZCYA 4Y7FA 5L6VA 2O1GA 2MZBA 3U2XA 4IRQA 4KPZA 4KC2A 1R7VA 1ZCUA 3V0QA 4FRQA 1GWVA 2Z87A 1VGZA 4P02A 4AYJA 1ON6A 2X60A 4P00A 2UX8A 1ZJ2A 5FTSA 1ZDFA 2RJ1A 1HJJA 4R7PA 1LZ7A 4HO8A 1TZFA 1W55A 1HM8A 5C1GA 5DDTA 4NANA 4D0TA 2WGZA 3U0YA 4ECMA 1O23B 5CMHA 1TW5A 2RJ8A 2YQHA 1GA8A 3FOQA 3HL3A 5FV9A 4HO0A 2WVKA 2AM5A 1G3LA 1NWGB 2Y4JA 4FRAA 4O6MA 5C49A 1G93A 2A8WA 4KNXA 3U2VA 4E1KA 2D0JA 2FYAA 4KRVA 2AM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z90 A;  1QG8 A;  5C3D A;  4BMA A;  2V0J A;  2Y6P A;  4Y9X A;  2AE7 A;  5C3B A;  3SXB A;  1WT0 A;  5CMG X;  1JV1 A;  1FGG A;  2A8U A;  2FFU A;  1VZU A;  1WT2 A;  2I7B A;  2V0L A;  4Y63 A;  4NAK A;  2D7R A;  2ZU9 A;  1INI A;  5IFY A;  1G97 A;  2I5K A;  1TW1 A;  1GX4 A;  4FRB A;  4M2B A;  5EJ1 A;  4DDZ A;  2BO4 A;  3GUE A;  2VSH A;  2W0W A;  1H5R B;  1YP2 A;  3Q80 A;  2YES A;  3BCV A;  4D0Z A;  3IOI A;  1G8O A;  1XHB A;  2V0K A;  3R2W A;  5AJN A;  5FUH A;  1MP5 A;  1FO8 A;  1H5S D;  1YP4 A;  3USR A;  3I0D A;  4Y64 A;  4B3U A;  1VH3 A;  2RIX A;  2QGI A;  2RJ7 A;  2GGQ A;  2PA4 A;  4HO2 A;  4EEA A;  5FTV A;  1H7Q A;  1WVC A;  1H5S B;  4JIS A;  2XWN A;  2YCM A;  1FG5 N;  3IOH A;  3U0X A;  3SPT A;  4FRE A;  2VSI A;  2XMH A;  3K8E A;  3K8D A;  4XWI A;  2X5S A;  2OEF A;  1ZCT A;  4Y6U A;  3FWW A;  2JCJ A;  4FCE A;  4FRD A;  4KT7 A;  2GGO A;  4MND A;  4K6R A;  3SXE A;  3I0E A;  1ZDG A;  4UEG A;  4EE3 A;  4EEM A;  1INJ A;  3CKO A;  3SX7 A;  3USQ A;  1R80 A;  2VD4 A;  3OGZ A;  5C1H A;  3SX5 A;  5CQP A;  1JV3 A;  1VGW A;  4G87 A;  2W0V A;  3V0P A;  3ZLL A;  3DJ4 A;  2PGY A;  1LL0 A;  1FR9 A;  1TVY A;  2I5E A;  3RMW A;  4B4B A;  2OI7 A;  1VH1 A;  3V91 A;  1H5T A;  1R7Y A;  1IIN A;  3V0O A;  4HO4 A;  4J18 A;  1G0R A;  1FGX A;  2AES A;  1ZI4 A;  2VXL A;  3PKQ A;  1H7T A;  1H4D A;  3OAM A;  3OH1 A;  1H4E A;  2DPW A;  1YRO B;  1WT1 A;  4B5B A;  1S4O A;  2X5Z A;  5FU8 A;  2NXV A;  2P72 A;  1QWJ A;  4HOC A;  3RSB A;  2XME A;  2V0H A;  2Y7A A;  4NAI A;  1KWS A;  2XWL A;  2VS4 A;  1OMX A;  5FU0 A;  3CKN A;  1FRW A;  5J49 A;  4FRO A;  1H5R A;  2BO7 A;  4Y7U A;  1LZJ A;  4KXO A;  1G9R