1S4PA

Crystal structure of yeast alpha1,2-mannosyltransferase kre2p/mnt1p: ternary complex with gdp/mn and methyl-alpha-mannoside acceptor
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
339
structure length
335
Chain Sequence
KTTMDYITPSFGKPKACYVTLVRNKELKGLLSSIKYVENKINKKFPYPWVFLNDEPFTEEFKEAVTKAVSSEVKFGILPKEHWSYPEWINQTKAAEIRADAATKYIYGGSESYRHMCRYQSGFFWRHELLEEYDWYWRVEPDIKLYCDINYDVFKWMQENEKVYGFTVSIHEYEVTIPTLWQTSMDFIKKNPEYLDENNLMSFLSNDNGKTYNLCHFWSNFEIANLNLWRSPAYREYFDTLDHQGGFFYERWGDAPVHSIAAALFLPKDKIHYFSDIGYHHPPYDNCPLDKEVYNSNNCECDQGNDFTFQGYSCGKEYYDAQGLVKPKNWKKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycolipid 2-alpha-mannosyltransferase
publication title Structure of Kre2p/Mnt1p: A YEAST {alpha}1,2-MANNOSYLTRANSFERASE INVOLVED IN MANNOPROTEIN BIOSYNTHESIS
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 133
structure length 335
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.4.1.131: GDP-Man:Man(3)GlcNAc(2)-PP-dolichol alpha-1,2-mannosyltransferase.
pdb deposition date 2004-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1s4pA00
3BRKX 1SS9A 4KQLA 2AM5A 3V0PA 3U2XA 1EZIA 3DUVA 2QH5A 1KWSA 1FXJA 3CKOA 4Y6UA 1NWGB 4HO8A 3ZLLA 4KPXA 5C1LA 5CMGX 1TVYA 3D5NA 2I5EA 1G97A 4KNXA 4HG6A 4HOCA 1O7QA 1VZUA 1INJA 1FGGA 1ON6A 2WGZA 3V0OA 4ECMA 4M2AA 4FCEA 1FR9A 1YP3A 1MP3A 2OEFA 4ARWA 2PGYA 1TZFA 1ZI5A 3TQDA 2VXLA 5IDTA 1ZCYA 1JYKA 2Y4KA 1VGZA 1H7FA 5C4FA 1ZCVA 3RMVA 1FZWA 4XWIA 2BO7A 4ZDQA 5FV9A 2X60A 2Y4MA 4EE4A 4NANA 1INIA 5C1GA 1QGQA 2RJ6A 4KXOA 5I1FA 4FRDA 3DJ4A 4EEGA 3BCVA 2E8BA 4HO6A 1H5SB 2W0WA 2YC5A 2D0JA 4MYBA 2XMEA 3T7NA 3V8YA 2E3DA 1W77A 2D7RA 2Y4LA 2WAWA 2RIYA 1G2VA 3PNNA 2VXMA 1O23B 3OKRA 3Q7UA 3OH0A 3K8EA 1Z90A 1WSZA 2AE7A 4KC1A 2O1FA 3USQA 4FCUA 3K8DA 4LW3A 1O0RA 4Y7TA 4D0TA 2Y7AA 2MZBA 2FYBA 1VZXA 2RJ1A 4B4GA 3OGZA 4Y9XA 3V0QA 4B5BA 3GUEA 1HJLA 1E5KA 2ZU8A 2RIZA 3Q80A 2AESA 2OI6A 4Y7VA 3V90A 1ZCUA 1MC3A 3T7MA 1NHEB 5C47A 4B4MA 2WVMA 3U2VA 1FO8A 1VPAA 1H5RB 3ZGGA 4AYJA 3I0IX 1LZJA 3ZF8A 3T7OA 5C49A 3SXAA 4FQWA 2RITA 5C4CA 4JISA 3E26A 4FRPA 4FRAA 4AC3A 2P73A 1S4PA 4B2WA 3SXEA 2W0VA 2ZU9A 1S4OA 1V84A 2RIXA 2ZU7A 4EE3A 3IOIA 5C38A 5DDVA 3RSBA 1R7YA 1VM8A 2FFUA 3I0DA 2WVKA 1VGWA 1ZDFA 1JVGA 1GX4A 5JQQA 4AAWA 4Y7GA 3PKQA 3OC9A 3V0MA 2A8WA 1H7EA 3TZTA 2ICXA 1ZCTA 1ZI3A 3RMWA 3U2UA 5AJNA 1V82A 4K6RA 4L41C 1R81A 5CMIA 4NALA 3I0FA 2GGQA 4Y63A 2A8UA 2AM3A 4HO9A 2JCLA 4DE7A 1NKHB 2FYCB 1LL3A 4G3QA 5C48A 1V83A 3FOQA 1TW1A 2QGIA 5DDTA 3I0JA 4B42A 5C36A 2AGDA 1ZJPA 3D8VA 4CJCA 3EE5A 4Y6NA 4B3UA 1HJJA 2OI7A 3U2TA 1ZJ0A 2P6WA 1VGTA 3SXDA 1LL2A 3SX7A 3I0LA 3U0XA 2DPWA 4HO2A 4G3PA 3USRA 4CVHA 1MP4A 3Q4SA 3O3PA 3IOJA 1G8OA 5FUHA 4P02A 5C3DA 2VD4A 4M28A 5IDSA 5C3BA 1XHBA 3JUKA 5EIYA 1GA8A 1W57A 3NGWA 4G3SA 4Y62A 1O7OA 3SX3A 1QWJA 1G9RA 4AYLA 3PKPA 5EJZA 4FREA 1NF5B 1JV3A 4NAIA 4J18A 4CJ8A 5C4BA 4FRBA 1G93A 3F1YA 4ASJA 3ZGFA 1H7GA 2BO4A 3OAMA 1ZJ2A 2VFZA 4NAKA 1EYRA 1VH3A 4DDZA 2V0LA 3LW6A 1XZ6A 1JV1A 4HO3A 5CQMX 1IIMA 2VS5A 1WT0A 5C4DA 1LZ0A 3I0HA 2YC3A 1YROB 1H5SA 1LVWA 4E1KA 1G23A 1GQCA 4KT7A 1FGXA 2PGVA 4KC4A 3QVBA 1HV9A 4FRLA 5L6VA 2V0IA 1H4DA 5FTVA 4FRQA 4R7PA 3JUJA 2FYAA 4D48A 4KPZA 1H3MA 1W55A 1GQ9A 4C2SA 1ZIZA 4KRVA 4P00A 4FROA 1OMXA 1ZDGA 3E25A 2D7IA 2APCA 1G95A 2AM4A 5AJPA 3CKQA 4D11C 2I5KA 4KNRA 2XWLA 1JYLA 2JCOA 1FWYA 5FU0A 4EE5A 3OH2A 1I52A 3I0KA 2O1GA 3U0YA 3OH4A 3SPTA 5J49A 1R7TA 1H5TA 2YQJA 3V0NA 1LL0A 1G0RA 2YCMA 1H5SC 3I0CA 3KIAA 3V8ZA 3V0LA 2V0HA 2VS3A 1JVDA 5IFYA 2X5ZA 2PA4A 1FO9A 2FFVA 3IOHA 4IRPA 2V0JA 1HM8A 3SXGA 5FYEA 3CKJA 2WE9A 5FU8A 1FG5N 1ON8A 