1S4PA

Crystal structure of yeast alpha1,2-mannosyltransferase kre2p/mnt1p: ternary complex with gdp/mn and methyl-alpha-mannoside acceptor
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
339
structure length
335
Chain Sequence
KTTMDYITPSFGKPKACYVTLVRNKELKGLLSSIKYVENKINKKFPYPWVFLNDEPFTEEFKEAVTKAVSSEVKFGILPKEHWSYPEWINQTKAAEIRADAATKYIYGGSESYRHMCRYQSGFFWRHELLEEYDWYWRVEPDIKLYCDINYDVFKWMQENEKVYGFTVSIHEYEVTIPTLWQTSMDFIKKNPEYLDENNLMSFLSNDNGKTYNLCHFWSNFEIANLNLWRSPAYREYFDTLDHQGGFFYERWGDAPVHSIAAALFLPKDKIHYFSDIGYHHPPYDNCPLDKEVYNSNNCECDQGNDFTFQGYSCGKEYYDAQGLVKPKNWKKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycolipid 2-alpha-mannosyltransferase
publication title Structure of Kre2p/Mnt1p: A YEAST {alpha}1,2-MANNOSYLTRANSFERASE INVOLVED IN MANNOPROTEIN BIOSYNTHESIS
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 133
structure length 335
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.4.1.131: GDP-Man:Man(3)GlcNAc(2)-PP-dolichol alpha-1,2-mannosyltransferase.
pdb deposition date 2004-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1s4pA00
1WT2A 4Y6UA 5IDTA 2Y6PA 3PKPA 2V0IA 4Y7TA 3SXAA 3Q80A 1R7XA 4B4BA 4LW6A 3EE5A 3OH1A 1ZIZA 1YROB 4FRAA 1INJA 1VM8A 2VS4A 2QGIA 1JYKA 5FTSA 4G3QA 3DUVA 2X5SA 3TZTA 2PX7A 1G8OA 1OMXA 3HL3A 3I0CA 1O7QA 1FO9A 3CKVA 3SX5A 3OGZA 2FYDB 2RJ5A 3V0NA 2JCOA 2OI7A 2YQSA 1QGSA 2V0HA 2WGZA 2VFZA 1H7EA 4IRQA 4KXOA 1LZ7A 1OMZA 4ASJA 1G23A 1ZCTA 3V0MA 4HO6A 4FRBA 4JD0A 5FV9A 2AM4A 4HO5A 1LVWA 1H5RA 2AE7A 2P73A 4M4KA 3CKOA 3V0QA 2FFUA 1HM0A 2E8BA 5C1GA 3K8DA 3CGXA 4NANA 3RMWA 2Y4JA 3SPTA 3USRA 1H5SD 2QKXA 1VGTA 4FRMA 2D7RA 1R7TA 2WVKA 4KC2A 2V0JA 1FXOA 5CMFX 4FQWA 5C3AA 1H5RB 3GUEA 4HO8A 1VGUA 5C4DA 5CMJA 3BCVA 3SX8A 2I7BA 1WSZA 2JCLA 2YQCA 1GQ9A 1H4DA 1JV3A 3I0IX 1S4NA 2O1HA 1GWWA 2RJ6A 3PNNA 1JVGA 4HO2A 5C4CA 5BXCA 2YESA 3ZLKA 1MP5A 2CU2A 4M2BA 1NF5B 1H7QA 3OH2A 1GQCA 1G3LA 2FYBA 4KNRA 2FFVA 5AJPA 5L6SA 1MP4A 4HCQA 4B2XA 2P6WA 2I5EA 5FUHA 5CQOA 4EE4A 2YQHA 2QH5A 2OI5A 2BO6A 1O23B 1V82A 1WVCA 5AJOA 2A8UA 3SX3A 1MC3A 2Z86A 3OKRA 4KC1A 4CJCA 2X65A 1H5TA 4ARWA 1VPAA 1YP3A 3ZF8A 1HM8A 4AYJA 3RMVA 2RJ1A 5C3BA 4P00A 1W55A 1QGQA 4B4MA 2YC5A 4M28A 1IINA 4Y9XA 2AM5A 4M2AA 1MP3A 2VSHA 4FRHA 3I0JA 1JYLA 4UEGA 5FYEA 1H4EA 3SXCA 2RJ7A 1ZCYA 5FU8A 2D7IA 4G3SA 2ZU9A 3E26A 3JTJA 3U2UA 3SXDA 5DDTA 1H5TB 4D48A 2O1FA 3JUKA 1LL3A 1ZJ0A 3TQDA 2WE9A 3RSBA 1VH3A 1H5SC 4G87A 2WAWA 3POLA 4BQHA 2PGVA 2VXMA 5FU0A 5IFYA 5JQQA 5C1LA 5CQPA 1ZJ3A 1TVYA 4EEOA 3I0LA 4KC4A 2VS5A 3NGWA 2AM3A 1G2VA 1R80A 4ECMA 1ZJOA 3OAMA 3QVBA 4JISA 5C38A 1G95A 3F1YA 4D0ZA 1H7TA 2VSIA 3I0FA 2OEFA 1R7VA 4MYBA 1QG8A 3BRKX 3D98A 3ST8A 1I52A 1HM9A 1ZJ1A 4CJ8A 1H4CA 3SXEA 3U0XA 1TW5A 1FG5N 2ICYA 2Y7AA 4L41C 3PKQA 3DJ4A 3SXBA 2Y4KA 2YC3A 5HS2A 2GGOA 3I0EA 4Y7FA 2Y4LA 5CQNX 1IIMA 2Y4MA 1ZDGA 1H3MA 4Y64A 1OQMB 4FRPA 4HG6A 5CQMX 3OH4A 4FRQA 4EEAA 2P72A 2RIXA 4BMAA 2OEGA 2FYAA 1HJJA 2BO8A 4D11A 5IDSA 5EJZA 4K6RA 1H7LA 3I0DA 3O3PA 2XMHA 3SX7A 2ZU7A 5AJNA 1FGXA 1S4PA 1ZCUA 4B3UA 4XWIA 4B5BA 4KT7A 1FGGA 4FRDA 4FCUA 4AAWA 1FOAA 4DE7A 2VS3A 5CMHA 3ZGFA 5C8RA 2RJ8A 1YP4A 1XZ6A 2AECA 3OH3A 2FYCB 3V90A 2VD4A 2V0KA 4KPXA 1NQIB 4ZDQA 2RIYA 1E5KA 1INIA 3I0KA 1ZI1A 1W77A 1QWJA 3K8EA 2APCA 1NKHB 2MZBA 1ZCVA 2AESA 2YCMA 4Y62A 5C4BA 1S4OA 2AH9A 5C4EA 1JVDA 4B2WA 3USQA 1HV9A 1TW1A 1GX0A 2BO4A 1NHEB 2Q4JA 1H7GA 2ZU8A 4EEMA 2GGQA 1WT0A 2O1GA 1GA8A 3T7NA 5C47A 5I1FA 2WVMA 3OH0A 1EZIA 1FR8A 4DECA 1VZUA 5C4FA 1PZTA 1ZI5A 2RIZA 1O0RA 3V0PA 1G0RA 4EEGA 2X5ZA 3CKJA 1WT3A 4NAKA 4NAIA 4E1KA 4LW3A 5C3DA 4HOCA 4FROA 4KQLA 2A8WA 1G9RA 