A;  2AEC A;  1ZJ0 A;  3I0L A;  1FO9 A;  1R81 A;  2E8B A;  1H5S C;  4AYL A;  3Q4S A;  3I0I X;  3O3P A;  4KNR A;  4AAW A;  5CMJ A;  2YQS A;  5IDT A;  2VS3 A;  4HO6 A;  3I0F A;  3OH0 A;  5C36 A;  2YQC A;  3U2U A;  2D7I A;  1S4P A;  3OH2 A;  3T7N A;  1NHE B;  5CQN X;  1FXO A;  2JCO A;  3V0M A;  2CU2 A;  3QVB A;  1ZJ1 A;  1W77 A;  3LW6 A;  3Q7U A;  4GBP A;  4ZDQ A;  1VZT A;  1H7F A;  1LZI A;  4KQL A;  1ZJP A;  1HM0 A;  3CKJ A;  4Y62 A;  4FQW A;  4ARW A;  3TQD A;  3RMV A;  4LW3 A;  2PGV A;  3PNN A;  4CJC A;  3E25 A;  4IRP A;  2FYD B;  1LL2 A;  2FFV A;  2WAW A;  1I52 A;  4HO5 A;  4C2S A;  2O1F A;  1H7L A;  2P6W A;  3SXC A;  3ZLK A;  3OH4 A;  5C48 A;  3E26 A;  4EVW A;  1GWW A;  5CQO A;  1VGU A;  2RJ9 A;  2WVM A;  2RJ5 A;  2RJ4 A;  4HG6 A;  5C3A A;  1QGQ A;  4Y7V A;  2RIT A;  5HS2 A;  2BO6 A;  4MYB A;  3CGX A;  3SXD A;  4D48 A;  1FOA A;  2Z86 A;  4KC1 A;  5C8R A;  3ZGF A;  1ZI1 A;  3U2T A;  1WT3 A;  2YQJ A;  2PX7 A;  1H7G A;  3PKP A;  4D11 C;  2E3D A;  1IIM A;  5CMI A;  3NGW A;  5C4D A;  2X65 A;  3POL A;  3V8Y A;  1VIC A;  1ZHJ A;  4D11 A;  1YP3 A;  3T7O A;  1NMM B;  3CU0 A;  4AC3 A;  1VZX A;  4EEO A;  5IDS A;  4LW6 A;  3D98 A;  5I1F A;  1LL3 A;  1NQI B;  4L41 C;  1OMZ A;  2OI5 A;  3JUK A;  4M28 A;  3CKV A;  1FWY A;  1O0R A;  3BRK X;  2ICY A;  1V84 A;  3V90 A;  3U2W A;  1PZT A;  3OKR A;  4KPX A;  2ZU7 A;  3DK5 A;  5DDV A;  1H7E A;  2VXM A;  4HO3 A;  1S4N A;  1LVW A;  2XWM A;  2Y4L A;  1FR8 A;  4ASY A;  1EZI A;  3KIA A;  3F1Y A;  5EIY A;  3T7M A;  1V83 A;  1FZW A;  3F1C A;  2WVL A;  1FXJ A;  3D5N A;  1HJL A;  2RJ6 A;  4NAL A;  4Y7T A;  2JCK A;  1ZI5 A;  2WE9 A;  1VGT A;  4YS8 A;  1HM9 A;  4HCQ A;  4CVH A;  3N9W A;  1JYL A;  3SX8 A;  5C4C A;  5EJZ A;  2P73 A;  5L6S A;  1H5T B;  5C38 A;  4CJ8 A;  1EYR A;  3I0C A;  1GQ9 A;  1GQC A;  3JUJ A;  1NF5 B;  2ZU8 A;  1H4C A;  4DEC A;  4B2W A;  4G3P A;  1QGS A;  3OC9 A;  1K4V A;  1ZI3 A;  2V0I A;  1G23 A;  2RIY A;  1H7H A;  4EEG A;  3IOJ A;  4ASJ A;  1MC3 A;  2OEG A;  1SS9 A;  1H5S A;  1ZCV A;  3D8V A;  4FRL A;  5CQL X;  5C47 A;  3I0H A;  4KC4 A;  2JCL A;  4Y6N A;  5AJP