4B4BA 4EVWA 1GWWA 4DECA 4BMAA 5BXCA 2AECA 1MP5A 3V91A 3CKNA 2WVLA 1G1LA 5CQNX 1R7XA 4BQHA 3N9WA 2UX8A 1R7VA 1H5SD 2OI5A 2BO8A 1QG8A 2XMHA 3JTJA 1VICA 2PX7A 3OH1A 1HM0A 4B2XA 5CMHA 3SX5A 4IRQA 4M4KA 3SXCA 3I0GA 5C3AA 1LZ7A 4EEOA 1IINA 3CU0A 4HO0A 1ZJ3A 4G87A 2GGOA 2P72A 3FWWA 1ZHJA 1YP4A 1R7UA 1GWVA 4Y64A 1HM9A 3OH3A 1VZTA 2JCJA 4UEGA 5CQPA 4FRMA 4EEMA 3I0EA 1WT1A 2XWNA 1R80A 4HO4A 1WT3A 4D11A 1PZYB 1H7TA 4HO5A 1ZI1A 2X5SA 3D98A 1H7HA 1S4NA 5CQOA 5HS2A 1H7QA 4ASYA 4KC2A 3SX8A 2VS4A 1FRWA 2YQSA 1PZTA 2BO6A 2CU2A 2I7BA 2QKXA 2AH9A 2RJ9A 5C4EA 1FXOA 1YP2A 2RJ7A 1G3LA 2Z87A 5EJ1A 2FY7A 2OEGA 1ZJ1A 1FOAA 1ZJOA 5L6SA 2Z86A 2VSIA 3DK5A 1WT2A 3U2WA 1LZIA 3CGXA 2ICYA 1OQMB 4JD0A 1H7LA 2XWMA 1GX0A 5FTSA 2O1HA 2Y4JA 2YQCA 1FR8A 2WEEA 3R2WA 2NXVA 5C8RA 4MNDA 4LW6A 4Y7UA 2X65A 5C1HA 3F1CA 3HL3A 1WVCA 2RJ4A 1H5TB 1VGUA 1NMMB 1ZI4A 2FYDB 3ZLKA 4FRHA 4Y7FA 2RJ0A 1TW5A 2RJ5A 2YESA 1QGSA 4EEAA 2RJ8A 2Q4JA 1H4CA 1NQIB 1R82A 1VH1A 4GBPA 4M2BA 2V0KA 3R3IA 5CQLX 3ST8A 1H5RA 5AJOA 3POLA 2YQHA 1K4VA 3CKVA 4YS8A 5CMJA 2VSHA 5CMFX 2JCKA 4CJBA 1H4EA 3SXBA 2Y6PA 4HCQA 4D0ZA 1OMZA
chains in the Genus database with same CATH superfamily
3BRKX 1SS9A 4KQLA 2AM5A 3V0PA 3U2XA 1EZIA 3DUVA 2QH5A 1KWSA 1FXJA 3CKOA 4Y6UA 1NWGB 4HO8A 3ZLLA 4KPXA 5C1LA 5CMGX 1TVYA 3D5NA 2I5EA 1G97A 4KNXA 4HG6A 4HOCA 1O7QA 1VZUA 1INJA 1FGGA 1ON6A 2WGZA 3V0OA 4ECMA 4M2AA 4FCEA 1FR9A 1YP3A 1MP3A 2OEFA 4ARWA 2PGYA 1TZFA 1ZI5A 3TQDA 2VXLA 5IDTA 1ZCYA 1JYKA 2Y4KA 1VGZA 2C0NA 1H7FA 5C4FA 1ZCVA 3RMVA 1FZWA 4XWIA 2BO7A 4ZDQA 5FV9A 2X60A 2Y4MA 4EE4A 4NANA 1INIA 5C1GA 1QGQA 2RJ6A 4KXOA 5I1FA 4FRDA 3DJ4A 4EEGA 3BCVA 2E8BA 4HO6A 1H5SB 2W0WA 2YC5A 2D0JA 4MYBA 2XMEA 3T7NA 3V8YA 2E3DA 1W77A 2D7RA 2Y4LA 2WAWA 2RIYA 1G2VA 3PNNA 2VXMA 1O23B 3OKRA 3Q7UA 3OH0A 3K8EA 1Z90A 1WSZA 2AE7A 4KC1A 2O1FA 3USQA 4FCUA 3K8DA 4LW3A 1O0RA 4Y7TA 4D0TA 2Y7AA 2MZBA 2FYBA 1VZXA 2RJ1A 4B4GA 3OGZA 4Y9XA 3V0QA 4B5BA 3GUEA 1HJLA 1E5KA 2ZU8A 2RIZA 3Q80A 2AESA 2OI6A 4Y7VA 3V90A 1ZCUA 1MC3A 3T7MA 1NHEB 5C47A 4B4MA 2WVMA 3U2VA 1FO8A 1VPAA 1H5RB 3ZGGA 4AYJA 3I0IX 1LZJA 3ZF8A 3T7OA 5C49A 3SXAA 4FQWA 2RITA 5C4CA 4JISA 3E26A 4FRPA 4FRAA 4AC3A 2P73A 1S4PA 4B2WA 3SXEA 2W0VA 2ZU9A 1S4OA 1V84A 2RIXA 2ZU7A 4EE3A 3IOIA 5C38A 5DDVA 3RSBA 1R7YA 1VM8A 2FFUA 3I0DA 2WVKA 1VGWA 1ZDFA 1JVGA 1GX4A 5JQQA 4AAWA 4Y7GA 3PKQA 3OC9A 3V0MA 2A8WA 1H7EA 3TZTA 2ICXA 1ZCTA 1ZI3A 3RMWA 3U2UA 5AJNA 4O6MA 1V82A 4K6RA 4L41C 1R81A 5CMIA 4NALA 3I0FA 2GGQA 4Y63A 2A8UA 2AM3A 4HO9A 2JCLA 4DE7A 1NKHB 2FYCB 1LL3A 4G3QA 5C48A 1V83A 3FOQA 1TW1A 2QGIA 5DDTA 3I0JA 4B42A 5C36A 2AGDA 1ZJPA 3D8VA 4CJCA 3EE5A 4Y6NA 4B3UA 1HJJA 2OI7A 3U2TA 1ZJ0A 2P6WA 1VGTA 3SXDA 1LL2A 3SX7A 3I0LA 3U0XA 2DPWA 4HO2A 4G3PA 3USRA 4CVHA 1MP4A 3Q4SA 3O3PA 3IOJA 1G8OA 5FUHA 4P02A 5C3DA 2VD4A 4M28A 5IDSA 5C3BA 1XHBA 3JUKA 5EIYA 1GA8A 1W57A 3NGWA 4G3SA 4Y62A 1O7OA 3SX3A 1QWJA 1G9RA 4AYLA 3PKPA 5EJZA 4FREA 1NF5B 1JV3A 4NAIA 4J18A 4CJ8A 5C4BA 4FRBA 1G93A 3F1YA 4ASJA 3ZGFA 1H7GA 2BO4A 3OAMA 1ZJ2A 5D92A 2VFZA 4NAKA 1EYRA 1VH3A 4DDZA 2V0LA 3LW6A 1XZ6A 1JV1A 4HO3A 5CQMX 1IIMA 2VS5A 1WT0A 5C4DA 1LZ0A 3I0HA 2YC3A 1YROB 1H5SA 1LVWA 4E1KA 1G23A 1GQCA 4KT7A 1FGXA 2PGVA 4KC4A 3QVBA 1HV9A 4FRLA 5L6VA 2V0IA 1H4DA 4FIXA 5FTVA 4FRQA 4R7PA 3JUJA 2FYAA 4D48A 4KPZA 1H3MA 1W55A 1GQ9A 4C2SA 1ZIZA 4KRVA 4P00A 4FROA 1OMXA 1ZDGA 3E25A 2D7IA 5D91A 2APCA 1G95A 2AM4A 5AJPA 3CKQA 4D11C 2I5KA 4KNRA 2XWLA 1JYLA 2JCOA 1FWYA 5FU0A 4EE5A 3OH2A 1I52A 3I0KA 2O1GA 3U0YA 3OH4A 3SPTA 5J49A 1R7TA 1H5TA 2YQJA 3V0NA 1LL0A 1G0RA 2YCMA 1H5SC 3I0CA 2J0AA 3KIAA 3V8ZA 3V0LA 2V0HA 2VS3A 1JVDA 4FIYA 