2XWNA 4KNXA 2XWMA 3CKNA 1FXJA 3ZGGA 1YP2A 1VZXA 5C36A 1FRWA 3IOIA 4HO4A 1G97A 3V8ZA 2FY7A 4CVHA 5EJ1A 2V0LA 1JV1A 1Z90A 5L6VA 3U2TA 3U2WA 4HO9A 4Y6NA 1GX4A 1R7YA 1VZTA 1ZJ2A 3I0HA 3U2VA 3Q7UA 5J49A 3I0GA 1G93A 3JUJA 2D0JA 4CJBA 2ICXA 3FOQA 5C49A 4HO3A 2W0WA 1NMMB 4NALA 3KIAA 3V0OA 1LZ0A 2BO7A 1EYRA 5EIYA 4B4GA 2XMEA 3Q4SA 2JCKA 2RJ4A 2Z87A 4KPZA 3V91A 3ZLLA 1K4VA 1LZIA 3FWWA 4FREA 3IOJA 1W57A 2OI6A 1H7FA 2WVLA 5FTVA 1TZFA 3R3IA 4Y7VA 4J18A 4P02A 3SXGA 4C2SA 3T7OA 4B42A 1ON6A 2RITA 2XWLA 3CU0A 4EE3A 3OC9A 4FCEA 5DDVA 2YQJA 1R81A 3CKQA 3D8VA 5CMIA 5C1HA 2DPWA 3DK5A 4Y7GA 4EE5A 3IOHA 4MNDA 1ON8A 4ASYA 2RJ9A 1HJLA 1ZDFA 2JCJA 2E3DA 2NXVA 2I5KA 2UX8A 3U2XA 2PA4A 1FO8A 1VH1A 5CQLX 1ZJPA 2AGDA 4GBPA 1R82A 2WEEA 4Y7UA 3V8YA 4AYLA 1H7HA 1G1LA 4Y63A 1LL0A 1H5SA 3N9WA 1LZJA 1LL2A 1NWGB 1R7UA 1O7OA 1V83A 2W0VA 3T7MA 1PZYB 1VGWA 1VGZA 4YS8A 3U0YA 4AC3A 2PGYA 1GWVA 1ZI3A 2VXLA 4FRLA 1FWYA 1XHBA 2X60A 2RJ0A 1ZI4A 3E25A 3LW6A 4R7PA 3R2WA 4IRPA 4D11C 5C48A 4G3PA 1FZWA 1VICA 4DDZA 4D0TA 1FR9A 1WT1A 1H5SB 4HO0A 1ZHJA 3V0LA 3F1CA 1KWSA 4KRVA 4EVWA 1V84A 5CMGX 3D5NA 1SS9A
chains in the Genus database with same CATH superfamily
1WT2A 4Y6UA 5IDTA 2Y6PA 3PKPA 2V0IA 4Y7TA 3SXAA 3Q80A 1R7XA 4B4BA 4LW6A 3EE5A 3OH1A 1ZIZA 1YROB 4FRAA 1INJA 1VM8A 2VS4A 2QGIA 1JYKA 5FTSA 4G3QA 3DUVA 2X5SA 3TZTA 2PX7A 1G8OA 1OMXA 3HL3A 3I0CA 1O7QA 1FO9A 3CKVA 3SX5A 3OGZA 2FYDB 2RJ5A 3V0NA 2JCOA 2OI7A 2YQSA 1QGSA 2V0HA 2WGZA 2VFZA 1H7EA 4IRQA 4KXOA 1LZ7A 1OMZA 4ASJA 1G23A 1ZCTA 3V0MA 4HO6A 4FRBA 4JD0A 5FV9A 2AM4A 4HO5A 1LVWA 1H5RA 2AE7A 2P73A 4M4KA 3CKOA 3V0QA 2FFUA 1HM0A 2E8BA 5C1GA 3K8DA 3CGXA 4NANA 3RMWA 4FIXA 2Y4JA 3SPTA 3USRA 1H5SD 2QKXA 1VGTA 4FRMA 2D7RA 1R7TA 2WVKA 4KC2A 2V0JA 1FXOA 5CMFX 4FQWA 5C3AA 1H5RB 3GUEA 4HO8A 1VGUA 5C4DA 5CMJA 3BCVA 3SX8A 2I7BA 1WSZA 4FIYA 2JCLA 2YQCA 1GQ9A 1H4DA 1JV3A 3I0IX 1S4NA 2O1HA 1GWWA 2RJ6A 3PNNA 1JVGA 4HO2A 5C4CA 5BXCA 2YESA 3ZLKA 1MP5A 2CU2A 4M2BA 1NF5B 1H7QA 3OH2A 1GQCA 1G3LA 2FYBA 4KNRA 2FFVA 5AJPA 2J0AA 5L6SA 1MP4A 4HCQA 4B2XA 2P6WA 2I5EA 5FUHA 5CQOA 4EE4A 2YQHA 2QH5A 2OI5A 2BO6A 1O23B 1V82A 1WVCA 5AJOA 2A8UA 3SX3A 1MC3A 2Z86A 3OKRA 4KC1A 4CJCA 2C0NA 2X65A 1H5TA 4ARWA 1VPAA 1YP3A 3ZF8A 1HM8A 4AYJA 3RMVA 2RJ1A 5C3BA 4P00A 1W55A 1QGQA 4B4MA 2YC5A 4M28A 1IINA 4Y9XA 2AM5A 4M2AA 1MP3A 2VSHA 4FRHA 3I0JA 1JYLA 4UEGA 5FYEA 1H4EA 3SXCA 2RJ7A 1ZCYA 5FU8A 2D7IA 4G3SA 2ZU9A 3E26A 3JTJA 3U2UA 3SXDA 5DDTA 1H5TB 4D48A 2O1FA 3JUKA 1LL3A 1ZJ0A 3TQDA 2WE9A 3RSBA 1VH3A 1H5SC 4G87A 2WAWA 3POLA 4BQHA 2PGVA 2VXMA 5FU0A 5IFYA 5JQQA 5C1LA 5CQPA 2J0BA 1ZJ3A 1TVYA 4EEOA 3I0LA 4KC4A 2VS5A 3NGWA 2AM3A 4O6NA 1G2VA 1R80A 4ECMA 1ZJOA 3OAMA 3QVBA 4JISA 5C38A 1G95A 3F1YA 4D0ZA 1H7TA 2VSIA 3I0FA 2OEFA 1R7VA 4MYBA 1QG8A 3BRKX 3D98A 3ST8A 1I52A 1HM9A 1ZJ1A 4CJ8A 1H4CA 3SXEA 3U0XA 1TW5A 4O6MA 1FG5N 2ICYA 2Y7AA 4L41C 3PKQA 4Q7CA 3DJ4A 3SXBA 2Y4KA 2YC3A 5HS2A 2GGOA 3I0EA 4Y7FA 2Y4LA 5CQNX 1IIMA 5D91A 2Y4MA 1ZDGA 1H3MA 4Y64A 1OQMB 4FRPA 4HG6A 5CQMX 3OH4A 4FRQA 4EEAA 2P72A 2RIXA 4BMAA 2OEGA 2FYAA 1HJJA 2BO8A 4D11A 5IDSA 5EJZA 4K6RA 1H7LA 3I0DA 3O3PA 2XMHA 3SX7A 2ZU7A 5AJNA 1FGXA 1S4PA 1ZCUA 4B3UA 4XWIA 4B5BA 4KT7A 1FGGA 4FRDA 4FCUA 4AAWA 1FOAA 4DE7A 2VS3A 5CMHA 3ZGFA 5C8RA 2RJ8A 1YP4A 1XZ6A 2AECA 3OH3A 2FYCB 3V90A 2VD4A 2V0KA 4KPXA 1NQIB 4ZDQA 2RIYA 1E5KA 1INIA 3I0KA 1ZI1A 1W77A 1QWJA 3K8EA 2APCA 1NKHB 2MZBA 1ZCVA 2AESA 2YCMA 4Y62A 5C4BA 1S4OA 2AH9A 5C4EA 1JVDA 4B2WA 3USQA 1HV9A 1TW1A 1GX0A 2BO4A 1NHEB 2Q4JA 1H7GA 2ZU8A 4EEMA 2GGQA 1WT0A 2O1GA 1GA8A 3T7NA 5C47A 5I1FA 2WVMA 3OH0A 1EZIA 1FR8A 4DECA 1VZUA 5C4FA 1PZTA 1ZI5A 