A;  5C1L A;  1H3M A;  3OH3 A;  1ZJO A;  4FRM A;  4HO9 A;  2FYB A;  4B4M A;  2VFZ A;  4CJB A;  1R7T A;  2Q4J A;  1R7U A;  3I0G A;  1G2V A;  1W57 A;  2RJ0 A;  1R7X A;  1MP4 A;  3CKQ A;  1HV9 A;  3SXA A;  1G1L A;  1LZ0 A;  2FY7 A;  1E5K A;  3TZT A;  3R3I A;  4B42 A;  5JQQ A;  4FRP A;  2YC5 A;  3I0J A;  2YC3 A;  1MP3 A;  5FYE A;  2QH5 A;  2RIZ A;  3JTJ A;  4BQH A;  1O7O A;  1XZ6 A;  1ON8 A;  4B2X A;  2OI6 A;  3V0L A;  1V82 A;  1ZJ3 A;  4Y7G A;  2VS5 A;  1G95 A;  4M2A A;  2AH9 A;  4B4G A;  1JVG A;  1ZIZ A;  5CQM X;  2O1H A;  1JYK A;  2QKX A;  3ZF8 A;  3V8Z A;  1O7Q A;  2Y4M A;  4M4K A;  5C4F A;  1JVD A;  1VPA A;  4EE4 A;  4FRH A;  3SXG A;  1OQM B;  1VM8 A;  5CMF X;  5AJO A;  5BXC A;  2Y4K A;  3SX3 A;  4G3Q A;  4DE7 A;  1NKH B;  2AM4 A;  3V0N A;  1R82 A;  1WSZ A;  3I0K A;  4G3S A;  4JD0 A;  1GX0 A;  2FYC B;  2BO8 A;  2AGD A;  5C4B A;  2WEE A;  2ICX A;  3DUV A;  4EE5 A;  3ST8 A;  2APC A;  3EE5 A;  4FCU A;  5C4E A;  1PZY B;  3ZGG A;  1ZCY A;  4Y7F A;  5L6V A;  2O1G A;  2MZB A;  3U2X A;  4IRQ A;  4KPZ A;  4KC2 A;  1R7V A;  1ZCU A;  3V0Q A;  4FRQ A;  1GWV A;  2Z87 A;  1VGZ A;  4P02 A;  4AYJ A;  1ON6 A;  2X60 A;  4P00 A;  2UX8 A;  1ZJ2 A;  5FTS A;  1ZDF A;  2RJ1 A;  1HJJ A;  4R7P A;  1LZ7 A;  4HO8 A;  1TZF A;  1W55 A;  1HM8 A;  5C1G A;  5DDT A;  4NAN A;  4D0T A;  2WGZ A;  3U0Y A;  4ECM A;  1O23 B;  5CMH A;  1TW5 A;  2RJ8 A;  2YQH A;  1GA8 A;  3FOQ A;  3HL3 A;  5FV9 A;  4HO0 A;  2WVK A;  2AM5 A;  1G3L A;  1NWG B;  2Y4J A;  4FRA A;  5C49 A;  1G93 A;  2A8W A;  4KNX A;  3U2V A;  4E1K A;  2D0J A;  2FYA A;  4KRV A;  2AM3 A; 
#chains in the Genus database with same CATH topology
 1Z90 A;  1QG8 A;  5C3D A;  4BMA A;  2V0J A;  4FIY A;  2Y6P A;  4Y9X A;  2AE7 A;  5C3B A;  3SXB A;  1WT0 A;  5CMG X;  1JV1 A;  1FGG A;  2A8U A;  2FFU A;  1VZU A;  1WT2 A;  2I7B A;  2V0L A;  4Y63 A;  4NAK A;  2D7R A;  2ZU9 A;  1INI A;  5IFY A;  1G97 A;  2I5K A;  1TW1 A;  1GX4 A;  4FRB A;  4M2B A;  5EJ1 A;  4DDZ A;  2BO4 A;  3GUE A;  2VSH A;  2W0W A;  1H5R B;  1YP2 A;  3Q80 A;  2YES A;  3BCV A;  4D0Z A;  3IOI A;  1G8O A;  1XHB A;  2V0K A;  3R2W A;  