5IFYA 2J0BA 2X5ZA 2PA4A 1FO9A 2FFVA 3IOHA 4IRPA 2V0JA 1HM8A 3SXGA 5FYEA 3CKJA 2WE9A 5FU8A 1FG5N 1ON8A 4B4BA 4EVWA 1GWWA 4DECA 4BMAA 5BXCA 2AECA 1MP5A 3V91A 3CKNA 2WVLA 1G1LA 5CQNX 1R7XA 4BQHA 3N9WA 2UX8A 1R7VA 1H5SD 2OI5A 2BO8A 1QG8A 2XMHA 3JTJA 1VICA 2PX7A 3OH1A 1HM0A 4B2XA 5CMHA 2VK9A 3SX5A 4MIXA 4IRQA 4M4KA 3SXCA 3I0GA 5C3AA 1LZ7A 4EEOA 1IINA 3CU0A 4HO0A 1ZJ3A 4G87A 2GGOA 2P72A 3FWWA 1ZHJA 1YP4A 1R7UA 1GWVA 4Y64A 1HM9A 3OH3A 1VZTA 2JCJA 4UEGA 5CQPA 4FRMA 4EEMA 3I0EA 1WT1A 2XWNA 1R80A 4HO4A 1WT3A 4D11A 1PZYB 1H7TA 4HO5A 1ZI1A 2X5SA 3D98A 1H7HA 1S4NA 5CQOA 5HS2A 1H7QA 4ASYA 4KC2A 3SX8A 2VS4A 1FRWA 2YQSA 1PZTA 2BO6A 2CU2A 2I7BA 2QKXA 2AH9A 2RJ9A 4O6NA 5C4EA 1FXOA 1YP2A 2RJ7A 1G3LA 2Z87A 5EJ1A 2FY7A 2OEGA 1ZJ1A 1FOAA 1ZJOA 5L6SA 2Z86A 2VSIA 3DK5A 1WT2A 3U2WA 1LZIA 3CGXA 2ICYA 1OQMB 4JD0A 1H7LA 2XWMA 1GX0A 5FTSA 2O1HA 2Y4JA 2YQCA 1FR8A 2WEEA 3R2WA 2NXVA 4Q7CA 5C8RA 4MNDA 4LW6A 4Y7UA 2X65A 5C1HA 3F1CA 3HL3A 1WVCA 2RJ4A 1H5TB 1VGUA 1NMMB 1ZI4A 2FYDB 3ZLKA 4FRHA 4Y7FA 2RJ0A 1TW5A 2RJ5A 2YESA 1QGSA 4EEAA 2RJ8A 2Q4JA 1H4CA 1NQIB 1R82A 1VH1A 4GBPA 4M2BA 2V0KA 3R3IA 5CQLX 3ST8A 1H5RA 5AJOA 3POLA 2YQHA 1K4VA 3CKVA 4YS8A 5CMJA 2VSHA 5CMFX 2JCKA 4CJBA 1H4EA 3SXBA 2Y6PA 4HCQA 4D0ZA 1OMZA
chains in the Genus database with same CATH topology
3BRKX 1SS9A 4KQLA 2AM5A 3V0PA 3U2XA 1EZIA 3DUVA 2QH5A 1KWSA 1FXJA 3CKOA 4Y6UA 1NWGB 4HO8A 3ZLLA 4KPXA 5C1LA 5CMGX 1TVYA 3D5NA 2I5EA 1G97A 4KNXA 4HG6A 4HOCA 1O7QA 1VZUA 1INJA 1FGGA 1ON6A 2WGZA 3V0OA 4ECMA 4M2AA 4FCEA 1FR9A 1YP3A 1MP3A 2OEFA 4ARWA 2PGYA 1TZFA 1ZI5A 3TQDA 2VXLA 5IDTA 1ZCYA 1JYKA 2Y4KA 1VGZA 2C0NA 1H7FA 5C4FA 1ZCVA 3RMVA 1FZWA 4XWIA 2BO7A 4ZDQA 5FV9A 2X60A 2Y4MA 4EE4A 4NANA 1INIA 5C1GA 1QGQA 2RJ6A 4KXOA 5I1FA 4FRDA 3DJ4A 4EEGA 3BCVA 2E8BA 4HO6A 1H5SB 2W0WA 2YC5A 2D0JA 4MYBA 2XMEA 3T7NA 3V8YA 2E3DA 1W77A 2D7RA 2Y4LA 2WAWA 2RIYA 1G2VA 3PNNA 2VXMA 1O23B 3OKRA 3Q7UA 3OH0A 3K8EA 1Z90A 1WSZA 2AE7A 4KC1A 2O1FA 3USQA 4FCUA 3K8DA 4LW3A 1O0RA 4Y7TA 4D0TA 2Y7AA 2MZBA 2FYBA 1VZXA 2RJ1A 4B4GA 3OGZA 4Y9XA 3V0QA 4B5BA 3GUEA 1HJLA 1E5KA 2ZU8A 2RIZA 3Q80A 2AESA 2OI6A 4Y7VA 3V90A 1ZCUA 1MC3A 3T7MA 1NHEB 5C47A 4B4MA 2WVMA 3U2VA 1FO8A 1VPAA 1H5RB 3ZGGA 4AYJA 3I0IX 1LZJA 3ZF8A 3T7OA 5C49A 3SXAA 4FQWA 2RITA 5C4CA 4JISA 3E26A 4FRPA 4FRAA 4AC3A 2P73A 1S4PA 4B2WA 3SXEA 2W0VA 2ZU9A 1S4OA 1V84A 2RIXA 2ZU7A 4EE3A 3IOIA 5C38A 5DDVA 3RSBA 1R7YA 1VM8A 2FFUA 3I0DA 2WVKA 1VGWA 1ZDFA 1JVGA 1GX4A 5JQQA 4AAWA 4Y7GA 3PKQA 3OC9A 3V0MA 2A8WA 1H7EA 3TZTA 2ICXA 1ZCTA 1ZI3A 3RMWA 3U2UA 5AJNA 4O6MA 1V82A 4K6RA 4L41C 1R81A 5CMIA 4NALA 3I0FA 2GGQA 4Y63A 2A8UA 2AM3A 4HO9A 2JCLA 4DE7A 1NKHB 2FYCB 1LL3A 4G3QA 5C48A 1V83A 3FOQA 1TW1A 2QGIA 5DDTA 3I0JA 4B42A 5C36A 2AGDA 1ZJPA 3D8VA 4CJCA 3EE5A 4Y6NA 4B3UA 1HJJA 2OI7A 3U2TA 1ZJ0A 2P6WA 1VGTA 3SXDA 1LL2A 3SX7A 3I0LA 3U0XA 2DPWA 4HO2A 4G3PA 3USRA 4CVHA 1MP4A 3Q4SA 3O3PA 3IOJA 1G8OA 5FUHA 4P02A 5C3DA 2VD4A 4M28A 5IDSA 5C3BA 1XHBA 3JUKA 5EIYA 1GA8A 1W57A 3NGWA 4G3SA 4Y62A 1O7OA 3SX3A 1QWJA 1G9RA 4AYLA 3PKPA 5EJZA 4FREA 1NF5B 1JV3A 4NAIA 4J18A 4CJ8A 5C4BA 4FRBA 1G93A 3F1YA 4ASJA 3ZGFA 1H7GA 2BO4A 3OAMA 1ZJ2A 5D92A 2VFZA 4NAKA 1EYRA 1VH3A 4DDZA 2V0LA 3LW6A 1XZ6A 1JV1A 4HO3A 5CQMX 1IIMA 2VS5A 1WT0A 5C4DA 1LZ0A 3I0HA 2YC3A 1YROB 1H5SA 1LVWA 4E1KA 1G23A 1GQCA 4KT7A 1FGXA 2PGVA 4KC4A 3QVBA 1HV9A 4FRLA 5L6VA 2V0IA 1H4DA 4FIXA 5FTVA 4FRQA 4R7PA 3JUJA 2FYAA 4D48A 4KPZA 1H3MA 1W55A 1GQ9A 4C2SA 1ZIZA 4KRVA 4P00A 4FROA 1OMXA 1ZDGA 3E25A 2D7IA 5D91A 2APCA 1G95A 2AM4A 5AJPA 3CKQA 4D11C 2I5KA 4KNRA 2XWLA 1JYLA 2JCOA 1FWYA 5FU0A 4EE5A 3OH2A 1I52A 3I0KA 2O1GA 3U0YA 