2RIZA 1O0RA 3V0PA 1G0RA 4EEGA 2X5ZA 3CKJA 1WT3A 4NAKA 4NAIA 4E1KA 4LW3A 2VK9A 5C3DA 4HOCA 4FROA 4KQLA 2A8WA 1G9RA 2XWNA 4KNXA 2XWMA 3CKNA 1FXJA 3ZGGA 1YP2A 5D92A 1VZXA 5C36A 1FRWA 3IOIA 4HO4A 1G97A 4MIXA 3V8ZA 2FY7A 4CVHA 5EJ1A 2V0LA 1JV1A 1Z90A 5L6VA 3U2TA 3U2WA 4HO9A 4Y6NA 1GX4A 1R7YA 1VZTA 1ZJ2A 3I0HA 3U2VA 3Q7UA 5J49A 3I0GA 1G93A 3JUJA 2D0JA 4CJBA 2ICXA 3FOQA 5C49A 4HO3A 2W0WA 1NMMB 4NALA 3KIAA 3V0OA 1LZ0A 2BO7A 1EYRA 5EIYA 4B4GA 2XMEA 3Q4SA 2JCKA 2RJ4A 2Z87A 4KPZA 3V91A 3ZLLA 1K4VA 1LZIA 3FWWA 4FREA 3IOJA 1W57A 2OI6A 1H7FA 2WVLA 5FTVA 1TZFA 3R3IA 4Y7VA 4J18A 4P02A 3SXGA 4C2SA 3T7OA 4B42A 1ON6A 2RITA 2XWLA 3CU0A 4EE3A 3OC9A 4FCEA 5DDVA 2YQJA 1R81A 3CKQA 3D8VA 5CMIA 5C1HA 2DPWA 3DK5A 4Y7GA 4EE5A 3IOHA 4MNDA 1ON8A 4ASYA 2RJ9A 1HJLA 1ZDFA 2JCJA 2E3DA 2NXVA 2I5KA 2UX8A 3U2XA 2PA4A 1FO8A 1VH1A 5CQLX 1ZJPA 2AGDA 4GBPA 1R82A 2WEEA 4Y7UA 3V8YA 4AYLA 1H7HA 1G1LA 4Y63A 1LL0A 1H5SA 3N9WA 1LZJA 1LL2A 1NWGB 1R7UA 1O7OA 1V83A 2W0VA 3T7MA 1PZYB 1VGWA 1VGZA 4YS8A 3U0YA 4AC3A 2PGYA 1GWVA 1ZI3A 2VXLA 4FRLA 1FWYA 1XHBA 2X60A 2RJ0A 1ZI4A 3E25A 3LW6A 4R7PA 3R2WA 4IRPA 4D11C 5C48A 4G3PA 1FZWA 1VICA 4DDZA 4D0TA 1FR9A 1WT1A 1H5SB 4HO0A 1ZHJA 3V0LA 3F1CA 1KWSA 4KRVA 4EVWA 1V84A 5CMGX 3D5NA 1SS9A
chains in the Genus database with same CATH topology
1WT2A 4Y6UA 5IDTA 2Y6PA 3PKPA 2V0IA 4Y7TA 3SXAA 3Q80A 1R7XA 4B4BA 4LW6A 3EE5A 3OH1A 1ZIZA 1YROB 4FRAA 1INJA 1VM8A 2VS4A 2QGIA 1JYKA 5FTSA 4G3QA 3DUVA 2X5SA 3TZTA 2PX7A 1G8OA 1OMXA 3HL3A 3I0CA 1O7QA 1FO9A 3CKVA 3SX5A 3OGZA 2FYDB 2RJ5A 3V0NA 2JCOA 2OI7A 2YQSA 1QGSA 2V0HA 2WGZA 2VFZA 1H7EA 4IRQA 4KXOA 1LZ7A 1OMZA 4ASJA 1G23A 1ZCTA 3V0MA 4HO6A 4FRBA 4JD0A 5FV9A 2AM4A 4HO5A 1LVWA 1H5RA 2AE7A 2P73A 4M4KA 3CKOA 3V0QA 2FFUA 1HM0A 2E8BA 5C1GA 3K8DA 3CGXA 4NANA 3RMWA 4FIXA 2Y4JA 3SPTA 3USRA 1H5SD 2QKXA 1VGTA 4FRMA 2D7RA 1R7TA 2WVKA 4KC2A 2V0JA 1FXOA 5CMFX 4FQWA 5C3AA 1H5RB 3GUEA 4HO8A 1VGUA 5C4DA 5CMJA 3BCVA 3SX8A 2I7BA 1WSZA 4FIYA 2JCLA 2YQCA 1GQ9A 1H4DA 1JV3A 3I0IX 1S4NA 2O1HA 1GWWA 2RJ6A 3PNNA 1JVGA 4HO2A 5C4CA 5BXCA 2YESA 3ZLKA 1MP5A 2CU2A 4M2BA 1NF5B 1H7QA 3OH2A 1GQCA 1G3LA 2FYBA 4KNRA 2FFVA 5AJPA 2J0AA 5L6SA 1MP4A 4HCQA 4B2XA 2P6WA 2I5EA 5FUHA 5CQOA 4EE4A 2YQHA 2QH5A 2OI5A 2BO6A 1O23B 1V82A 1WVCA 5AJOA 2A8UA 3SX3A 1MC3A 2Z86A 3OKRA 4KC1A 4CJCA 2C0NA 2X65A 1H5TA 4ARWA 1VPAA 1YP3A 3ZF8A 1HM8A 4AYJA 3RMVA 2RJ1A 5C3BA 4P00A 1W55A 1QGQA 4B4MA 2YC5A 4M28A 1IINA 4Y9XA 2AM5A 4M2AA 1MP3A 2VSHA 4FRHA 3I0JA 1JYLA 4UEGA 5FYEA 1H4EA 3SXCA 2RJ7A 1ZCYA 5FU8A 2D7IA 4G3SA 2ZU9A 3E26A 3JTJA 3U2UA 3SXDA 5DDTA 1H5TB 4D48A 2O1FA 3JUKA 1LL3A 1ZJ0A 3TQDA 2WE9A 3RSBA 1VH3A 1H5SC 4G87A 2WAWA 3POLA 4BQHA 2PGVA 2VXMA 5FU0A 5IFYA 5JQQA 5C1LA 5CQPA 2J0BA 1ZJ3A 1TVYA 4EEOA 3I0LA 4KC4A 2VS5A 3NGWA 2AM3A 4O6NA 1G2VA 1R80A 4ECMA 1ZJOA 3OAMA 3QVBA 4JISA 5C38A 1G95A 3F1YA 4D0ZA 1H7TA 2VSIA 3I0FA 2OEFA 1R7VA 4MYBA 1QG8A 3BRKX 3D98A 3ST8A 1I52A 1HM9A 1ZJ1A 4CJ8A 1H4CA 3SXEA 3U0XA 1TW5A 4O6MA 1FG5N 2ICYA 2Y7AA 4L41C 3PKQA 4Q7CA 3DJ4A 3SXBA 2Y4KA 2YC3A 5HS2A 2GGOA 3I0EA 4Y7FA 2Y4LA 5CQNX 1IIMA 5D91A 2Y4MA 1ZDGA 1H3MA 4Y64A 1OQMB 4FRPA 4HG6A 5CQMX 3OH4A 4FRQA 4EEAA 2P72A 2RIXA 4BMAA 2OEGA 2FYAA 1HJJA 2BO8A 4D11A 5IDSA 5EJZA 4K6RA 1H7LA 3I0DA 3O3PA 2XMHA 3SX7A 2ZU7A 5AJNA 1FGXA 1S4PA 1ZCUA 4B3UA 4XWIA 4B5BA 4KT7A 1FGGA 4FRDA 4FCUA 4AAWA 1FOAA 4DE7A 2VS3A 5CMHA 3ZGFA 5C8RA 2RJ8A 1YP4A 1XZ6A 2AECA 3OH3A 2FYCB 3V90A 2VD4A 2V0KA 4KPXA 1NQIB 4ZDQA 2RIYA 1E5KA 1INIA 3I0KA 1ZI1A 1W77A 1QWJA 3K8EA 2APCA 1NKHB 2MZBA 1ZCVA 2AESA 2YCMA 4Y62A 5C4BA 1S4OA 2AH9A 5C4EA 1JVDA 4B2WA 3USQA 1HV9A 1TW1A 1GX0A 2BO4A 1NHEB 