5AJN A;  5FUH A;  1MP5 A;  1FO8 A;  1H5S D;  1YP4 A;  3USR A;  3I0D A;  4Y64 A;  4B3U A;  1VH3 A;  2RIX A;  2QGI A;  2RJ7 A;  2GGQ A;  2PA4 A;  4HO2 A;  4EEA A;  5FTV A;  1H7Q A;  1WVC A;  1H5S B;  4JIS A;  2XWN A;  2YCM A;  1FG5 N;  3IOH A;  3U0X A;  3SPT A;  4FRE A;  2VSI A;  2XMH A;  3K8E A;  3K8D A;  4XWI A;  2X5S A;  2OEF A;  1ZCT A;  4Y6U A;  3FWW A;  2JCJ A;  4FCE A;  4FRD A;  4KT7 A;  2GGO A;  2J0A A;  4MND A;  4K6R A;  3SXE A;  3I0E A;  1ZDG A;  4UEG A;  4EE3 A;  4EEM A;  1INJ A;  3CKO A;  3SX7 A;  3USQ A;  1R80 A;  2VD4 A;  3OGZ A;  5C1H A;  3SX5 A;  5CQP A;  1JV3 A;  1VGW A;  4G87 A;  2W0V A;  3V0P A;  3ZLL A;  3DJ4 A;  2PGY A;  1LL0 A;  1FR9 A;  1TVY A;  2I5E A;  3RMW A;  4B4B A;  2OI7 A;  1VH1 A;  3V91 A;  1H5T A;  1R7Y A;  1IIN A;  3V0O A;  4HO4 A;  4J18 A;  1G0R A;  1FGX A;  2AES A;  1ZI4 A;  2VXL A;  4O6N A;  3PKQ A;  1H7T A;  1H4D A;  3OAM A;  3OH1 A;  1H4E A;  2DPW A;  1YRO B;  2C0N A;  1WT1 A;  4B5B A;  1S4O A;  2X5Z A;  5FU8 A;  2NXV A;  2P72 A;  1QWJ A;  4HOC A;  3RSB A;  2XME A;  2V0H A;  2Y7A A;  4NAI A;  1KWS A;  2XWL A;  2VS4 A;  1OMX A;  5FU0 A;  3CKN A;  1FRW A;  5D91 A;  5J49 A;  4FRO A;  1H5R A;  2BO7 A;  4Y7U A;  1LZJ A;  4KXO A;  1G9R A;  2AEC A;  1ZJ0 A;  3I0L A;  1FO9 A;  1R81 A;  2E8B A;  1H5S C;  4AYL A;  3Q4S A;  3I0I X;  3O3P A;  4KNR A;  4AAW A;  5CMJ A;  2YQS A;  5IDT A;  2VS3 A;  4HO6 A;  4Q7C A;  3I0F A;  3OH0 A;  5C36 A;  2YQC A;  3U2U A;  2D7I A;  1S4P A;  3OH2 A;  3T7N A;  1NHE B;  5CQN X;  1FXO A;  2JCO A;  3V0M A;  2CU2 A;  3QVB A;  1ZJ1 A;  1W77 A;  3LW6 A;  3Q7U A;  4GBP A;  4ZDQ A;  1VZT A;  1H7F A;  1LZI A;  4KQL A;  1ZJP A;  1HM0 A;  3CKJ A;  4Y62 A;  4FQW A;  4ARW A;  3TQD A;  3RMV A;  4LW3 A;  2PGV A;  3PNN A;  4CJC A;  3E25 A;  4IRP A;  2FYD B;  1LL2 A;  2FFV A;  2WAW A;  1I52 A;  4HO5 A;  4C2S A;  2O1F A;  1H7L A;  2P6W A;  3SXC A;  3ZLK A;  3OH4 A;  5C48 A;  3E26 A;  4EVW A;  1GWW A;  5CQO A;  1VGU A;  2RJ9 A;  2WVM A;  2RJ5 A;  2RJ4 A;  4HG6 A;  5C3A A;  1QGQ A;  4Y7V A;  2RIT A;  5HS2 A;  2BO6 A;  4MYB A;  3CGX A;  3SXD A;  4D48 A;  1FOA A;  