3OH4A 3SPTA 5J49A 1R7TA 1H5TA 2YQJA 3V0NA 1LL0A 1G0RA 2YCMA 1H5SC 3I0CA 2J0AA 3KIAA 3V8ZA 3V0LA 2V0HA 2VS3A 1JVDA 4FIYA 5IFYA 2J0BA 2X5ZA 2PA4A 1FO9A 2FFVA 3IOHA 4IRPA 2V0JA 1HM8A 3SXGA 5FYEA 3CKJA 2WE9A 5FU8A 1FG5N 1ON8A 4B4BA 4EVWA 1GWWA 4DECA 4BMAA 5BXCA 2AECA 1MP5A 3V91A 3CKNA 2WVLA 1G1LA 5CQNX 1R7XA 4BQHA 3N9WA 2UX8A 1R7VA 1H5SD 2OI5A 2BO8A 1QG8A 2XMHA 3JTJA 1VICA 2PX7A 3OH1A 1HM0A 4B2XA 5CMHA 2VK9A 3SX5A 4MIXA 4IRQA 4M4KA 3SXCA 3I0GA 5C3AA 1LZ7A 4EEOA 1IINA 3CU0A 4HO0A 1ZJ3A 4G87A 2GGOA 2P72A 3FWWA 1ZHJA 1YP4A 1R7UA 1GWVA 4Y64A 1HM9A 3OH3A 1VZTA 2JCJA 4UEGA 5CQPA 4FRMA 4EEMA 3I0EA 1WT1A 2XWNA 1R80A 4HO4A 1WT3A 4D11A 1PZYB 1H7TA 4HO5A 1ZI1A 2X5SA 3D98A 1H7HA 1S4NA 5CQOA 5HS2A 1H7QA 4ASYA 4KC2A 3SX8A 2VS4A 1FRWA 2YQSA 1PZTA 2BO6A 2CU2A 2I7BA 2QKXA 2AH9A 2RJ9A 4O6NA 5C4EA 1FXOA 1YP2A 2RJ7A 1G3LA 2Z87A 5EJ1A 2FY7A 2OEGA 1ZJ1A 1FOAA 1ZJOA 5L6SA 2Z86A 2VSIA 3DK5A 1WT2A 3U2WA 1LZIA 3CGXA 2ICYA 1OQMB 4JD0A 1H7LA 2XWMA 1GX0A 5FTSA 2O1HA 2Y4JA 2YQCA 1FR8A 2WEEA 3R2WA 2NXVA 4Q7CA 5C8RA 4MNDA 4LW6A 4Y7UA 2X65A 5C1HA 3F1CA 3HL3A 1WVCA 2RJ4A 1H5TB 1VGUA 1NMMB 1ZI4A 2FYDB 3ZLKA 4FRHA 4Y7FA 2RJ0A 1TW5A 2RJ5A 2YESA 1QGSA 4EEAA 2RJ8A 2Q4JA 1H4CA 1NQIB 1R82A 1VH1A 4GBPA 4M2BA 2V0KA 3R3IA 5CQLX 3ST8A 1H5RA 5AJOA 3POLA 2YQHA 1K4VA 3CKVA 4YS8A 5CMJA 2VSHA 5CMFX 2JCKA 4CJBA 1H4EA 3SXBA 2Y6PA 4HCQA 4D0ZA 1OMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRK X;  1SS9 A;  4KQL A;  2AM5 A;  3V0P A;  3U2X A;  1EZI A;  3DUV A;  2QH5 A;  1KWS A;  1FXJ A;  3CKO A;  4Y6U A;  1NWG B;  4HO8 A;  3ZLL A;  4KPX A;  5C1L A;  5CMG X;  1TVY A;  3D5N A;  2I5E A;  1G97 A;  4KNX A;  4HG6 A;  4HOC A;  1O7Q A;  1VZU A;  1INJ A;  1FGG A;  1ON6 A;  2WGZ A;  3V0O A;  4ECM A;  4M2A A;  4FCE A;  1FR9 A;  1YP3 A;  1MP3 A;  2OEF A;  4ARW A;  2PGY A;  1TZF A;  1ZI5 A;  3TQD A;  2VXL A;  5IDT A;  1ZCY A;  1JYK A;  2Y4K A;  1VGZ A;  1H7F A;  5C4F A;  1ZCV A;  3RMV A;  1FZW A;  4XWI A;  2BO7 A;  4ZDQ A;  5FV9 A;  2X60 A;  2Y4M A;  4EE4 A;  4NAN A;  1INI A;  5C1G A;  1QGQ A;  2RJ6 A;  4KXO A;  5I1F A;  4FRD A;  3DJ4 A;  4EEG A;  3BCV A;  2E8B A;  4HO6 A;  1H5S B;  2W0W A;  2YC5 A;  2D0J A;  4MYB A;  2XME A;  3T7N A;  3V8Y A;  2E3D A;  1W77 A;  2D7R A;  2Y4L A;  2WAW A;  2RIY A;  1G2V A;  3PNN A;  2VXM A;  1O23 B;  3OKR A;  3Q7U A;  3OH0 A;  3K8E A;  1Z90 A;  1WSZ A;  2AE7 A;  4KC1 A;  2O1F A;  3USQ A;  4FCU A;  3K8D A;  4LW3 A;  1O0R A;  4Y7T A;  4D0T A;  2Y7A A;  2MZB A;  2FYB A;  1VZX A;  2RJ1 A;  4B4G A;  3OGZ A;  4Y9X A;  3V0Q A;  4B5B A;  3GUE A;  1HJL A;  1E5K A;  2ZU8 A;  2RIZ A;  3Q80 A;  2AES A;  2OI6 A;  4Y7V A;  3V90 A;  1ZCU A;  1MC3 A;  3T7M A;  1NHE B;  5C47 A;  4B4M A;  2WVM A;  3U2V A;  1FO8 A;  1VPA A;  1H5R B;  3ZGG A;  4AYJ A;  3I0I X;  1LZJ A;  3ZF8 A;  3T7O A;  5C49 A;  3SXA A;  4FQW A;  2RIT A;  5C4C A;  4JIS A;  3E26 A;  4FRP A;  4FRA A;  4AC3 A;  2P73 A;  1S4P A;  4B2W A;  3SXE A;  2W0V A;  2ZU9 A;  1S4O A;  1V84 A;  2RIX A;  2ZU7 A;  4EE3 A;  3IOI A;  5C38 A;  5DDV A;  3RSB A;  1R7Y A;  1VM8 A;  2FFU A;  3I0D A;  2WVK A;  1VGW A;  1ZDF A;  1JVG A;  1GX4 A;  5JQQ A;  4AAW A;  4Y7G A;  3PKQ A;  3OC9 A;  3V0M A;  2A8W A;  1H7E A;  3TZT A;  2ICX A;  1ZCT A;  1ZI3 A;  3RMW A;  3U2U A;  5AJN A;  1V82 A;  4K6R A;  4L41 C;  1R81 A;  5CMI A;  4NAL A;  3I0F A;  2GGQ A;  4Y63 A;  2A8U A;  2AM3 A;  4HO9 A;  2JCL A;  4DE7 A;  1NKH B;  2FYC B;  1LL3 A;  4G3Q A;  5C48 A;  1V83 A;  3FOQ A;  1TW1 A;  2QGI A;  5DDT A;  3I0J A;  4B42 A;  5C36 A;  2AGD A;  1ZJP A;  3D8V A;  4CJC A;  3EE5 A;  4Y6N A;  4B3U A;  1HJJ A;  