2Q4JA 1H7GA 2ZU8A 4EEMA 2GGQA 1WT0A 2O1GA 1GA8A 3T7NA 5C47A 5I1FA 2WVMA 3OH0A 1EZIA 1FR8A 4DECA 1VZUA 5C4FA 1PZTA 1ZI5A 2RIZA 1O0RA 3V0PA 1G0RA 4EEGA 2X5ZA 3CKJA 1WT3A 4NAKA 4NAIA 4E1KA 4LW3A 2VK9A 5C3DA 4HOCA 4FROA 4KQLA 2A8WA 1G9RA 2XWNA 4KNXA 2XWMA 3CKNA 1FXJA 3ZGGA 1YP2A 5D92A 1VZXA 5C36A 1FRWA 3IOIA 4HO4A 1G97A 4MIXA 3V8ZA 2FY7A 4CVHA 5EJ1A 2V0LA 1JV1A 1Z90A 5L6VA 3U2TA 3U2WA 4HO9A 4Y6NA 1GX4A 1R7YA 1VZTA 1ZJ2A 3I0HA 3U2VA 3Q7UA 5J49A 3I0GA 1G93A 3JUJA 2D0JA 4CJBA 2ICXA 3FOQA 5C49A 4HO3A 2W0WA 1NMMB 4NALA 3KIAA 3V0OA 1LZ0A 2BO7A 1EYRA 5EIYA 4B4GA 2XMEA 3Q4SA 2JCKA 2RJ4A 2Z87A 4KPZA 3V91A 3ZLLA 1K4VA 1LZIA 3FWWA 4FREA 3IOJA 1W57A 2OI6A 1H7FA 2WVLA 5FTVA 1TZFA 3R3IA 4Y7VA 4J18A 4P02A 3SXGA 4C2SA 3T7OA 4B42A 1ON6A 2RITA 2XWLA 3CU0A 4EE3A 3OC9A 4FCEA 5DDVA 2YQJA 1R81A 3CKQA 3D8VA 5CMIA 5C1HA 2DPWA 3DK5A 4Y7GA 4EE5A 3IOHA 4MNDA 1ON8A 4ASYA 2RJ9A 1HJLA 1ZDFA 2JCJA 2E3DA 2NXVA 2I5KA 2UX8A 3U2XA 2PA4A 1FO8A 1VH1A 5CQLX 1ZJPA 2AGDA 4GBPA 1R82A 2WEEA 4Y7UA 3V8YA 4AYLA 1H7HA 1G1LA 4Y63A 1LL0A 1H5SA 3N9WA 1LZJA 1LL2A 1NWGB 1R7UA 1O7OA 1V83A 2W0VA 3T7MA 1PZYB 1VGWA 1VGZA 4YS8A 3U0YA 4AC3A 2PGYA 1GWVA 1ZI3A 2VXLA 4FRLA 1FWYA 1XHBA 2X60A 2RJ0A 1ZI4A 3E25A 3LW6A 4R7PA 3R2WA 4IRPA 4D11C 5C48A 4G3PA 1FZWA 1VICA 4DDZA 4D0TA 1FR9A 1WT1A 1H5SB 4HO0A 1ZHJA 3V0LA 3F1CA 1KWSA 4KRVA 4EVWA 1V84A 5CMGX 3D5NA 1SS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT2 A;  4Y6U A;  5IDT A;  2Y6P A;  3PKP A;  2V0I A;  4Y7T A;  3SXA A;  3Q80 A;  1R7X A;  4B4B A;  4LW6 A;  3EE5 A;  3OH1 A;  1ZIZ A;  1YRO B;  4FRA A;  1INJ A;  1VM8 A;  2VS4 A;  2QGI A;  1JYK A;  5FTS A;  4G3Q A;  3DUV A;  2X5S A;  3TZT A;  2PX7 A;  1G8O A;  1OMX A;  3HL3 A;  3I0C A;  1O7Q A;  1FO9 A;  3CKV A;  3SX5 A;  3OGZ A;  2FYD B;  2RJ5 A;  3V0N A;  2JCO A;  2OI7 A;  2YQS A;  1QGS A;  2V0H A;  2WGZ A;  2VFZ A;  1H7E A;  4IRQ A;  4KXO A;  1LZ7 A;  1OMZ A;  4ASJ A;  1G23 A;  1ZCT A;  3V0M A;  4HO6 A;  4FRB A;  4JD0 A;  5FV9 A;  2AM4 A;  4HO5 A;  1LVW A;  1H5R A;  2AE7 A;  2P73 A;  4M4K A;  3CKO A;  3V0Q A;  2FFU A;  1HM0 A;  2E8B A;  5C1G A;  3K8D A;  3CGX A;  4NAN A;  3RMW A;  2Y4J A;  3SPT A;  3USR A;  1H5S D;  2QKX A;  1VGT A;  4FRM A;  2D7R A;  1R7T A;  2WVK A;  4KC2 A;  2V0J A;  1FXO A;  5CMF X;  4FQW A;  5C3A A;  1H5R B;  3GUE A;  4HO8 A;  1VGU A;  5C4D A;  5CMJ A;  3BCV A;  3SX8 A;  2I7B A;  1WSZ A;  2JCL A;  2YQC A;  1GQ9 A;  1H4D A;  1JV3 A;  3I0I X;  1S4N A;  2O1H A;  1GWW A;  2RJ6 A;  3PNN A;  1JVG A;  4HO2 A;  5C4C A;  5BXC A;  2YES A;  3ZLK A;  1MP5 A;  2CU2 A;  4M2B A;  1NF5 B;  1H7Q A;  3OH2 A;  1GQC A;  1G3L A;  2FYB A;  4KNR A;  2FFV A;  5AJP A;  5L6S A;  1MP4 A;  4HCQ A;  4B2X A;  2P6W A;  2I5E A;  5FUH A;  5CQO A;  4EE4 A;  2YQH A;  2QH5 A;  2OI5 A;  2BO6 A;  1O23 B;  1V82 A;  1WVC A;  5AJO A;  2A8U A;  3SX3 A;  1MC3 A;  2Z86 A;  3OKR A;  4KC1 A;  4CJC A;  2X65 A;  1H5T A;  4ARW A;  1VPA A;  1YP3 A;  3ZF8 A;  1HM8 A;  4AYJ A;  3RMV A;  2RJ1 A;  5C3B A;  4P00 A;  1W55 A;  1QGQ A;  4B4M A;  2YC5 A;  4M28 A;  1IIN A;  4Y9X A;  2AM5 A;  4M2A A;  1MP3 A;  2VSH A;  4FRH A;  3I0J A;  1JYL A;  4UEG A;  5FYE A;  1H4E A;  3SXC A;  2RJ7 A;  1ZCY A;  5FU8 A;  2D7I A;  4G3S A;  2ZU9 A;  3E26 A;  3JTJ A;  3U2U A;  3SXD A;  5DDT A;  1H5T B;  4D48 A;  2O1F A;  3JUK A;  1LL3 A;  1ZJ0 A;  3TQD A;  2WE9 A;  3RSB A;  1VH3 A;  1H5S C;  4G87 A;  2WAW A;  3POL A;  4BQH A;  2PGV A;  2VXM A;  5FU0 A;  5IFY A;  5JQQ A;  5C1L A;  5CQP A;  1ZJ3 A;  1TVY A;  4EEO A;  3I0L A;  4KC4 A;  2VS5 A;  3NGW A;  2AM3 A;  1G2V A;  1R80 A;  4ECM A;  1ZJO A;  