2Z86 A;  4KC1 A;  5C8R A;  3ZGF A;  1ZI1 A;  3U2T A;  1WT3 A;  2YQJ A;  2PX7 A;  1H7G A;  3PKP A;  4D11 C;  2E3D A;  1IIM A;  5CMI A;  3NGW A;  5C4D A;  2X65 A;  3POL A;  4MIX A;  3V8Y A;  1VIC A;  1ZHJ A;  4D11 A;  1YP3 A;  3T7O A;  1NMM B;  3CU0 A;  2VK9 A;  4AC3 A;  1VZX A;  4EEO A;  5IDS A;  4LW6 A;  3D98 A;  5I1F A;  1LL3 A;  1NQI B;  4L41 C;  1OMZ A;  2OI5 A;  3JUK A;  4M28 A;  3CKV A;  5D92 A;  1FWY A;  1O0R A;  3BRK X;  2ICY A;  1V84 A;  3V90 A;  3U2W A;  1PZT A;  3OKR A;  4KPX A;  2ZU7 A;  3DK5 A;  5DDV A;  1H7E A;  2VXM A;  4HO3 A;  1S4N A;  1LVW A;  2XWM A;  2Y4L A;  1FR8 A;  4ASY A;  1EZI A;  3KIA A;  3F1Y A;  5EIY A;  3T7M A;  1V83 A;  1FZW A;  3F1C A;  2WVL A;  1FXJ A;  3D5N A;  1HJL A;  2RJ6 A;  4NAL A;  4Y7T A;  2JCK A;  1ZI5 A;  2WE9 A;  1VGT A;  4YS8 A;  1HM9 A;  4HCQ A;  4CVH A;  3N9W A;  1JYL A;  3SX8 A;  5C4C A;  5EJZ A;  2P73 A;  5L6S A;  1H5T B;  5C38 A;  4CJ8 A;  1EYR A;  3I0C A;  1GQ9 A;  1GQC A;  3JUJ A;  1NF5 B;  2ZU8 A;  1H4C A;  4DEC A;  4B2W A;  2J0B A;  4G3P A;  1QGS A;  3OC9 A;  1K4V A;  1ZI3 A;  2V0I A;  1G23 A;  2RIY A;  1H7H A;  4EEG A;  3IOJ A;  4ASJ A;  1MC3 A;  2OEG A;  1SS9 A;  1H5S A;  1ZCV A;  3D8V A;  4FRL A;  5CQL X;  5C47 A;  3I0H A;  4KC4 A;  2JCL A;  4Y6N A;  5AJP A;  5C1L A;  1H3M A;  3OH3 A;  1ZJO A;  4FRM A;  4HO9 A;  2FYB A;  4B4M A;  2VFZ A;  4CJB A;  1R7T A;  2Q4J A;  1R7U A;  3I0G A;  1G2V A;  1W57 A;  2RJ0 A;  1R7X A;  1MP4 A;  3CKQ A;  1HV9 A;  3SXA A;  1G1L A;  1LZ0 A;  2FY7 A;  1E5K A;  3TZT A;  3R3I A;  4B42 A;  5JQQ A;  4FRP A;  2YC5 A;  3I0J A;  2YC3 A;  1MP3 A;  5FYE A;  2QH5 A;  2RIZ A;  3JTJ A;  4BQH A;  1O7O A;  1XZ6 A;  1ON8 A;  4B2X A;  2OI6 A;  3V0L A;  1V82 A;  1ZJ3 A;  4Y7G A;  2VS5 A;  1G95 A;  4M2A A;  2AH9 A;  4B4G A;  1JVG A;  1ZIZ A;  5CQM X;  2O1H A;  1JYK A;  2QKX A;  3ZF8 A;  3V8Z A;  1O7Q A;  2Y4M A;  4M4K A;  5C4F A;  1JVD A;  1VPA A;  4EE4 A;  4FRH A;  3SXG A;  1OQM B;  1VM8 A;  5CMF X;  5AJO A;  5BXC A;  2Y4K A;  3SX3 A;  4G3Q A;  4DE7 A;  1NKH B;  2AM4 A;  3V0N A;  1R82 A;  4FIX A;  1WSZ A;  3I0K A;  4G3S A;  4JD0 A;  1GX0 