2OI7 A;  3U2T A;  1ZJ0 A;  2P6W A;  1VGT A;  3SXD A;  1LL2 A;  3SX7 A;  3I0L A;  3U0X A;  2DPW A;  4HO2 A;  4G3P A;  3USR A;  4CVH A;  1MP4 A;  3Q4S A;  3O3P A;  3IOJ A;  1G8O A;  5FUH A;  4P02 A;  5C3D A;  2VD4 A;  4M28 A;  5IDS A;  5C3B A;  1XHB A;  3JUK A;  5EIY A;  1GA8 A;  1W57 A;  3NGW A;  4G3S A;  4Y62 A;  1O7O A;  3SX3 A;  1QWJ A;  1G9R A;  4AYL A;  3PKP A;  5EJZ A;  4FRE A;  1NF5 B;  1JV3 A;  4NAI A;  4J18 A;  4CJ8 A;  5C4B A;  4FRB A;  1G93 A;  3F1Y A;  4ASJ A;  3ZGF A;  1H7G A;  2BO4 A;  3OAM A;  1ZJ2 A;  2VFZ A;  4NAK A;  1EYR A;  1VH3 A;  4DDZ A;  2V0L A;  3LW6 A;  1XZ6 A;  1JV1 A;  4HO3 A;  5CQM X;  1IIM A;  2VS5 A;  1WT0 A;  5C4D A;  1LZ0 A;  3I0H A;  2YC3 A;  1YRO B;  1H5S A;  1LVW A;  4E1K A;  1G23 A;  1GQC A;  4KT7 A;  1FGX A;  2PGV A;  4KC4 A;  3QVB A;  1HV9 A;  4FRL A;  5L6V A;  2V0I A;  1H4D A;  5FTV A;  4FRQ A;  4R7P A;  3JUJ A;  2FYA A;  4D48 A;  4KPZ A;  1H3M A;  1W55 A;  1GQ9 A;  4C2S A;  1ZIZ A;  4KRV A;  4P00 A;  4FRO A;  1OMX A;  1ZDG A;  3E25 A;  2D7I A;  2APC A;  1G95 A;  2AM4 A;  5AJP A;  3CKQ A;  4D11 C;  2I5K A;  4KNR A;  2XWL A;  1JYL A;  2JCO A;  1FWY A;  5FU0 A;  4EE5 A;  3OH2 A;  1I52 A;  3I0K A;  2O1G A;  3U0Y A;  3OH4 A;  3SPT A;  5J49 A;  1R7T A;  1H5T A;  2YQJ A;  3V0N A;  1LL0 A;  1G0R A;  2YCM A;  1H5S C;  3I0C A;  3KIA A;  3V8Z A;  3V0L A;  2V0H A;  2VS3 A;  1JVD A;  5IFY A;  2X5Z A;  2PA4 A;  1FO9 A;  2FFV A;  3IOH A;  4IRP A;  2V0J A;  1HM8 A;  3SXG A;  5FYE A;  3CKJ A;  2WE9 A;  5FU8 A;  1FG5 N;  1ON8 A;  4B4B A;  4EVW A;  1GWW A;  4DEC A;  4BMA A;  5BXC A;  2AEC A;  1MP5 A;  3V91 A;  3CKN A;  2WVL A;  1G1L A;  5CQN X;  1R7X A;  4BQH A;  3N9W A;  2UX8 A;  1R7V A;  1H5S D;  2OI5 A;  2BO8 A;  1QG8 A;  2XMH A;  3JTJ A;  1VIC A;  2PX7 A;  3OH1 A;  1HM0 A;  4B2X A;  5CMH A;  3SX5 A;  4IRQ A;  4M4K A;  3SXC A;  3I0G A;  5C3A A;  1LZ7 A;  4EEO A;  1IIN A;  3CU0 A;  4HO0 A;  1ZJ3 A;  4G87 A;  2GGO A;  2P72 A;  3FWW A;  1ZHJ A;  1YP4 A;  1R7U A;  1GWV A;  4Y64 A;  1HM9 A;  3OH3 A;  1VZT A;  2JCJ A;  4UEG A;  5CQP A;  4FRM A;  4EEM A;  3I0E A;  1WT1 A;  2XWN A;  1R80 A;  4HO4 A;  1WT3 A;  4D11 A;  1PZY B;  1H7T A;  4HO5 A;  1ZI1 A;  2X5S A;  3D98 A;  1H7H A;  1S4N A;  5CQO A;  5HS2 A;  1H7Q A;  4ASY A;  4KC2 A;  3SX8 A;  2VS4 A;  1FRW A;  2YQS A;  1PZT A;  2BO6 A;  2CU2 A;  2I7B A;  2QKX A;  2AH9 A;  2RJ9 A;  5C4E A;  1FXO A;  1YP2 A;  2RJ7 A;  1G3L A;  2Z87 A;  5EJ1 A;  2FY7 A;  2OEG A;  1ZJ1 A;  1FOA A;  1ZJO A;  5L6S A;  2Z86 A;  2VSI A;  3DK5 A;  1WT2 A;  3U2W A;  1LZI A;  3CGX A;  2ICY A;  1OQM B;  4JD0 A;  1H7L A;  2XWM A;  1GX0 A;  5FTS A;  2O1H A;  2Y4J A;  2YQC A;  1FR8 A;  2WEE A;  3R2W A;  2NXV A;  5C8R A;  4MND A;  4LW6 A;  4Y7U A;  2X65 A;  5C1H A;  3F1C A;  3HL3 A;  1WVC A;  2RJ4 A;  1H5T B;  1VGU A;  1NMM B;  1ZI4 A;  2FYD B;  3ZLK A;  4FRH A;  4Y7F A;  2RJ0 A;  1TW5 A;  2RJ5 A;  2YES A;  1QGS A;  4EEA A;  2RJ8 A;  2Q4J A;  1H4C A;  1NQI B;  1R82 A;  1VH1 A;  4GBP A;  4M2B A;  2V0K A;  3R3I A;  5CQL X;  3ST8 A;  1H5R A;  5AJO A;  3POL A;  2YQH A;  1K4V A;  3CKV A;  4YS8 A;  5CMJ A;  2VSH A;  5CMF X;  2JCK A;  4CJB A;  1H4E A;  3SXB A;  2Y6P A;  4HCQ A;  4D0Z A;  1OMZ A; 
#chains in the Genus database with same CATH topology