3OAM A;  3QVB A;  4JIS A;  5C38 A;  1G95 A;  3F1Y A;  4D0Z A;  1H7T A;  2VSI A;  3I0F A;  2OEF A;  1R7V A;  4MYB A;  1QG8 A;  3BRK X;  3D98 A;  3ST8 A;  1I52 A;  1HM9 A;  1ZJ1 A;  4CJ8 A;  1H4C A;  3SXE A;  3U0X A;  1TW5 A;  1FG5 N;  2ICY A;  2Y7A A;  4L41 C;  3PKQ A;  3DJ4 A;  3SXB A;  2Y4K A;  2YC3 A;  5HS2 A;  2GGO A;  3I0E A;  4Y7F A;  2Y4L A;  5CQN X;  1IIM A;  2Y4M A;  1ZDG A;  1H3M A;  4Y64 A;  1OQM B;  4FRP A;  4HG6 A;  5CQM X;  3OH4 A;  4FRQ A;  4EEA A;  2P72 A;  2RIX A;  4BMA A;  2OEG A;  2FYA A;  1HJJ A;  2BO8 A;  4D11 A;  5IDS A;  5EJZ A;  4K6R A;  1H7L A;  3I0D A;  3O3P A;  2XMH A;  3SX7 A;  2ZU7 A;  5AJN A;  1FGX A;  1S4P A;  1ZCU A;  4B3U A;  4XWI A;  4B5B A;  4KT7 A;  1FGG A;  4FRD A;  4FCU A;  4AAW A;  1FOA A;  4DE7 A;  2VS3 A;  5CMH A;  3ZGF A;  5C8R A;  2RJ8 A;  1YP4 A;  1XZ6 A;  2AEC A;  3OH3 A;  2FYC B;  3V90 A;  2VD4 A;  2V0K A;  4KPX A;  1NQI B;  4ZDQ A;  2RIY A;  1E5K A;  1INI A;  3I0K A;  1ZI1 A;  1W77 A;  1QWJ A;  3K8E A;  2APC A;  1NKH B;  2MZB A;  1ZCV A;  2AES A;  2YCM A;  4Y62 A;  5C4B A;  1S4O A;  2AH9 A;  5C4E A;  1JVD A;  4B2W A;  3USQ A;  1HV9 A;  1TW1 A;  1GX0 A;  2BO4 A;  1NHE B;  2Q4J A;  1H7G A;  2ZU8 A;  4EEM A;  2GGQ A;  1WT0 A;  2O1G A;  1GA8 A;  3T7N A;  5C47 A;  5I1F A;  2WVM A;  3OH0 A;  1EZI A;  1FR8 A;  4DEC A;  1VZU A;  5C4F A;  1PZT A;  1ZI5 A;  2RIZ A;  1O0R A;  3V0P A;  1G0R A;  4EEG A;  2X5Z A;  3CKJ A;  1WT3 A;  4NAK A;  4NAI A;  4E1K A;  4LW3 A;  5C3D A;  4HOC A;  4FRO A;  4KQL A;  2A8W A;  1G9R A;  2XWN A;  4KNX A;  2XWM A;  3CKN A;  1FXJ A;  3ZGG A;  1YP2 A;  1VZX A;  5C36 A;  1FRW A;  3IOI A;  4HO4 A;  1G97 A;  3V8Z A;  2FY7 A;  4CVH A;  5EJ1 A;  2V0L A;  1JV1 A;  1Z90 A;  5L6V A;  3U2T A;  3U2W A;  4HO9 A;  4Y6N A;  1GX4 A;  1R7Y A;  1VZT A;  1ZJ2 A;  3I0H A;  3U2V A;  3Q7U A;  5J49 A;  3I0G A;  1G93 A;  3JUJ A;  2D0J A;  4CJB A;  2ICX A;  3FOQ A;  5C49 A;  4HO3 A;  2W0W A;  1NMM B;  4NAL A;  3KIA A;  3V0O A;  1LZ0 A;  2BO7 A;  1EYR A;  5EIY A;  4B4G A;  2XME A;  3Q4S A;  2JCK A;  2RJ4 A;  2Z87 A;  4KPZ A;  3V91 A;  3ZLL A;  1K4V A;  1LZI A;  3FWW A;  4FRE A;  3IOJ A;  1W57 A;  2OI6 A;  1H7F A;  2WVL A;  5FTV A;  1TZF A;  3R3I A;  4Y7V A;  4J18 A;  4P02 A;  3SXG A;  4C2S A;  3T7O A;  4B42 A;  1ON6 A;  2RIT A;  2XWL A;  3CU0 A;  4EE3 A;  3OC9 A;  4FCE A;  5DDV A;  2YQJ A;  1R81 A;  3CKQ A;  3D8V A;  5CMI A;  5C1H A;  2DPW A;  3DK5 A;  4Y7G A;  4EE5 A;  3IOH A;  4MND A;  1ON8 A;  4ASY A;  2RJ9 A;  1HJL A;  1ZDF A;  2JCJ A;  2E3D A;  2NXV A;  2I5K A;  2UX8 A;  3U2X A;  2PA4 A;  1FO8 A;  1VH1 A;  5CQL X;  1ZJP A;  2AGD A;  4GBP A;  1R82 A;  2WEE A;  4Y7U A;  3V8Y A;  4AYL A;  1H7H A;  1G1L A;  4Y63 A;  1LL0 A;  1H5S A;  3N9W A;  1LZJ A;  1LL2 A;  1NWG B;  1R7U A;  1O7O A;  1V83 A;  2W0V A;  3T7M A;  1PZY B;  1VGW A;  1VGZ A;  4YS8 A;  3U0Y A;  4AC3 A;  2PGY A;  1GWV A;  1ZI3 A;  2VXL A;  4FRL A;  1FWY A;  1XHB A;  2X60 A;  2RJ0 A;  1ZI4 A;  3E25 A;  3LW6 A;  4R7P A;  3R2W A;  4IRP A;  4D11 C;  5C48 A;  4G3P A;  1FZW A;  1VIC A;  4DDZ A;  4D0T A;  1FR9 A;  1WT1 A;  1H5S B;  4HO0 A;  1ZHJ A;  3V0L A;  3F1C A;  1KWS A;  4KRV A;  4EVW A;  1V84 A;  5CMG X;  3D5N A;  1SS9 A; 
#chains in the Genus database with same CATH topology