A;  2FYC B;  2BO8 A;  2AGD A;  5C4B A;  2WEE A;  2ICX A;  3DUV A;  4EE5 A;  3ST8 A;  2APC A;  3EE5 A;  4FCU A;  5C4E A;  1PZY B;  3ZGG A;  1ZCY A;  4Y7F A;  5L6V A;  2O1G A;  2MZB A;  3U2X A;  4IRQ A;  4KPZ A;  4KC2 A;  1R7V A;  1ZCU A;  3V0Q A;  4FRQ A;  1GWV A;  2Z87 A;  1VGZ A;  4P02 A;  4AYJ A;  1ON6 A;  2X60 A;  4P00 A;  2UX8 A;  1ZJ2 A;  5FTS A;  1ZDF A;  2RJ1 A;  1HJJ A;  4R7P A;  1LZ7 A;  4HO8 A;  1TZF A;  1W55 A;  1HM8 A;  5C1G A;  5DDT A;  4NAN A;  4D0T A;  2WGZ A;  3U0Y A;  4ECM A;  1O23 B;  5CMH A;  1TW5 A;  2RJ8 A;  2YQH A;  1GA8 A;  3FOQ A;  3HL3 A;  5FV9 A;  4HO0 A;  2WVK A;  2AM5 A;  1G3L A;  1NWG B;  2Y4J A;  4FRA A;  4O6M A;  5C49 A;  1G93 A;  2A8W A;  4KNX A;  3U2V A;  4E1K A;  2D0J A;  2FYA A;  4KRV A;  2AM3 A; 
#chains in the Genus database with same CATH homology
 1Z90 A;  1QG8 A;  5C3D A;  4BMA A;  2V0J A;  4FIY A;  2Y6P A;  4Y9X A;  2AE7 A;  5C3B A;  3SXB A;  1WT0 A;  5CMG X;  1JV1 A;  1FGG A;  2A8U A;  2FFU A;  1VZU A;  1WT2 A;  2I7B A;  2V0L A;  4Y63 A;  4NAK A;  2D7R A;  2ZU9 A;  1INI A;  5IFY A;  1G97 A;  2I5K A;  1TW1 A;  1GX4 A;  4FRB A;  4M2B A;  5EJ1 A;  4DDZ A;  2BO4 A;  3GUE A;  2VSH A;  2W0W A;  1H5R B;  1YP2 A;  3Q80 A;  2YES A;  3BCV A;  4D0Z A;  3IOI A;  1G8O A;  1XHB A;  2V0K A;  3R2W A;  5AJN A;  5FUH A;  1MP5 A;  1FO8 A;  1H5S D;  1YP4 A;  3USR A;  3I0D A;  4Y64 A;  4B3U A;  1VH3 A;  2RIX A;  2QGI A;  2RJ7 A;  2GGQ A;  2PA4 A;  4HO2 A;  4EEA A;  5FTV A;  1H7Q A;  1WVC A;  1H5S B;  4JIS A;  2XWN A;  2YCM A;  1FG5 N;  3IOH A;  3U0X A;  3SPT A;  4FRE A;  2VSI A;  2XMH A;  3K8E A;  3K8D A;  4XWI A;  2X5S A;  2OEF A;  1ZCT A;  4Y6U A;  3FWW A;  2JCJ A;  4FCE A;  4FRD A;  4KT7 A;  2GGO A;  2J0A A;  4MND A;  4K6R A;  3SXE A;  3I0E A;  1ZDG A;  4UEG A;  4EE3 A;  4EEM A;  1INJ A;  3CKO A;  3SX7 A;  3USQ A;  1R80 A;  2VD4 A;  3OGZ A;  5C1H A;  3SX5 A;  5CQP A;  1JV3 A;  1VGW A;  4G87 A;  2W0V A;  3V0P A;  3ZLL A;  3DJ4 A;  2PGY A;  1LL0 A;  1FR9 A;  1TVY A;  2I5E A;  3RMW A;  4B4B A;  2OI7 A;  1VH1 A;  3V91 A;  1H5T A;  1R7Y A;  1IIN A;  3V0O A;  4HO4 A;  4J18 A;  1G0R A;  