 3BRK X;  1SS9 A;  4KQL A;  2AM5 A;  3V0P A;  3U2X A;  1EZI A;  3DUV A;  2QH5 A;  1KWS A;  1FXJ A;  3CKO A;  4Y6U A;  1NWG B;  4HO8 A;  3ZLL A;  4KPX A;  5C1L A;  5CMG X;  1TVY A;  3D5N A;  2I5E A;  1G97 A;  4KNX A;  4HG6 A;  4HOC A;  1O7Q A;  1VZU A;  1INJ A;  1FGG A;  1ON6 A;  2WGZ A;  3V0O A;  4ECM A;  4M2A A;  4FCE A;  1FR9 A;  1YP3 A;  1MP3 A;  2OEF A;  4ARW A;  2PGY A;  1TZF A;  1ZI5 A;  3TQD A;  2VXL A;  5IDT A;  1ZCY A;  1JYK A;  2Y4K A;  1VGZ A;  2C0N A;  1H7F A;  5C4F A;  1ZCV A;  3RMV A;  1FZW A;  4XWI A;  2BO7 A;  4ZDQ A;  5FV9 A;  2X60 A;  2Y4M A;  4EE4 A;  4NAN A;  1INI A;  5C1G A;  1QGQ A;  2RJ6 A;  4KXO A;  5I1F A;  4FRD A;  3DJ4 A;  4EEG A;  3BCV A;  2E8B A;  4HO6 A;  1H5S B;  2W0W A;  2YC5 A;  2D0J A;  4MYB A;  2XME A;  3T7N A;  3V8Y A;  2E3D A;  1W77 A;  2D7R A;  2Y4L A;  2WAW A;  2RIY A;  1G2V A;  3PNN A;  2VXM A;  1O23 B;  3OKR A;  3Q7U A;  3OH0 A;  3K8E A;  1Z90 A;  1WSZ A;  2AE7 A;  4KC1 A;  2O1F A;  3USQ A;  4FCU A;  3K8D A;  4LW3 A;  1O0R A;  4Y7T A;  4D0T A;  2Y7A A;  2MZB A;  2FYB A;  1VZX A;  2RJ1 A;  4B4G A;  3OGZ A;  4Y9X A;  3V0Q A;  4B5B A;  3GUE A;  1HJL A;  1E5K A;  2ZU8 A;  2RIZ A;  3Q80 A;  2AES A;  2OI6 A;  4Y7V A;  3V90 A;  1ZCU A;  1MC3 A;  3T7M A;  1NHE B;  5C47 A;  4B4M A;  2WVM A;  3U2V A;  1FO8 A;  1VPA A;  1H5R B;  3ZGG A;  4AYJ A;  3I0I X;  1LZJ A;  3ZF8 A;  3T7O A;  5C49 A;  3SXA A;  4FQW A;  2RIT A;  5C4C A;  4JIS A;  3E26 A;  4FRP A;  4FRA A;  4AC3 A;  2P73 A;  1S4P A;  4B2W A;  3SXE A;  2W0V A;  2ZU9 A;  1S4O A;  1V84 A;  2RIX A;  2ZU7 A;  4EE3 A;  3IOI A;  5C38 A;  5DDV A;  3RSB A;  1R7Y A;  1VM8 A;  2FFU A;  3I0D A;  2WVK A;  1VGW A;  1ZDF A;  1JVG A;  1GX4 A;  5JQQ A;  4AAW A;  4Y7G A;  3PKQ A;  3OC9 A;  3V0M A;  2A8W A;  1H7E A;  3TZT A;  2ICX A;  1ZCT A;  1ZI3 A;  3RMW A;  3U2U A;  5AJN A;  4O6M A;  1V82 A;  4K6R A;  4L41 C;  1R81 A;  5CMI A;  4NAL A;  3I0F A;  2GGQ A;  4Y63 A;  2A8U A;  2AM3 A;  4HO9 A;  2JCL A;  4DE7 A;  1NKH B;  2FYC B;  1LL3 A;  4G3Q A;  5C48 A;  1V83 A;  3FOQ A;  1TW1 A;  2QGI A;  5DDT A;  3I0J A;  4B42 A;  5C36 A;  2AGD A;  1ZJP A;  3D8V A;  4CJC A;  3EE5 A;  4Y6N A;  4B3U A;  1HJJ A;  2OI7 A;  3U2T A;  1ZJ0 A;  2P6W A;  1VGT A;  3SXD A;  1LL2 A;  3SX7 A;  3I0L A;  3U0X A;  2DPW A;  4HO2 A;  4G3P A;  3USR A;  4CVH A;  1MP4 A;  3Q4S A;  3O3P A;  3IOJ A;  1G8O A;  5FUH A;  4P02 A;  5C3D A;  2VD4 A;  4M28 A;  5IDS A;  5C3B A;  1XHB A;  3JUK A;  5EIY A;  1GA8 A;  1W57 A;  3NGW A;  4G3S A;  4Y62 A;  1O7O A;  3SX3 A;  1QWJ A;  1G9R A;  4AYL A;  3PKP A;  5EJZ A;  4FRE A;  1NF5 B;  1JV3 A;  4NAI A;  4J18 A;  4CJ8 A;  5C4B A;  4FRB A;  1G93 A;  3F1Y A;  4ASJ A;  3ZGF A;  1H7G A;  2BO4 A;  3OAM A;  1ZJ2 A;  5D92 A;  2VFZ A;  4NAK A;  1EYR A;  1VH3 A;  4DDZ A;  2V0L A;  3LW6 A;  1XZ6 A;  1JV1 A;  4HO3 A;  5CQM X;  1IIM A;  2VS5 A;  1WT0 A;  5C4D A;  1LZ0 A;  3I0H A;  2YC3 A;  1YRO B;  1H5S A;  1LVW A;  4E1K A;  1G23 A;  1GQC A;  4KT7 A;  1FGX A;  2PGV A;  4KC4 A;  3QVB A;  1HV9 A;  4FRL A;  5L6V A;  2V0I A;  1H4D A;  4FIX A;  5FTV A;  4FRQ A;  4R7P A;  3JUJ A;  2FYA A;  4D48 A;  4KPZ A;  1H3M A;  1W55 A;  1GQ9 A;  4C2S A;  1ZIZ A;  4KRV A;  4P00 A;  4FRO A;  1OMX A;  1ZDG A;  3E25 A;  2D7I A;  5D91 A;  2APC A;  1G95 A;  2AM4 A;  5AJP A;  3CKQ A;  4D11 C;  2I5K A;  4KNR A;  2XWL A;  1JYL A;  2JCO A;  1FWY A;  5FU0 A;  4EE5 A;  3OH2 A;  1I52 A;  3I0K A;  2O1G A;  3U0Y A;  3OH4 A;  3SPT A;  5J49 A;  1R7T A;  1H5T A;  2YQJ A;  3V0N A;  1LL0 A;  1G0R A;  2YCM A;  1H5S C;  3I0C A;  2J0A A;  3KIA A;  3V8Z A;  3V0L A;  2V0H A;  2VS3 A;  1JVD A;  4FIY A;  5IFY A;  2J0B A;  2X5Z A;  2PA4 A;  1FO9 A;  2FFV A;  3IOH A;  4IRP A;  2V0J A;  1HM8 A;  3SXG A;  5FYE A;  3CKJ A;  2WE9 A;  5FU8 A;  1FG5 N;  1ON8 A;  4B4B A;  4EVW A;  1GWW A;  4DEC A;  4BMA A;  5BXC A;  2AEC A;  1MP5 A;  3V91 A;  3CKN A;  2WVL A;  1G1L A;  5CQN X;  1R7X A;  