 1WT2 A;  4Y6U A;  5IDT A;  2Y6P A;  3PKP A;  2V0I A;  4Y7T A;  3SXA A;  3Q80 A;  1R7X A;  4B4B A;  4LW6 A;  3EE5 A;  3OH1 A;  1ZIZ A;  1YRO B;  4FRA A;  1INJ A;  1VM8 A;  2VS4 A;  2QGI A;  1JYK A;  5FTS A;  4G3Q A;  3DUV A;  2X5S A;  3TZT A;  2PX7 A;  1G8O A;  1OMX A;  3HL3 A;  3I0C A;  1O7Q A;  1FO9 A;  3CKV A;  3SX5 A;  3OGZ A;  2FYD B;  2RJ5 A;  3V0N A;  2JCO A;  2OI7 A;  2YQS A;  1QGS A;  2V0H A;  2WGZ A;  2VFZ A;  1H7E A;  4IRQ A;  4KXO A;  1LZ7 A;  1OMZ A;  4ASJ A;  1G23 A;  1ZCT A;  3V0M A;  4HO6 A;  4FRB A;  4JD0 A;  5FV9 A;  2AM4 A;  4HO5 A;  1LVW A;  1H5R A;  2AE7 A;  2P73 A;  4M4K A;  3CKO A;  3V0Q A;  2FFU A;  1HM0 A;  2E8B A;  5C1G A;  3K8D A;  3CGX A;  4NAN A;  3RMW A;  4FIX A;  2Y4J A;  3SPT A;  3USR A;  1H5S D;  2QKX A;  1VGT A;  4FRM A;  2D7R A;  1R7T A;  2WVK A;  4KC2 A;  2V0J A;  1FXO A;  5CMF X;  4FQW A;  5C3A A;  1H5R B;  3GUE A;  4HO8 A;  1VGU A;  5C4D A;  5CMJ A;  3BCV A;  3SX8 A;  2I7B A;  1WSZ A;  4FIY A;  2JCL A;  2YQC A;  1GQ9 A;  1H4D A;  1JV3 A;  3I0I X;  1S4N A;  2O1H A;  1GWW A;  2RJ6 A;  3PNN A;  1JVG A;  4HO2 A;  5C4C A;  5BXC A;  2YES A;  3ZLK A;  1MP5 A;  2CU2 A;  4M2B A;  1NF5 B;  1H7Q A;  3OH2 A;  1GQC A;  1G3L A;  2FYB A;  4KNR A;  2FFV A;  5AJP A;  2J0A A;  5L6S A;  1MP4 A;  4HCQ A;  4B2X A;  2P6W A;  2I5E A;  5FUH A;  5CQO A;  4EE4 A;  2YQH A;  2QH5 A;  2OI5 A;  2BO6 A;  1O23 B;  1V82 A;  1WVC A;  5AJO A;  2A8U A;  3SX3 A;  1MC3 A;  2Z86 A;  3OKR A;  4KC1 A;  4CJC A;  2C0N A;  2X65 A;  1H5T A;  4ARW A;  1VPA A;  1YP3 A;  3ZF8 A;  1HM8 A;  4AYJ A;  3RMV A;  2RJ1 A;  5C3B A;  4P00 A;  1W55 A;  1QGQ A;  4B4M A;  2YC5 A;  4M28 A;  1IIN A;  4Y9X A;  2AM5 A;  4M2A A;  1MP3 A;  2VSH A;  4FRH A;  3I0J A;  1JYL A;  4UEG A;  5FYE A;  1H4E A;  3SXC A;  2RJ7 A;  1ZCY A;  5FU8 A;  2D7I A;  4G3S A;  2ZU9 A;  3E26 A;  3JTJ A;  3U2U A;  3SXD A;  5DDT A;  1H5T B;  4D48 A;  2O1F A;  3JUK A;  1LL3 A;  1ZJ0 A;  3TQD A;  2WE9 A;  3RSB A;  1VH3 A;  1H5S C;  4G87 A;  2WAW A;  3POL A;  4BQH A;  2PGV A;  2VXM A;  5FU0 A;  5IFY A;  5JQQ A;  5C1L A;  5CQP A;  2J0B A;  1ZJ3 A;  1TVY A;  4EEO A;  3I0L A;  4KC4 A;  2VS5 A;  3NGW A;  2AM3 A;  4O6N A;  1G2V A;  1R80 A;  4ECM A;  1ZJO A;  3OAM A;  3QVB A;  4JIS A;  5C38 A;  1G95 A;  3F1Y A;  4D0Z A;  1H7T A;  2VSI A;  3I0F A;  2OEF A;  1R7V A;  4MYB A;  1QG8 A;  3BRK X;  3D98 A;  3ST8 A;  1I52 A;  1HM9 A;  1ZJ1 A;  4CJ8 A;  1H4C A;  3SXE A;  3U0X A;  1TW5 A;  4O6M A;  1FG5 N;  2ICY A;  2Y7A A;  4L41 C;  3PKQ A;  4Q7C A;  3DJ4 A;  3SXB A;  2Y4K A;  2YC3 A;  5HS2 A;  2GGO A;  3I0E A;  4Y7F A;  2Y4L A;  5CQN X;  1IIM A;  5D91 A;  2Y4M A;  1ZDG A;  1H3M A;  4Y64 A;  1OQM B;  4FRP A;  4HG6 A;  5CQM X;  3OH4 A;  4FRQ A;  4EEA A;  2P72 A;  2RIX A;  4BMA A;  2OEG A;  2FYA A;  1HJJ A;  2BO8 A;  4D11 A;  5IDS A;  5EJZ A;  4K6R A;  1H7L A;  3I0D A;  3O3P A;  2XMH A;  3SX7 A;  2ZU7 A;  5AJN A;  1FGX A;  1S4P A;  1ZCU A;  4B3U A;  4XWI A;  4B5B A;  4KT7 A;  1FGG A;  4FRD A;  4FCU A;  4AAW A;  1FOA A;  4DE7 A;  2VS3 A;  5CMH A;  3ZGF A;  5C8R A;  2RJ8 A;  1YP4 A;  1XZ6 A;  2AEC A;  3OH3 A;  2FYC B;  3V90 A;  2VD4 A;  2V0K A;  4KPX A;  1NQI B;  4ZDQ A;  2RIY A;  1E5K A;  1INI A;  3I0K A;  1ZI1 A;  1W77 A;  1QWJ A;  3K8E A;  2APC A;  1NKH B;  2MZB A;  1ZCV A;  2AES A;  2YCM A;  4Y62 A;  5C4B A;  1S4O A;  2AH9 A;  5C4E A;  1JVD A;  4B2W A;  3USQ A;  1HV9 A;  1TW1 A;  1GX0 A;  2BO4 A;  1NHE B;  2Q4J A;  1H7G A;  2ZU8 A;  4EEM A;  2GGQ A;  1WT0 A;  2O1G A;  1GA8 A;  3T7N A;  5C47 A;  5I1F A;  2WVM A;  3OH0 A;  1EZI A;  1FR8 A;  4DEC A;  1VZU A;  5C4F A;  1PZT A;  1ZI5 A;  2RIZ A;  1O0R A;  3V0P A;  1G0R A;  4EEG A;  2X5Z A;  3CKJ A;  1WT3 A;  4NAK A;  4NAI A;  4E1K A;  4LW3 A;  2VK9 A;  5C3D A;  4HOC A;  4FRO A;  4KQL A;  2A8W A;  1G9R A;  2XWN A;  4KNX A;  2XWM A;  3CKN A;  1FXJ A;  3ZGG A;  1YP2 A;  5D92 A;  1VZX A;  5C36 A;  1FRW A;  3IOI A;  