1FGX A;  2AES A;  1ZI4 A;  2VXL A;  4O6N A;  3PKQ A;  1H7T A;  1H4D A;  3OAM A;  3OH1 A;  1H4E A;  2DPW A;  1YRO B;  2C0N A;  1WT1 A;  4B5B A;  1S4O A;  2X5Z A;  5FU8 A;  2NXV A;  2P72 A;  1QWJ A;  4HOC A;  3RSB A;  2XME A;  2V0H A;  2Y7A A;  4NAI A;  1KWS A;  2XWL A;  2VS4 A;  1OMX A;  5FU0 A;  3CKN A;  1FRW A;  5D91 A;  5J49 A;  4FRO A;  1H5R A;  2BO7 A;  4Y7U A;  1LZJ A;  4KXO A;  1G9R A;  2AEC A;  1ZJ0 A;  3I0L A;  1FO9 A;  1R81 A;  2E8B A;  1H5S C;  4AYL A;  3Q4S A;  3I0I X;  3O3P A;  4KNR A;  4AAW A;  5CMJ A;  2YQS A;  5IDT A;  2VS3 A;  4HO6 A;  4Q7C A;  3I0F A;  3OH0 A;  5C36 A;  2YQC A;  3U2U A;  2D7I A;  1S4P A;  3OH2 A;  3T7N A;  1NHE B;  5CQN X;  1FXO A;  2JCO A;  3V0M A;  2CU2 A;  3QVB A;  1ZJ1 A;  1W77 A;  3LW6 A;  3Q7U A;  4GBP A;  4ZDQ A;  1VZT A;  1H7F A;  1LZI A;  4KQL A;  1ZJP A;  1HM0 A;  3CKJ A;  4Y62 A;  4FQW A;  4ARW A;  3TQD A;  3RMV A;  4LW3 A;  2PGV A;  3PNN A;  4CJC A;  3E25 A;  4IRP A;  2FYD B;  1LL2 A;  2FFV A;  2WAW A;  1I52 A;  4HO5 A;  4C2S A;  2O1F A;  1H7L A;  2P6W A;  3SXC A;  3ZLK A;  3OH4 A;  5C48 A;  3E26 A;  4EVW A;  1GWW A;  5CQO A;  1VGU A;  2RJ9 A;  2WVM A;  2RJ5 A;  2RJ4 A;  4HG6 A;  5C3A A;  1QGQ A;  4Y7V A;  2RIT A;  5HS2 A;  2BO6 A;  4MYB A;  3CGX A;  3SXD A;  4D48 A;  1FOA A;  2Z86 A;  4KC1 A;  5C8R A;  3ZGF A;  1ZI1 A;  3U2T A;  1WT3 A;  2YQJ A;  2PX7 A;  1H7G A;  3PKP A;  4D11 C;  2E3D A;  1IIM A;  5CMI A;  3NGW A;  5C4D A;  2X65 A;  3POL A;  4MIX A;  3V8Y A;  1VIC A;  1ZHJ A;  4D11 A;  1YP3 A;  3T7O A;  1NMM B;  3CU0 A;  2VK9 A;  4AC3 A;  1VZX A;  4EEO A;  5IDS A;  4LW6 A;  3D98 A;  5I1F A;  1LL3 A;  1NQI B;  4L41 C;  1OMZ A;  2OI5 A;  3JUK A;  4M28 A;  3CKV A;  5D92 A;  1FWY A;  1O0R A;  3BRK X;  2ICY A;  1V84 A;  3V90 A;  3U2W A;  1PZT A;  3OKR A;  4KPX A;  2ZU7 A;  3DK5 A;  5DDV A;  1H7E A;  2VXM A;  4HO3 A;  1S4N A;  1LVW A;  2XWM A;  2Y4L A;  1FR8 A;  4ASY A;  1EZI A;  3KIA A;  3F1Y A;  5EIY A;  3T7M A;  1V83 A;  1FZW A;  3F1C A;  2WVL A;  1FXJ A;  3D5N A;  1HJL A;  2RJ6 A;  4NAL A;  4Y7T A;  2JCK A;  1ZI5 A;  2WE9 A;  1VGT A;  4YS8 A;  1HM9 A;  