4BQH A;  3N9W A;  2UX8 A;  1R7V A;  1H5S D;  2OI5 A;  2BO8 A;  1QG8 A;  2XMH A;  3JTJ A;  1VIC A;  2PX7 A;  3OH1 A;  1HM0 A;  4B2X A;  5CMH A;  2VK9 A;  3SX5 A;  4MIX A;  4IRQ A;  4M4K A;  3SXC A;  3I0G A;  5C3A A;  1LZ7 A;  4EEO A;  1IIN A;  3CU0 A;  4HO0 A;  1ZJ3 A;  4G87 A;  2GGO A;  2P72 A;  3FWW A;  1ZHJ A;  1YP4 A;  1R7U A;  1GWV A;  4Y64 A;  1HM9 A;  3OH3 A;  1VZT A;  2JCJ A;  4UEG A;  5CQP A;  4FRM A;  4EEM A;  3I0E A;  1WT1 A;  2XWN A;  1R80 A;  4HO4 A;  1WT3 A;  4D11 A;  1PZY B;  1H7T A;  4HO5 A;  1ZI1 A;  2X5S A;  3D98 A;  1H7H A;  1S4N A;  5CQO A;  5HS2 A;  1H7Q A;  4ASY A;  4KC2 A;  3SX8 A;  2VS4 A;  1FRW A;  2YQS A;  1PZT A;  2BO6 A;  2CU2 A;  2I7B A;  2QKX A;  2AH9 A;  2RJ9 A;  4O6N A;  5C4E A;  1FXO A;  1YP2 A;  2RJ7 A;  1G3L A;  2Z87 A;  5EJ1 A;  2FY7 A;  2OEG A;  1ZJ1 A;  1FOA A;  1ZJO A;  5L6S A;  2Z86 A;  2VSI A;  3DK5 A;  1WT2 A;  3U2W A;  1LZI A;  3CGX A;  2ICY A;  1OQM B;  4JD0 A;  1H7L A;  2XWM A;  1GX0 A;  5FTS A;  2O1H A;  2Y4J A;  2YQC A;  1FR8 A;  2WEE A;  3R2W A;  2NXV A;  4Q7C A;  5C8R A;  4MND A;  4LW6 A;  4Y7U A;  2X65 A;  5C1H A;  3F1C A;  3HL3 A;  1WVC A;  2RJ4 A;  1H5T B;  1VGU A;  1NMM B;  1ZI4 A;  2FYD B;  3ZLK A;  4FRH A;  4Y7F A;  2RJ0 A;  1TW5 A;  2RJ5 A;  2YES A;  1QGS A;  4EEA A;  2RJ8 A;  2Q4J A;  1H4C A;  1NQI B;  1R82 A;  1VH1 A;  4GBP A;  4M2B A;  2V0K A;  3R3I A;  5CQL X;  3ST8 A;  1H5R A;  5AJO A;  3POL A;  2YQH A;  1K4V A;  3CKV A;  4YS8 A;  5CMJ A;  2VSH A;  5CMF X;  2JCK A;  4CJB A;  1H4E A;  3SXB A;  2Y6P A;  4HCQ A;  4D0Z A;  1OMZ A; 
#chains in the Genus database with same CATH homology
 3BRK X;  1SS9 A;  4KQL A;  2AM5 A;  3V0P A;  3U2X A;  1EZI A;  3DUV A;  2QH5 A;  1KWS A;  1FXJ A;  3CKO A;  4Y6U A;  1NWG B;  4HO8 A;  3ZLL A;  4KPX A;  5C1L A;  5CMG X;  1TVY A;  3D5N A;  2I5E A;  1G97 A;  4KNX A;  4HG6 A;  4HOC A;  1O7Q A;  1VZU A;  1INJ A;  1FGG A;  1ON6 A;  2WGZ A;  3V0O A;  4ECM A;  4M2A A;  4FCE A;  1FR9 A;  1YP3 A;  1MP3 A;  2OEF A;  4ARW A;  2PGY A;  1TZF A;  1ZI5 A;  3TQD A;  2VXL A;  5IDT A;  1ZCY A;  1JYK A;  2Y4K A;  1VGZ A;  2C0N A;  1H7F A;  5C4F A;  1ZCV A;  3RMV A;  1FZW A;  4XWI A;  2BO7 A;  4ZDQ A;  5FV9 A;  2X60 A;  2Y4M A;  4EE4 A;  4NAN A;  1INI A;  5C1G A;  1QGQ A;  2RJ6 A;  4KXO A;  5I1F A;  4FRD A;  3DJ4 A;  4EEG A;  3BCV A;  2E8B A;  4HO6 A;  1H5S B;  2W0W A;  2YC5 A;  2D0J A;  4MYB A;  2XME A;  3T7N A;  3V8Y A;  2E3D A;  1W77 A;  2D7R A;  2Y4L A;  2WAW A;  2RIY A;  1G2V A;  3PNN A;  2VXM A;  1O23 B;  3OKR A;  3Q7U A;  3OH0 A;  3K8E A;  1Z90 A;  1WSZ A;  2AE7 A;  4KC1 A;  2O1F A;  3USQ A;  4FCU A;  3K8D A;  4LW3 A;  1O0R A;  4Y7T A;  4D0T A;  2Y7A A;  2MZB A;  2FYB A;  1VZX A;  2RJ1 A;  4B4G A;  3OGZ A;  4Y9X A;  3V0Q A;  4B5B A;  3GUE A;  1HJL A;  1E5K A;  2ZU8 A;  2RIZ A;  3Q80 A;  2AES A;  2OI6 A;  4Y7V A;  3V90 A;  1ZCU A;  1MC3 A;  3T7M A;  1NHE B;  5C47 A;  4B4M A;  2WVM A;  3U2V A;  1FO8 A;  1VPA A;  1H5R B;  3ZGG A;  4AYJ A;  3I0I X;  1LZJ A;  3ZF8 A;  3T7O A;  5C49 A;  3SXA A;  4FQW A;  2RIT A;  5C4C A;  4JIS A;  3E26 A;  4FRP A;  4FRA A;  4AC3 A;  2P73 A;  1S4P A;  4B2W A;  3SXE A;  2W0V A;  2ZU9 A;  1S4O A;  1V84 A;  2RIX A;  2ZU7 A;  4EE3 A;  3IOI A;  5C38 A;  5DDV A;  3RSB A;  1R7Y A;  1VM8 A;  2FFU A;  3I0D A;  2WVK A;  1VGW A;  1ZDF A;  1JVG A;  1GX4 A;  5JQQ A;  4AAW A;  4Y7G A;  3PKQ A;  3OC9 A;  3V0M A;  2A8W A;  1H7E A;  3TZT A;  2ICX A;  1ZCT A;  1ZI3 A;  3RMW A;  3U2U A;  5AJN A;  4O6M A;  1V82 A;  4K6R A;  4L41 C;  1R81 A;  5CMI A;  4NAL A;  3I0F A;  2GGQ A;  4Y63 A;  2A8U A;  