4HO4 A;  1G97 A;  4MIX A;  3V8Z A;  2FY7 A;  4CVH A;  5EJ1 A;  2V0L A;  1JV1 A;  1Z90 A;  5L6V A;  3U2T A;  3U2W A;  4HO9 A;  4Y6N A;  1GX4 A;  1R7Y A;  1VZT A;  1ZJ2 A;  3I0H A;  3U2V A;  3Q7U A;  5J49 A;  3I0G A;  1G93 A;  3JUJ A;  2D0J A;  4CJB A;  2ICX A;  3FOQ A;  5C49 A;  4HO3 A;  2W0W A;  1NMM B;  4NAL A;  3KIA A;  3V0O A;  1LZ0 A;  2BO7 A;  1EYR A;  5EIY A;  4B4G A;  2XME A;  3Q4S A;  2JCK A;  2RJ4 A;  2Z87 A;  4KPZ A;  3V91 A;  3ZLL A;  1K4V A;  1LZI A;  3FWW A;  4FRE A;  3IOJ A;  1W57 A;  2OI6 A;  1H7F A;  2WVL A;  5FTV A;  1TZF A;  3R3I A;  4Y7V A;  4J18 A;  4P02 A;  3SXG A;  4C2S A;  3T7O A;  4B42 A;  1ON6 A;  2RIT A;  2XWL A;  3CU0 A;  4EE3 A;  3OC9 A;  4FCE A;  5DDV A;  2YQJ A;  1R81 A;  3CKQ A;  3D8V A;  5CMI A;  5C1H A;  2DPW A;  3DK5 A;  4Y7G A;  4EE5 A;  3IOH A;  4MND A;  1ON8 A;  4ASY A;  2RJ9 A;  1HJL A;  1ZDF A;  2JCJ A;  2E3D A;  2NXV A;  2I5K A;  2UX8 A;  3U2X A;  2PA4 A;  1FO8 A;  1VH1 A;  5CQL X;  1ZJP A;  2AGD A;  4GBP A;  1R82 A;  2WEE A;  4Y7U A;  3V8Y A;  4AYL A;  1H7H A;  1G1L A;  4Y63 A;  1LL0 A;  1H5S A;  3N9W A;  1LZJ A;  1LL2 A;  1NWG B;  1R7U A;  1O7O A;  1V83 A;  2W0V A;  3T7M A;  1PZY B;  1VGW A;  1VGZ A;  4YS8 A;  3U0Y A;  4AC3 A;  2PGY A;  1GWV A;  1ZI3 A;  2VXL A;  4FRL A;  1FWY A;  1XHB A;  2X60 A;  2RJ0 A;  1ZI4 A;  3E25 A;  3LW6 A;  4R7P A;  3R2W A;  4IRP A;  4D11 C;  5C48 A;  4G3P A;  1FZW A;  1VIC A;  4DDZ A;  4D0T A;  1FR9 A;  1WT1 A;  1H5S B;  4HO0 A;  1ZHJ A;  3V0L A;  3F1C A;  1KWS A;  4KRV A;  4EVW A;  1V84 A;  5CMG X;  3D5N A;  1SS9 A; 
#chains in the Genus database with same CATH homology
 1WT2 A;  4Y6U A;  5IDT A;  2Y6P A;  3PKP A;  2V0I A;  4Y7T A;  3SXA A;  3Q80 A;  1R7X A;  4B4B A;  4LW6 A;  3EE5 A;  3OH1 A;  1ZIZ A;  1YRO B;  4FRA A;  1INJ A;  1VM8 A;  2VS4 A;  2QGI A;  1JYK A;  5FTS A;  4G3Q A;  3DUV A;  2X5S A;  3TZT A;  2PX7 A;  1G8O A;  1OMX A;  3HL3 A;  3I0C A;  1O7Q A;  1FO9 A;  3CKV A;  3SX5 A;  3OGZ A;  2FYD B;  2RJ5 A;  3V0N A;  2JCO A;  2OI7 A;  2YQS A;  1QGS A;  2V0H A;  2WGZ A;  2VFZ A;  1H7E A;  4IRQ A;  4KXO A;  1LZ7 A;  1OMZ A;  4ASJ A;  1G23 A;  1ZCT A;  3V0M A;  4HO6 A;  4FRB A;  4JD0 A;  5FV9 A;  2AM4 A;  4HO5 A;  1LVW A;  1H5R A;  2AE7 A;  2P73 A;  4M4K A;  3CKO A;  3V0Q A;  2FFU A;  1HM0 A;  2E8B A;  5C1G A;  3K8D A;  3CGX A;  4NAN A;  3RMW A;  4FIX A;  2Y4J A;  3SPT A;  3USR A;  1H5S D;  2QKX A;  1VGT A;  4FRM A;  2D7R A;  1R7T A;  2WVK A;  4KC2 A;  2V0J A;  1FXO A;  5CMF X;  4FQW A;  5C3A A;  1H5R B;  3GUE A;  4HO8 A;  1VGU A;  5C4D A;  5CMJ A;  3BCV A;  3SX8 A;  2I7B A;  1WSZ A;  4FIY A;  2JCL A;  2YQC A;  1GQ9 A;  1H4D A;  1JV3 A;  3I0I X;  1S4N A;  2O1H A;  1GWW A;  2RJ6 A;  3PNN A;  1JVG A;  4HO2 A;  5C4C A;  5BXC A;  2YES A;  3ZLK A;  1MP5 A;  2CU2 A;  4M2B A;  1NF5 B;  1H7Q A;  3OH2 A;  1GQC A;  1G3L A;  2FYB A;  4KNR A;  2FFV A;  5AJP A;  2J0A A;  5L6S A;  1MP4 A;  4HCQ A;  4B2X A;  2P6W A;  2I5E A;  5FUH A;  5CQO A;  4EE4 A;  2YQH A;  2QH5 A;  2OI5 A;  2BO6 A;  1O23 B;  1V82 A;  1WVC A;  5AJO A;  2A8U A;  3SX3 A;  1MC3 A;  2Z86 A;  3OKR A;  4KC1 A;  4CJC A;  2C0N A;  2X65 A;  1H5T A;  4ARW A;  1VPA A;  1YP3 A;  3ZF8 A;  1HM8 A;  4AYJ A;  3RMV A;  2RJ1 A;  5C3B A;  4P00 A;  1W55 A;  1QGQ A;  4B4M A;  2YC5 A;  4M28 A;  1IIN A;  4Y9X A;  2AM5 A;  4M2A A;  1MP3 A;  2VSH A;  4FRH A;  3I0J A;  1JYL A;  4UEG A;  5FYE A;  1H4E A;  3SXC A;  2RJ7 A;  1ZCY A;  5FU8 A;  2D7I A;  4G3S A;  2ZU9 A;  3E26 A;  3JTJ A;  3U2U A;  3SXD A;  5DDT A;  1H5T B;  4D48 A;  2O1F A;  3JUK A;  1LL3 A;  1ZJ0 A;  3TQD A;  