4HCQ A;  4CVH A;  3N9W A;  1JYL A;  3SX8 A;  5C4C A;  5EJZ A;  2P73 A;  5L6S A;  1H5T B;  5C38 A;  4CJ8 A;  1EYR A;  3I0C A;  1GQ9 A;  1GQC A;  3JUJ A;  1NF5 B;  2ZU8 A;  1H4C A;  4DEC A;  4B2W A;  2J0B A;  4G3P A;  1QGS A;  3OC9 A;  1K4V A;  1ZI3 A;  2V0I A;  1G23 A;  2RIY A;  1H7H A;  4EEG A;  3IOJ A;  4ASJ A;  1MC3 A;  2OEG A;  1SS9 A;  1H5S A;  1ZCV A;  3D8V A;  4FRL A;  5CQL X;  5C47 A;  3I0H A;  4KC4 A;  2JCL A;  4Y6N A;  5AJP A;  5C1L A;  1H3M A;  3OH3 A;  1ZJO A;  4FRM A;  4HO9 A;  2FYB A;  4B4M A;  2VFZ A;  4CJB A;  1R7T A;  2Q4J A;  1R7U A;  3I0G A;  1G2V A;  1W57 A;  2RJ0 A;  1R7X A;  1MP4 A;  3CKQ A;  1HV9 A;  3SXA A;  1G1L A;  1LZ0 A;  2FY7 A;  1E5K A;  3TZT A;  3R3I A;  4B42 A;  5JQQ A;  4FRP A;  2YC5 A;  3I0J A;  2YC3 A;  1MP3 A;  5FYE A;  2QH5 A;  2RIZ A;  3JTJ A;  4BQH A;  1O7O A;  1XZ6 A;  1ON8 A;  4B2X A;  2OI6 A;  3V0L A;  1V82 A;  1ZJ3 A;  4Y7G A;  2VS5 A;  1G95 A;  4M2A A;  2AH9 A;  4B4G A;  1JVG A;  1ZIZ A;  5CQM X;  2O1H A;  1JYK A;  2QKX A;  3ZF8 A;  3V8Z A;  1O7Q A;  2Y4M A;  4M4K A;  5C4F A;  1JVD A;  1VPA A;  4EE4 A;  4FRH A;  3SXG A;  1OQM B;  1VM8 A;  5CMF X;  5AJO A;  5BXC A;  2Y4K A;  3SX3 A;  4G3Q A;  4DE7 A;  1NKH B;  2AM4 A;  3V0N A;  1R82 A;  4FIX A;  1WSZ A;  3I0K A;  4G3S A;  4JD0 A;  1GX0 A;  2FYC B;  2BO8 A;  2AGD A;  5C4B A;  2WEE A;  2ICX A;  3DUV A;  4EE5 A;  3ST8 A;  2APC A;  3EE5 A;  4FCU A;  5C4E A;  1PZY B;  3ZGG A;  1ZCY A;  4Y7F A;  5L6V A;  2O1G A;  2MZB A;  3U2X A;  4IRQ A;  4KPZ A;  4KC2 A;  1R7V A;  1ZCU A;  3V0Q A;  4FRQ A;  1GWV A;  2Z87 A;  1VGZ A;  4P02 A;  4AYJ A;  1ON6 A;  2X60 A;  4P00 A;  2UX8 A;  1ZJ2 A;  5FTS A;  1ZDF A;  2RJ1 A;  1HJJ A;  4R7P A;  1LZ7 A;  4HO8 A;  1TZF A;  1W55 A;  1HM8 A;  5C1G A;  5DDT A;  4NAN A;  4D0T A;  2WGZ A;  3U0Y A;  4ECM A;  1O23 B;  5CMH A;  1TW5 A;  2RJ8 A;  2YQH A;  1GA8 A;  3FOQ A;  3HL3 A;  5FV9 A;  4HO0 A;  2WVK A;  2AM5 A;  1G3L A;  1NWG B;  2Y4J A;  4FRA A;  4O6M A;  5C49 A;  1G93 A;  2A8W A;  4KNX A;  3U2V A;  4E1K A;  2D0J A;  2FYA A;  4KRV A;  2AM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...