2AM3 A;  4HO9 A;  2JCL A;  4DE7 A;  1NKH B;  2FYC B;  1LL3 A;  4G3Q A;  5C48 A;  1V83 A;  3FOQ A;  1TW1 A;  2QGI A;  5DDT A;  3I0J A;  4B42 A;  5C36 A;  2AGD A;  1ZJP A;  3D8V A;  4CJC A;  3EE5 A;  4Y6N A;  4B3U A;  1HJJ A;  2OI7 A;  3U2T A;  1ZJ0 A;  2P6W A;  1VGT A;  3SXD A;  1LL2 A;  3SX7 A;  3I0L A;  3U0X A;  2DPW A;  4HO2 A;  4G3P A;  3USR A;  4CVH A;  1MP4 A;  3Q4S A;  3O3P A;  3IOJ A;  1G8O A;  5FUH A;  4P02 A;  5C3D A;  2VD4 A;  4M28 A;  5IDS A;  5C3B A;  1XHB A;  3JUK A;  5EIY A;  1GA8 A;  1W57 A;  3NGW A;  4G3S A;  4Y62 A;  1O7O A;  3SX3 A;  1QWJ A;  1G9R A;  4AYL A;  3PKP A;  5EJZ A;  4FRE A;  1NF5 B;  1JV3 A;  4NAI A;  4J18 A;  4CJ8 A;  5C4B A;  4FRB A;  1G93 A;  3F1Y A;  4ASJ A;  3ZGF A;  1H7G A;  2BO4 A;  3OAM A;  1ZJ2 A;  5D92 A;  2VFZ A;  4NAK A;  1EYR A;  1VH3 A;  4DDZ A;  2V0L A;  3LW6 A;  1XZ6 A;  1JV1 A;  4HO3 A;  5CQM X;  1IIM A;  2VS5 A;  1WT0 A;  5C4D A;  1LZ0 A;  3I0H A;  2YC3 A;  1YRO B;  1H5S A;  1LVW A;  4E1K A;  1G23 A;  1GQC A;  4KT7 A;  1FGX A;  2PGV A;  4KC4 A;  3QVB A;  1HV9 A;  4FRL A;  5L6V A;  2V0I A;  1H4D A;  4FIX A;  5FTV A;  4FRQ A;  4R7P A;  3JUJ A;  2FYA A;  4D48 A;  4KPZ A;  1H3M A;  1W55 A;  1GQ9 A;  4C2S A;  1ZIZ A;  4KRV A;  4P00 A;  4FRO A;  1OMX A;  1ZDG A;  3E25 A;  2D7I A;  5D91 A;  2APC A;  1G95 A;  2AM4 A;  5AJP A;  3CKQ A;  4D11 C;  2I5K A;  4KNR A;  2XWL A;  1JYL A;  2JCO A;  1FWY A;  5FU0 A;  4EE5 A;  3OH2 A;  1I52 A;  3I0K A;  2O1G A;  3U0Y A;  3OH4 A;  3SPT A;  5J49 A;  1R7T A;  1H5T A;  2YQJ A;  3V0N A;  1LL0 A;  1G0R A;  2YCM A;  1H5S C;  3I0C A;  2J0A A;  3KIA A;  3V8Z A;  3V0L A;  2V0H A;  2VS3 A;  1JVD A;  4FIY A;  5IFY A;  2J0B A;  2X5Z A;  2PA4 A;  1FO9 A;  2FFV A;  3IOH A;  4IRP A;  2V0J A;  1HM8 A;  3SXG A;  5FYE A;  3CKJ A;  2WE9 A;  5FU8 A;  1FG5 N;  1ON8 A;  4B4B A;  4EVW A;  1GWW A;  4DEC A;  4BMA A;  5BXC A;  2AEC A;  1MP5 A;  3V91 A;  3CKN A;  2WVL A;  1G1L A;  5CQN X;  1R7X A;  4BQH A;  3N9W A;  2UX8 A;  1R7V A;  1H5S D;  2OI5 A;  2BO8 A;  1QG8 A;  2XMH A;  3JTJ A;  1VIC A;  2PX7 A;  3OH1 A;  1HM0 A;  4B2X A;  5CMH A;  2VK9 A;  3SX5 A;  4MIX A;  4IRQ A;  4M4K A;  3SXC A;  3I0G A;  5C3A A;  1LZ7 A;  4EEO A;  1IIN A;  3CU0 A;  4HO0 A;  1ZJ3 A;  4G87 A;  2GGO A;  2P72 A;  3FWW A;  1ZHJ A;  1YP4 A;  1R7U A;  1GWV A;  4Y64 A;  1HM9 A;  3OH3 A;  1VZT A;  2JCJ A;  4UEG A;  5CQP A;  4FRM A;  4EEM A;  3I0E A;  1WT1 A;  2XWN A;  1R80 A;  4HO4 A;  1WT3 A;  4D11 A;  1PZY B;  1H7T A;  4HO5 A;  1ZI1 A;  2X5S A;  3D98 A;  1H7H A;  1S4N A;  5CQO A;  5HS2 A;  1H7Q A;  4ASY A;  4KC2 A;  3SX8 A;  2VS4 A;  1FRW A;  2YQS A;  1PZT A;  2BO6 A;  2CU2 A;  2I7B A;  2QKX A;  2AH9 A;  2RJ9 A;  4O6N A;  5C4E A;  1FXO A;  1YP2 A;  2RJ7 A;  1G3L A;  2Z87 A;  5EJ1 A;  2FY7 A;  2OEG A;  1ZJ1 A;  1FOA A;  1ZJO A;  5L6S A;  2Z86 A;  2VSI A;  3DK5 A;  1WT2 A;  3U2W A;  1LZI A;  3CGX A;  2ICY A;  1OQM B;  4JD0 A;  1H7L A;  2XWM A;  1GX0 A;  5FTS A;  2O1H A;  2Y4J A;  2YQC A;  1FR8 A;  2WEE A;  3R2W A;  2NXV A;  4Q7C A;  5C8R A;  4MND A;  4LW6 A;  4Y7U A;  2X65 A;  5C1H A;  3F1C A;  3HL3 A;  1WVC A;  2RJ4 A;  1H5T B;  1VGU A;  1NMM B;  1ZI4 A;  2FYD B;  3ZLK A;  4FRH A;  4Y7F A;  2RJ0 A;  1TW5 A;  2RJ5 A;  2YES A;  1QGS A;  4EEA A;  2RJ8 A;  2Q4J A;  1H4C A;  1NQI B;  1R82 A;  1VH1 A;  4GBP A;  4M2B A;  2V0K A;  3R3I A;  5CQL X;  3ST8 A;  1H5R A;  5AJO A;  3POL A;  2YQH A;  1K4V A;  3CKV A;  4YS8 A;  5CMJ A;  2VSH A;  5CMF X;  2JCK A;  4CJB A;  1H4E A;  3SXB A;  2Y6P A;  4HCQ A;  4D0Z A;  1OMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...