2WE9 A;  3RSB A;  1VH3 A;  1H5S C;  4G87 A;  2WAW A;  3POL A;  4BQH A;  2PGV A;  2VXM A;  5FU0 A;  5IFY A;  5JQQ A;  5C1L A;  5CQP A;  2J0B A;  1ZJ3 A;  1TVY A;  4EEO A;  3I0L A;  4KC4 A;  2VS5 A;  3NGW A;  2AM3 A;  4O6N A;  1G2V A;  1R80 A;  4ECM A;  1ZJO A;  3OAM A;  3QVB A;  4JIS A;  5C38 A;  1G95 A;  3F1Y A;  4D0Z A;  1H7T A;  2VSI A;  3I0F A;  2OEF A;  1R7V A;  4MYB A;  1QG8 A;  3BRK X;  3D98 A;  3ST8 A;  1I52 A;  1HM9 A;  1ZJ1 A;  4CJ8 A;  1H4C A;  3SXE A;  3U0X A;  1TW5 A;  4O6M A;  1FG5 N;  2ICY A;  2Y7A A;  4L41 C;  3PKQ A;  4Q7C A;  3DJ4 A;  3SXB A;  2Y4K A;  2YC3 A;  5HS2 A;  2GGO A;  3I0E A;  4Y7F A;  2Y4L A;  5CQN X;  1IIM A;  5D91 A;  2Y4M A;  1ZDG A;  1H3M A;  4Y64 A;  1OQM B;  4FRP A;  4HG6 A;  5CQM X;  3OH4 A;  4FRQ A;  4EEA A;  2P72 A;  2RIX A;  4BMA A;  2OEG A;  2FYA A;  1HJJ A;  2BO8 A;  4D11 A;  5IDS A;  5EJZ A;  4K6R A;  1H7L A;  3I0D A;  3O3P A;  2XMH A;  3SX7 A;  2ZU7 A;  5AJN A;  1FGX A;  1S4P A;  1ZCU A;  4B3U A;  4XWI A;  4B5B A;  4KT7 A;  1FGG A;  4FRD A;  4FCU A;  4AAW A;  1FOA A;  4DE7 A;  2VS3 A;  5CMH A;  3ZGF A;  5C8R A;  2RJ8 A;  1YP4 A;  1XZ6 A;  2AEC A;  3OH3 A;  2FYC B;  3V90 A;  2VD4 A;  2V0K A;  4KPX A;  1NQI B;  4ZDQ A;  2RIY A;  1E5K A;  1INI A;  3I0K A;  1ZI1 A;  1W77 A;  1QWJ A;  3K8E A;  2APC A;  1NKH B;  2MZB A;  1ZCV A;  2AES A;  2YCM A;  4Y62 A;  5C4B A;  1S4O A;  2AH9 A;  5C4E A;  1JVD A;  4B2W A;  3USQ A;  1HV9 A;  1TW1 A;  1GX0 A;  2BO4 A;  1NHE B;  2Q4J A;  1H7G A;  2ZU8 A;  4EEM A;  2GGQ A;  1WT0 A;  2O1G A;  1GA8 A;  3T7N A;  5C47 A;  5I1F A;  2WVM A;  3OH0 A;  1EZI A;  1FR8 A;  4DEC A;  1VZU A;  5C4F A;  1PZT A;  1ZI5 A;  2RIZ A;  1O0R A;  3V0P A;  1G0R A;  4EEG A;  2X5Z A;  3CKJ A;  1WT3 A;  4NAK A;  4NAI A;  4E1K A;  4LW3 A;  2VK9 A;  5C3D A;  4HOC A;  4FRO A;  4KQL A;  2A8W A;  1G9R A;  2XWN A;  4KNX A;  2XWM A;  3CKN A;  1FXJ A;  3ZGG A;  1YP2 A;  5D92 A;  1VZX A;  5C36 A;  1FRW A;  3IOI A;  4HO4 A;  1G97 A;  4MIX A;  3V8Z A;  2FY7 A;  4CVH A;  5EJ1 A;  2V0L A;  1JV1 A;  1Z90 A;  5L6V A;  3U2T A;  3U2W A;  4HO9 A;  4Y6N A;  1GX4 A;  1R7Y A;  1VZT A;  1ZJ2 A;  3I0H A;  3U2V A;  3Q7U A;  5J49 A;  3I0G A;  1G93 A;  3JUJ A;  2D0J A;  4CJB A;  2ICX A;  3FOQ A;  5C49 A;  4HO3 A;  2W0W A;  1NMM B;  4NAL A;  3KIA A;  3V0O A;  1LZ0 A;  2BO7 A;  1EYR A;  5EIY A;  4B4G A;  2XME A;  3Q4S A;  2JCK A;  2RJ4 A;  2Z87 A;  4KPZ A;  3V91 A;  3ZLL A;  1K4V A;  1LZI A;  3FWW A;  4FRE A;  3IOJ A;  1W57 A;  2OI6 A;  1H7F A;  2WVL A;  5FTV A;  1TZF A;  3R3I A;  4Y7V A;  4J18 A;  4P02 A;  3SXG A;  4C2S A;  3T7O A;  4B42 A;  1ON6 A;  2RIT A;  2XWL A;  3CU0 A;  4EE3 A;  3OC9 A;  4FCE A;  5DDV A;  2YQJ A;  1R81 A;  3CKQ A;  3D8V A;  5CMI A;  5C1H A;  2DPW A;  3DK5 A;  4Y7G A;  4EE5 A;  3IOH A;  4MND A;  1ON8 A;  4ASY A;  2RJ9 A;  1HJL A;  1ZDF A;  2JCJ A;  2E3D A;  2NXV A;  2I5K A;  2UX8 A;  3U2X A;  2PA4 A;  1FO8 A;  1VH1 A;  5CQL X;  1ZJP A;  2AGD A;  4GBP A;  1R82 A;  2WEE A;  4Y7U A;  3V8Y A;  4AYL A;  1H7H A;  1G1L A;  4Y63 A;  1LL0 A;  1H5S A;  3N9W A;  1LZJ A;  1LL2 A;  1NWG B;  1R7U A;  1O7O A;  1V83 A;  2W0V A;  3T7M A;  1PZY B;  1VGW A;  1VGZ A;  4YS8 A;  3U0Y A;  4AC3 A;  2PGY A;  1GWV A;  1ZI3 A;  2VXL A;  4FRL A;  1FWY A;  1XHB A;  2X60 A;  2RJ0 A;  1ZI4 A;  3E25 A;  3LW6 A;  4R7P A;  3R2W A;  4IRP A;  4D11 C;  5C48 A;  4G3P A;  1FZW A;  1VIC A;  4DDZ A;  4D0T A;  1FR9 A;  1WT1 A;  1H5S B;  4HO0 A;  1ZHJ A;  3V0L A;  3F1C A;  1KWS A;  4KRV A;  4EVW A;  1V84 A;  5CMG X;  3D5N A;  1SS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...